Metagenome Family F040952

Overview

Basic Information

• Family ID: F040952
• Family Type: Metagenome
• Number of Sequences: 160
• Average Sequence Length: 44 residues
• Representative Sequence: QPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAA
• Number of Associated Samples: 54
• Number of Associated Scaffolds: 160

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 12.88 %
• % of genes near scaffold ends (potentially truncated): 73.12 %
• % of genes from short scaffolds (< 2000 bps): 81.88 %
• Associated GOLD sequencing projects: 54
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (85.625 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (98.750 % of family members)
• Environment Ontology (ENVO): Unclassified (98.750 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (98.750 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 56.52%
  β-sheet: 0.00%
  Coil/Unstructured: 43.48%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 160 Family Scaffolds
PF02666	PS_Dcarbxylase	1.25
PF14223	Retrotran_gag_2	0.62
PF14303	NAM-associated	0.62
PF13966	zf-RVT	0.62
PF01566	Nramp	0.62
PF00069	Pkinase	0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 160 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	2.50
COG0688	Phosphatidylserine decarboxylase	Lipid transport and metabolism [I]	1.25
COG1914	Mn2+ or Fe2+ transporter, NRAMP family	Inorganic ion transport and metabolism [P]	0.62

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
All Organisms	root	All Organisms	14.38 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
cellular organisms	root	All Organisms → cellular organisms	14.38 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	13.75 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.62 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	13.12 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.62 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	13.12 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.62 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	13.12 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	13.12 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	10.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	10.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	10.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	10.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	10.00 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	10.00 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	10.00 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	10.00 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	10.00 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	8.12 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	3.75 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	1.25 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	3.12 %
Pooideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae	1.25 %
Arundinoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae	0.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	1.88 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	1.25 %
Triticodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae	1.25 %
Arundineae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae	0.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	1.88 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	1.25 %
Triticeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	1.25 %
Arundo	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo	0.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	1.25 %
Hordeinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae	1.25 %
Tripsacinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae	0.62 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	0.62 %
Dichantheliinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae	0.62 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Hordeum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum	1.25 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	1.25 %
Zea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea	0.62 %
Dichanthelium	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium	0.62 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	0.62 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Hordeum vulgare	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare	1.25 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1.25 %
Dichanthelium oligosanthes	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	0.62 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.62 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.62 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Hordeum vulgare subsp. vulgare	subspecies	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare	1.25 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1.25 %
Dichanthelium oligosanthes	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	0.62 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.62 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.62 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005718|Ga0068866_10972153	Not Available	602
3300015267|Ga0182122_1022826	Not Available	691
3300015269|Ga0182113_1052515	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	608
3300015274|Ga0182188_1029596	Not Available	611
3300015277|Ga0182128_1049488	Not Available	578
3300015281|Ga0182160_1042539	Not Available	613
3300015282|Ga0182124_1002579	Not Available	1301
3300015283|Ga0182156_1011415	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	895
3300015283|Ga0182156_1014214	Not Available	844
3300015283|Ga0182156_1050569	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare	594
3300015283|Ga0182156_1070435	Not Available	538
3300015286|Ga0182176_1058819	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare	567
3300015287|Ga0182171_1076800	Not Available	525
3300015288|Ga0182173_1023626	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	727
3300015288|Ga0182173_1025194	Not Available	714
3300015291|Ga0182125_1053105	Not Available	598
3300015291|Ga0182125_1067988	All Organisms → cellular organisms → Eukaryota	556
3300015294|Ga0182126_1049134	Not Available	614
3300015294|Ga0182126_1050239	Not Available	610
3300015295|Ga0182175_1039300	Not Available	661
3300015295|Ga0182175_1070882	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	557
3300015298|Ga0182106_1016738	Not Available	857
3300015300|Ga0182108_1009596	Not Available	1013
3300015300|Ga0182108_1026003	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	765
3300015300|Ga0182108_1056953	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	610
3300015300|Ga0182108_1090033	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	530
3300015303|Ga0182123_1009539	Not Available	960
3300015303|Ga0182123_1069328	Not Available	559
3300015303|Ga0182123_1088736	Not Available	519
3300015304|Ga0182112_1081629	Not Available	545
3300015304|Ga0182112_1100496	Not Available	511
3300015305|Ga0182158_1064697	Not Available	583
3300015314|Ga0182140_1011624	Not Available	981
3300015314|Ga0182140_1034712	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	723
3300015314|Ga0182140_1065035	Not Available	603
3300015321|Ga0182127_1023907	Not Available	830
3300015322|Ga0182110_1048195	Not Available	674
3300015322|Ga0182110_1073323	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	595
