| Basic Information | |
|---|---|
| Family ID | F040941 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 161 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSTDTSTTTPSSKGTSLSLDAWAVILAFLLALAVRFDILKNVPW |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.37 % |
| % of genes near scaffold ends (potentially truncated) | 22.98 % |
| % of genes from short scaffolds (< 2000 bps) | 73.91 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.031 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil (14.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.298 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (71.429 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.72% β-sheet: 0.00% Coil/Unstructured: 65.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF03601 | Cons_hypoth698 | 50.93 |
| PF01726 | LexA_DNA_bind | 4.35 |
| PF02082 | Rrf2 | 4.35 |
| PF11004 | Kdo_hydroxy | 2.48 |
| PF13454 | NAD_binding_9 | 1.86 |
| PF00753 | Lactamase_B | 1.24 |
| PF04185 | Phosphoesterase | 1.24 |
| PF10282 | Lactonase | 1.24 |
| PF00528 | BPD_transp_1 | 1.24 |
| PF00005 | ABC_tran | 1.24 |
| PF00174 | Oxidored_molyb | 1.24 |
| PF01904 | DUF72 | 0.62 |
| PF03061 | 4HBT | 0.62 |
| PF13304 | AAA_21 | 0.62 |
| PF03352 | Adenine_glyco | 0.62 |
| PF00685 | Sulfotransfer_1 | 0.62 |
| PF08240 | ADH_N | 0.62 |
| PF16930 | Porin_5 | 0.62 |
| PF13442 | Cytochrome_CBB3 | 0.62 |
| PF00474 | SSF | 0.62 |
| PF08530 | PepX_C | 0.62 |
| PF13378 | MR_MLE_C | 0.62 |
| PF01370 | Epimerase | 0.62 |
| PF00085 | Thioredoxin | 0.62 |
| PF01695 | IstB_IS21 | 0.62 |
| PF00144 | Beta-lactamase | 0.62 |
| PF00266 | Aminotran_5 | 0.62 |
| PF14559 | TPR_19 | 0.62 |
| PF00848 | Ring_hydroxyl_A | 0.62 |
| PF01494 | FAD_binding_3 | 0.62 |
| PF00557 | Peptidase_M24 | 0.62 |
| PF00982 | Glyco_transf_20 | 0.62 |
| PF00117 | GATase | 0.62 |
| PF10370 | DUF2437 | 0.62 |
| PF07859 | Abhydrolase_3 | 0.62 |
| PF16326 | ABC_tran_CTD | 0.62 |
| PF01063 | Aminotran_4 | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG2855 | Uncharacterized membrane protein YadS, UPF0324 family | Function unknown [S] | 50.93 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 4.35 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 4.35 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 4.35 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 4.35 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 4.35 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 4.35 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 4.35 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 4.35 |
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.24 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 1.24 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 1.24 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.24 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 1.24 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 1.24 |
| COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.62 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.62 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.62 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.62 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.62 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.62 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.62 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.62 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.62 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.62 |
| COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.03 % |
| Unclassified | root | N/A | 4.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10176171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 762 | Open in IMG/M |
| 3300001100|JGI12703J13194_100713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1476 | Open in IMG/M |
| 3300001170|JGI12704J13340_1021247 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300001180|JGI12695J13573_1014890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 547 | Open in IMG/M |
| 3300001356|JGI12269J14319_10344274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 526 | Open in IMG/M |
| 3300001471|JGI12712J15308_10003689 | All Organisms → cellular organisms → Bacteria | 4427 | Open in IMG/M |
| 3300001593|JGI12635J15846_10009927 | All Organisms → cellular organisms → Bacteria | 8060 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100312028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1456 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10005280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3881 | Open in IMG/M |
| 3300004080|Ga0062385_10257036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 977 | Open in IMG/M |
| 3300004080|Ga0062385_10841969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 604 | Open in IMG/M |
| 3300004082|Ga0062384_100014717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3146 | Open in IMG/M |
| 3300004082|Ga0062384_100066235 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
| 3300004082|Ga0062384_100242430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1089 | Open in IMG/M |
| 3300004091|Ga0062387_100109311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1507 | Open in IMG/M |
| 3300004091|Ga0062387_100784598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 708 | Open in IMG/M |
| 3300004091|Ga0062387_100987274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 644 | Open in IMG/M |
| 3300004091|Ga0062387_101722730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 509 | Open in IMG/M |
| 3300004092|Ga0062389_100357353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1560 | Open in IMG/M |
| 3300004092|Ga0062389_100909119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1063 | Open in IMG/M |
| 3300004092|Ga0062389_102912681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 640 | Open in IMG/M |
| 3300004092|Ga0062389_103809366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 566 | Open in IMG/M |
| 3300004152|Ga0062386_100109195 | All Organisms → cellular organisms → Bacteria | 2132 | Open in IMG/M |
| 3300004635|Ga0062388_100540241