3300015322|Ga0182110_1097542	Not Available	544
3300015323|Ga0182129_1084553	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	554
3300015323|Ga0182129_1102619	Not Available	522
3300015341|Ga0182187_1031768	Not Available	948
3300015341|Ga0182187_1035304	Not Available	917
3300015341|Ga0182187_1051506	Not Available	809
3300015341|Ga0182187_1121932	Not Available	602
3300015341|Ga0182187_1172317	Not Available	531
3300015342|Ga0182109_1000715	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	2931
3300015342|Ga0182109_1134149	Not Available	611
3300015342|Ga0182109_1150577	Not Available	585
3300015343|Ga0182155_1119210	Not Available	636
3300015343|Ga0182155_1131084	Not Available	614
3300015343|Ga0182155_1135627	Not Available	607
3300015343|Ga0182155_1210850	Not Available	515
3300015343|Ga0182155_1213727	Not Available	512
3300015343|Ga0182155_1217601	Not Available	509
3300015344|Ga0182189_1042275	Not Available	924
3300015344|Ga0182189_1074958	Not Available	760
3300015344|Ga0182189_1183677	Not Available	547
3300015345|Ga0182111_1013063	Not Available	1410
3300015345|Ga0182111_1026810	Not Available	1125
3300015345|Ga0182111_1054082	Not Available	884
3300015345|Ga0182111_1056921	Not Available	868
3300015345|Ga0182111_1072730	Not Available	795
3300015345|Ga0182111_1075350	Not Available	785
3300015345|Ga0182111_1111207	Not Available	681
3300015345|Ga0182111_1115874	Not Available	671
3300015345|Ga0182111_1148810	Not Available	610
3300015345|Ga0182111_1231809	Not Available	513
3300015346|Ga0182139_1129672	Not Available	644
3300015346|Ga0182139_1132779	Not Available	638
3300015346|Ga0182139_1163641	Not Available	589
3300015347|Ga0182177_1057905	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	869
3300015347|Ga0182177_1071452	Not Available	804
3300015351|Ga0182161_1025872	Not Available	1207
3300015351|Ga0182161_1028675	Not Available	1165
3300015351|Ga0182161_1079732	Not Available	808
3300015351|Ga0182161_1156540	Not Available	623
3300015351|Ga0182161_1203469	Not Available	562
3300015351|Ga0182161_1205645	Not Available	559
3300015351|Ga0182161_1215823	Not Available	548
3300015355|Ga0182159_1026525	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1410
3300015355|Ga0182159_1030034	Not Available	1351
3300015355|Ga0182159_1051568	Not Available	1111
3300015355|Ga0182159_1125687	Not Available	781
3300015355|Ga0182159_1200827	Not Available	642
3300015355|Ga0182159_1236104	Not Available	598
3300015355|Ga0182159_1256903	Not Available	577
3300015355|Ga0182159_1295909	Not Available	542
3300015355|Ga0182159_1311423	Not Available	530
3300015361|Ga0182145_1012284	Not Available	1205
3300015361|Ga0182145_1015883	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1118
3300015361|Ga0182145_1066479	Not Available	720
3300015361|Ga0182145_1111275	Not Available	607
3300015361|Ga0182145_1178502	Not Available	517
3300015361|Ga0182145_1180427	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	515
3300017404|Ga0182203_1025833	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	896
3300017404|Ga0182203_1035314	Not Available	817
3300017409|Ga0182204_1101067	Not Available	530
3300017410|Ga0182207_1067487	Not Available	693
3300017410|Ga0182207_1096647	Not Available	617
3300017410|Ga0182207_1103706	Not Available	603
3300017413|Ga0182222_1075117	Not Available	553
3300017417|Ga0182230_1095818	Not Available	546
3300017420|Ga0182228_1082646	Not Available	591
3300017420|Ga0182228_1115019	Not Available	525
3300017420|Ga0182228_1117774	Not Available	520
3300017424|Ga0182219_1127140	Not Available	518
3300017425|Ga0182224_1151756	Not Available	517
3300017425|Ga0182224_1153623	Not Available	515
3300017425|Ga0182224_1157650	Not Available	510
3300017427|Ga0182190_1013250	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1154
3300017427|Ga0182190_1028964	Not Available	902
3300017427|Ga0182190_1124484	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	555
3300017430|Ga0182192_1053353	Not Available	754
3300017430|Ga0182192_1120422	Not Available	571
3300017430|Ga0182192_1126013	Not Available	563
3300017430|Ga0182192_1127375	Not Available	560
3300017433|Ga0182206_1158403	Not Available	503
3300017436|Ga0182209_1088659	Not Available	626
3300017438|Ga0182191_1005645	Not Available	1493
3300017438|Ga0182191_1043272	Not Available	809
3300017438|Ga0182191_1182738	Not Available	502
3300017442|Ga0182221_1142759	Not Available	532
3300017442|Ga0182221_1170686	Not Available	502
3300017443|Ga0182193_1017501	Not Available	1097
3300017683|Ga0182218_1110860	Not Available	557
3300017685|Ga0182227_1081126	Not Available	611
3300017686|Ga0182205_1074492	Not Available	665
3300017686|Ga0182205_1078991	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	653
3300017686|Ga0182205_1103297	Not Available	597
3300017686|Ga0182205_1162496	Not Available	512
3300025935|Ga0207709_11369237	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	586

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	98.75%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.62%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.62%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	98.75%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.62%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.62%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	98.75%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.62%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.62%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	98.75%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.62%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.62%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068866_109721531	3300005718	Miscanthus Rhizosphere	MQPVREAVSYRGLFTAGWFGVREKHCSWLEIYDRLRASEQADYTQGQS*
Ga0182122_10228261	3300015267	Miscanthus Phyllosphere	MQPVREAVSYRGLFTVGWFGVREKHYSRLEIYDRLRASEQ
Ga0182113_10525151	3300015269	Miscanthus Phyllosphere	MQPVREAVSYRGLFTVGWFGMREKHCFRLEIYDRLRASEQADDILG*
Ga0182188_10295961	3300015274	Miscanthus Phyllosphere	QPVQETVSYRELFTACWFDVKEKHCSQLKIYDRLRASKQAANQW*
Ga0182128_10494882	3300015277	Miscanthus Phyllosphere	MCHAPKQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASE
Ga0182160_10425391	3300015281	Miscanthus Phyllosphere	VREAVSYRGLFTAGWFGVREKHCFRLEIYDRLRAREQAASS*
Ga0182124_10025791	3300015282	Miscanthus Phyllosphere	IQPVREAVSYRGLFTAGWFGVREKHCSWLEIYDRLRASEQADYTQGQS*
Ga0182124_10799751	3300015282	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAA*
Ga0182156_10114153	3300015283	Miscanthus Phyllosphere	FQPVREAVSYRGLFTAGWFGVREKHYSRLEIYDRLRASEQTDKCL*
Ga0182156_10142141	3300015283	Miscanthus Phyllosphere	PVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAV*
Ga0182156_10505691	3300015283	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGVREKHSSWLEIYDRLRASEQADGSAELFS*
Ga0182156_10704352	3300015283	Miscanthus Phyllosphere	AVSYRGLFTAGWFGVREKHCSRLEIYDHLRASEQADSKYVLMMN*
Ga0182176_10379081	3300015286	Miscanthus Phyllosphere	PVREAVSYRGLFTVGWFGVREKHCSRLKIYDRLRASEQAARA*
Ga0182176_10588192	3300015286	Miscanthus Phyllosphere	MQPVREAVSYRGLFTVGWFGVREKHCSRREIYDRLRTSEQADDPRGRGGAGA
Ga0182171_10768001	3300015287	Miscanthus Phyllosphere	LSFITLCQPVREAVSYRGLFTAGWFDVREKHYFRLKIYDRLRGNEQV*
Ga0182173_10236261	3300015288	Miscanthus Phyllosphere	MQPVREAVSYRGLFTVGWFGMREKHCSRLKIYDRLRASEQA
Ga0182173_10251942	3300015288	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCFRLEIYDRLRASEHAAK*
Ga0182125_10531051	3300015291	Miscanthus Phyllosphere	VSAGYIVQPVRETVLDRGLFTAGWFGVREKHCFWLEIYDRLRPSE
Ga0182125_10679881	3300015291	Miscanthus Phyllosphere	MVMRADCQPVREAVSYRGLFTAGWFGVREKHCSRLKIYDRLRASEQAA
Ga0182126_10491341	3300015294	Miscanthus Phyllosphere	MQPVQEAVSYRGLFTADWFGVREKHCSRLEIYDRLRASEQAD
Ga0182126_10502391	3300015294	Miscanthus Phyllosphere	MQVVRVHKQPVREAVSYRGLFTAGWFGVRKKYCFRLEIYDRLRASEQAE
Ga0182126_10597531	3300015294	Miscanthus Phyllosphere	QPVREVVSYRGLFTTGWFGVRKKYCSRLEIYDRLRASEHADIYAIKI*
Ga0182175_10070771	3300015295	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQ
Ga0182175_10393001	3300015295	Miscanthus Phyllosphere	REAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQA*
Ga0182175_10708821	3300015295	Miscanthus Phyllosphere	MNSCNNQPVREAVSYRGLFTAGWFDVREKHCSRLEIYDRLRASEQA
Ga0182157_10782161	3300015296	Miscanthus Phyllosphere	VPHKHKQHVREAVSYRGLFIVGWFGVREKHCSRLEIYDRLRA
Ga0182106_10167381	3300015298	Miscanthus Phyllosphere	VREAVSYRGLFTAGWFGVREKHCSRLKIYDRLRASEQAAHGGVRAAHLT*
Ga0182108_10095961	3300015300	Miscanthus Phyllosphere	LPDSHNYQPVREAISYRGLFTVGWFGVREKHCSRLEIYDHLRASEQAI*
Ga0182108_10260031	3300015300	Miscanthus Phyllosphere	LRDITNDLQPVREAVSYRGLFTAGWFGVREKHCSRLKIYDRLRASEQAA
Ga0182108_10569531	3300015300	Miscanthus Phyllosphere	VREAVNYRGLFTAGWFGVREKHGSRLEIYDRLRASEQLKTC*
Ga0182108_10900333	3300015300	Miscanthus Phyllosphere	RTYRNKPIQEAVSYRGLFTAGWFGVRKKYCSRLKIYDRLRANEQTED*
Ga0182123_10095392	3300015303	Miscanthus Phyllosphere	PVREVVSYRGLFTAGWFGVREKHCSWLEIYDRLRASEQALII*
Ga0182123_10693281	3300015303	Miscanthus Phyllosphere	MDNQPVREAVSYRGLRGLFTAGWFGVREKYCSRLEIYDRLRASEQAEYYF*
Ga0182123_10887362	3300015303	Miscanthus Phyllosphere	MERTSNQPVRKAVSYRGLFTAGWFGVREKHCFRLKIYDRLRANEQADG
Ga0182112_10816291	3300015304	Miscanthus Phyllosphere	MPYQPVREAVSYRGLFTAGWFGVREKYCSRLEIYDRLRASEQAVCCLVT*
Ga0182112_11004961	3300015304	Miscanthus Phyllosphere	PVREAVSYRGLFTAGWFGVREKHCFRLKIYDRLRASEQANGSRGEF*
Ga0182158_10646971	3300015305	Miscanthus Phyllosphere	HALRFQHVQEAVNDRGLFTASWFGVREKYYSQLEIYDRLRASEQALL*
Ga0182140_10116241	3300015314	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVRGKHCFRLEIYDRLRGSEQAADHENV*
Ga0182140_10347121	3300015314	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCSWLEIYDRLRASEQADST*
Ga0182140_10650351	3300015314	Miscanthus Phyllosphere	PVREAVSYRGLFTAGWFGVREKHCFRLKIYDRLRASKQAKIKRF*
Ga0182127_10239071	3300015321	Miscanthus Phyllosphere	MHQPVRKTVSYRGLFTAGWFGMREKHYSRLEIYDRLRASE
Ga0182110_10481951	3300015322	Miscanthus Phyllosphere	YQPVREAVSYRGLFTAGWFGVREKNCSRLKIYDRLRASEQAV*
Ga0182110_10733231	3300015322	Miscanthus Phyllosphere	YQPVREAVNDRGLFTAGWFGVREKHYSQLKIYDRLRASE*
Ga0182110_10975421	3300015322	Miscanthus Phyllosphere	MKERKAKPPVREAVSYRGLFTAGWFDVREKHYSRLEIYDRLRA
Ga0182129_10845531	3300015323	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGVREKHCSRLKIYDRLRASEQA
Ga0182129_11026191	3300015323	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCSWLEIYDRLRASEQAAWSC*
Ga0182187_10317681	3300015341	Miscanthus Phyllosphere	MQHVREAVSYHRLFIVGWFGVKENHCFQLEIYDHLRASEQADVGRQ*
Ga0182187_10353042	3300015341	Miscanthus Phyllosphere	NYQPVREAVSYRGLFTAGWFGVREKRCSRLKIYDRLRASEQAVCY*
Ga0182187_10515061	3300015341	Miscanthus Phyllosphere	PVREVVSYRGLFTAGWFGVREKHCSPLEIYDRLRASEQAANRCYCA*
Ga0182187_11219321	3300015341	Miscanthus Phyllosphere	MLARANNRPLREAVSYRGLFTAGRFGVREKHCSQLEIYDRLRASEQ
Ga0182187_11599141	3300015341	Miscanthus Phyllosphere	REAVSYRELFTAGWFGVREKHYF*LKIYDRLRASEHAE*
Ga0182187_11723171	3300015341	Miscanthus Phyllosphere	REAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAEEIQEIFR*
Ga0182109_10007152	3300015342	Miscanthus Phyllosphere	REAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASKQADDIQYP*
Ga0182109_10875521	3300015342	Miscanthus Phyllosphere	QPVREAVLYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAV*
Ga0182109_11341491	3300015342	Miscanthus Phyllosphere	EAVNDRGLFTAG*FGVREKHYFQLKIYGRLRANEQAEEQ*
Ga0182109_11505771	3300015342	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCSSLKIYDRLRASEQAE*
Ga0182155_11192101	3300015343	Miscanthus Phyllosphere	MDSQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQA
Ga0182155_11310841	3300015343	Miscanthus Phyllosphere	EAVSYRGLFTAGWLSVREKYYSRLKIYDRLRVREQAG*
Ga0182155_11356272	3300015343	Miscanthus Phyllosphere	MQPVRKSVSYRGLFTVGGFGVREKYGFWLEIYDRLRASEQADGGLVFPKN*
Ga0182155_12108501	3300015343	Miscanthus Phyllosphere	LAIHQPVWEAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAD
Ga0182155_12137271	3300015343	Miscanthus Phyllosphere	QPVREAVNDRGLFTAGWFGVREKHYSWLEIYDCLRASEQAVYI*
Ga0182155_12176011	3300015343	Miscanthus Phyllosphere	QPIREAVSYRGLFTAGWFGVREKHGSRLEIYDRLRASE*
Ga0182189_10422751	3300015344	Miscanthus Phyllosphere	QPVREAVSYRELFTAGWFGVTEKHCSQLEIYDRLRASEQAEKG*
Ga0182189_10749581	3300015344	Miscanthus Phyllosphere	AVSYRGLFTAGWFDVREKRCF*LEIYDRLRASEQAE*
Ga0182189_11187751	3300015344	Miscanthus Phyllosphere	VSYRGLFTAGWFGVREKYCFRLKIYDRLRASEQAANSFAN*
Ga0182189_11836771	3300015344	Miscanthus Phyllosphere	MQPVQETVSYRGLFTAGWFGVREKHYSQLEIYDRLRASEQ
Ga0182111_10130633	3300015345	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHYFQLEIYDRLRASEQG*
Ga0182111_10268101	3300015345	Miscanthus Phyllosphere	VPNYQPVREAVNDRGLFTAGWFCVREKHYSWLEIYDRLRASEQ
Ga0182111_10540821	3300015345	Miscanthus Phyllosphere	MPAHTQPVREAVSYRGLFTAGGFSVREKHYCWREIYDRLRASEQA
Ga0182111_10569211	3300015345	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDCLRASEQAYGII*
Ga0182111_10727301	3300015345	Miscanthus Phyllosphere	MEGTDIQPVRETVSYRGLFTAGWFGVREKHCSRLKIYDRLRASEQA
Ga0182111_10753501	3300015345	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGVREKHYSQLVIYDRLRASEQADDQRC*
Ga0182111_11009551	3300015345	Miscanthus Phyllosphere	EAVSYRGLFTAGWFGVREKYCSQLEIYNRLRASEQAESCMIR*
Ga0182111_11112072	3300015345	Miscanthus Phyllosphere	AVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQADISLR*
Ga0182111_11158741	3300015345	Miscanthus Phyllosphere	QINDVQPVREAVSYRGLFTAGWFDVREKHCSRLEIYDRLRASEQAAYCN*
Ga0182111_11488101	3300015345	Miscanthus Phyllosphere	VIQLVRETISYRGLFIAGWFGVREKHCSRLEIYDRLRASEQADCS*
Ga0182111_12318091	3300015345	Miscanthus Phyllosphere	NQAVREAISYRELFSTDWFGVREKHSFWLKIYDRLRASEQAE*
Ga0182139_11296721	3300015346	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGMREKHCSRLEIYDRLRASEQADEH*
Ga0182139_11327791	3300015346	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHYSRLEIYDRLRANEQAAYMQI*
Ga0182139_11636411	3300015346	Miscanthus Phyllosphere	QPVREAVSYHGLFTVDWFGVKEKHCSRLEIYDCLRASEQAVRSQAHT*
Ga0182177_10261412	3300015347	Miscanthus Phyllosphere	QPVRKAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAASEFEHFLM*
Ga0182177_10579051	3300015347	Miscanthus Phyllosphere	QPVWEAVSYRGLFTAGWFGVREKHYSWLEIYDRLRENEHAK*
Ga0182177_10714521	3300015347	Miscanthus Phyllosphere	NQPVREAVSYRGLFTAGWFGVREKHYSRLEMYNRLRASEQVEYSKSM*
Ga0182177_11819341	3300015347	Miscanthus Phyllosphere	MAHQPVREAVSYRGLFTAGWFDMREKHCYRLEIYDRLRASEQAACPH*
Ga0182161_10258722	3300015351	Miscanthus Phyllosphere	LLSVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASKQAACPQAQ*
Ga0182161_10286751	3300015351	Miscanthus Phyllosphere	QPIREAVSYRGLFTAGWFGVREKHYSPLEIYDRLRASEQAVCNWFCN*
Ga0182161_10797321	3300015351	Miscanthus Phyllosphere	MCVYLQPVREAVNDRGLFTAGWFGVREKHRFWLKIYDRLRTSEQAAN
Ga0182161_11565401	3300015351	Miscanthus Phyllosphere	MDHQPVREAVSYRGLFTADWFGVREKHCFRLEIYDRLRASEQANID*
Ga0182161_12034691	3300015351	Miscanthus Phyllosphere	MALVGNNQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQADE*
Ga0182161_12056451	3300015351	Miscanthus Phyllosphere	VREAVNDRGLFTADWFGVREKHCSWLEIYDRLRASEQAAS*
Ga0182161_12158231	3300015351	Miscanthus Phyllosphere	QPVWEAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASERTDRW*
Ga0182161_12318261	3300015351	Miscanthus Phyllosphere	MFSKEMQPVREAVSYRGLFTAGWFGVREKHCSRLEI
Ga0182159_10265253	3300015355	Miscanthus Phyllosphere	VSINLQPVREAVSYRGLFTAGWFGVREKHCFLLEIYDRLRASEQAEILVG*
Ga0182159_10300341	3300015355	Miscanthus Phyllosphere	EAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEHA*
Ga0182159_10515681	3300015355	Miscanthus Phyllosphere	QPVREAVSYRGLFTADWFGVREKHYSRLEIYDRLRASEQAVRPK*
Ga0182159_11256871	3300015355	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAEDHWPF*
Ga0182159_11355521	3300015355	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLR
Ga0182159_12008271	3300015355	Miscanthus Phyllosphere	NQPVREAVSYRGLFTSGWFGVREKHCFRLKIYDRLRASKQADIQ*
Ga0182159_12361041	3300015355	Miscanthus Phyllosphere	MLVREAVNDRGLFTAGWFGVREKHYYWLEIYDFLRASEL
Ga0182159_12569031	3300015355	Miscanthus Phyllosphere	MCHAPKQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAE
Ga0182159_12959092	3300015355	Miscanthus Phyllosphere	VREAVSYRGLFTAGWFGVREKHCSWLEIYDRLRANEQAARFDL*
Ga0182159_13114231	3300015355	Miscanthus Phyllosphere	MKHLGDNQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQA
Ga0182145_10122842	3300015361	Miscanthus Phyllosphere	VREAVNDRELFTAGWFGVREKHCSWLEIYVRLQANEQAEE*
Ga0182145_10128521	3300015361	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEHA*
Ga0182145_10158832	3300015361	Miscanthus Phyllosphere	VREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASKQADDIQYP*
Ga0182145_10664791	3300015361	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGMREKHCSRLEIYDRLRASEQA
Ga0182145_11112751	3300015361	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCFWLEIYDRLRASEQAEY*
Ga0182145_11785022	3300015361	Miscanthus Phyllosphere	EAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQADRCHH*
Ga0182145_11804271	3300015361	Miscanthus Phyllosphere	MNSCNNQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAE
Ga0182203_10258331	3300017404	Miscanthus Phyllosphere	PVREAVSYRGLFTADWFDVREKYCSRLEIYDRLRASEQAVYTY
Ga0182203_10353141	3300017404	Miscanthus Phyllosphere	MLIALNALQPVREAVSYRGLFTAVWFGVREKHCSRLEIYDRLRASEQA
Ga0182220_11058211	3300017407	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAV
Ga0182204_11010672	3300017409	Miscanthus Phyllosphere	LLEKVTTEDNQPVREAVSYRGIFTAGWFGVREKHYSRLEIYDRLRASEQAEC
Ga0182207_10674872	3300017410	Miscanthus Phyllosphere	VREAISYRGLFTAGWFGVREKHCSRLKIYDRLRASEQAASCYP
Ga0182207_10966471	3300017410	Miscanthus Phyllosphere	ANKQPVREAVSYRGLFTAGWFGVREKHCFQLEIYDRLRANEQAKVPNEISG
Ga0182207_11037061	3300017410	Miscanthus Phyllosphere	DSSPETVARQPVREALSYRGLFTAGWFGVREKHYSRLEIYDRLRASE
Ga0182207_11121271	3300017410	Miscanthus Phyllosphere	RTMKPSLHQPVREAVSYRGLFTADWFDVREKYCSRLEIYDRLRASDRVAY
Ga0182222_10751171	3300017413	Miscanthus Phyllosphere	YQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAS
Ga0182230_10958181	3300017417	Miscanthus Phyllosphere	MVGAFNQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRANEQADYSP
Ga0182228_10826461	3300017420	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCSWLEIYDRLRASEQAECSSNHINA
Ga0182228_11150191	3300017420	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQADSI
Ga0182228_11177741	3300017420	Miscanthus Phyllosphere	PVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAV
Ga0182219_11271401	3300017424	Miscanthus Phyllosphere	MQIIAIQPVREAVSCRGLFTAGWFGVREKHCSWLEIYDRLRASEQ
Ga0182224_11517562	3300017425	Miscanthus Phyllosphere	QPVRETVSYRGLFTAGWFGMREKHCFRLKIYDRLRANEQTE
Ga0182224_11536231	3300017425	Miscanthus Phyllosphere	EEITYGARDIQPVWEAVSYRGLFTAGWFGVSEKHCSQLEIYDRLRASEQA
Ga0182224_11576502	3300017425	Miscanthus Phyllosphere	CAQQQPVREAVNDRGLFTAGWFGVREKHCSRLEIYDRLRASERAV
Ga0182190_10132501	3300017427	Miscanthus Phyllosphere	VPSIDIQPVREAVSYRGLFTAGWFGVREKHCFRLEIYDRLRASE
Ga0182190_10289641	3300017427	Miscanthus Phyllosphere	QPVREAVSYRGLFTVGWFGVREKHCSRLKIYDRLRASEQAKRLII
Ga0182190_10735301	3300017427	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKYCSRLKIYDRLRVNEQAE
Ga0182190_11026591	3300017427	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAANHC
Ga0182190_11244841	3300017427	Miscanthus Phyllosphere	QPVREAVSYRGLFTADWFGVREKYCSQLEIYDRLRASEQAVSI
Ga0182192_10533531	3300017430	Miscanthus Phyllosphere	PVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRTSEQAIVSLFT
Ga0182192_11204221	3300017430	Miscanthus Phyllosphere	MQHVREAVSYRGLFTAGWFGVREKYCFRLKIYDRLRANEQATWSVALA
Ga0182192_11209871	3300017430	Miscanthus Phyllosphere	VRKAVSYRGLFTAGWFDVREKHCSRLKIYDHLRVSE
Ga0182192_11260131	3300017430	Miscanthus Phyllosphere	EAVSYRGLFTAGWFGVREKYYSRLEIYDRLRASEQADNKRP
Ga0182192_11273752	3300017430	Miscanthus Phyllosphere	MRRTFTDKQSARETVSYRGLFTASWFGMREKHYFQLEIYDRLRTSEQAECT
Ga0182206_11358931	3300017433	Miscanthus Phyllosphere	QHVREAVSYRGLFTADWFGVREKHCSRLEIYDRLRANEQAA
Ga0182206_11584031	3300017433	Miscanthus Phyllosphere	QPIREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQADKG
Ga0182209_10886591	3300017436	Miscanthus Phyllosphere	LQVDQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRAS
Ga0182191_10056451	3300017438	Miscanthus Phyllosphere	QPVREAVSYRGLFTADWFGVREKHCFRLKIYDRLRASEQAEC
Ga0182191_10432722	3300017438	Miscanthus Phyllosphere	IQPVREAVSYRGLFTAGWFGVREKHCFWLEIYDRLRASEQAAT
Ga0182191_11827381	3300017438	Miscanthus Phyllosphere	QPVREALLYRVLFTVVWFGVREKHCSRLEIYDRLRASEQEADG
Ga0182221_10130201	3300017442	Miscanthus Phyllosphere	RPVREAVSYRGLFTAGWFGVRKKYCSRLKIYDRLRASEQAANSFRLYH
Ga0182221_10975322	3300017442	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRAS
Ga0182221_11355051	3300017442	Miscanthus Phyllosphere	EYNHPVREAVSYRGLFTAGWFSVRGKHCSRLEIYDRLRASEQAD
Ga0182221_11427591	3300017442	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFSVREKHCSRLKIYDRLRASERAILR
Ga0182221_11706861	3300017442	Miscanthus Phyllosphere	MSLPVREAVSYRGLFTAGWFGVREKHCFRLEIYDRLRASEQ
Ga0182193_10129341	3300017443	Miscanthus Phyllosphere	AVSYRGLFTVGWFDVREKHCSWLEIYDCLRASEQSDS
Ga0182193_10175011	3300017443	Miscanthus Phyllosphere	PVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEHAAYKLKDLYI
Ga0182193_10491241	3300017443	Miscanthus Phyllosphere	MSMNLSQRPVREAVSYRGLFTVGWFGVREKHCSRLKIYDRLRASEQAAR
Ga0182218_10442151	3300017683	Miscanthus Phyllosphere	ISEYGIQPVREAVSYRGLFTAGWFGVREKHCSRLKIYDRLRVSE
Ga0182218_10778551	3300017683	Miscanthus Phyllosphere	EAVSYRGLFTAGWFGVREKHCSWLEIYDRLRASEEAVARFKK
Ga0182218_11108601	3300017683	Miscanthus Phyllosphere	MVYQPVREAVSYHGLFTVDWFGVKEKHCSRLEIYDCLRASEQAVRSQAHT
Ga0182227_10811261	3300017685	Miscanthus Phyllosphere	MQPVRETVKDRGLFTAGWFGVKEKYYSWLEIYDRLRASEQAVCHPPLHRQP
Ga0182205_10744921	3300017686	Miscanthus Phyllosphere	DFQPVRFVVNDRGLFTAGWFGVREKYCSQLIIHDHIRASEQTVYL
Ga0182205_10789911	3300017686	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFDVTEKHCSRLEIYDRLQASETRKR
Ga0182205_11032971	3300017686	Miscanthus Phyllosphere	PVREAVSYRGLFTVGWFGVREKHCSWLEIYDRLRASEQADYCRTHSAYV
Ga0182205_11516211	3300017686	Miscanthus Phyllosphere	QPVQEAVSYRGLFTAGWFGVREKHCSRLEIYDRLRANEQAVEF
Ga0182205_11624961	3300017686	Miscanthus Phyllosphere	VREAVNDRGLFTAGWFGVRKKHCSWLEIYDHLRASEQAARLLHF
Ga0207709_113692372	3300025935	Miscanthus Rhizosphere	KQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQADNGQ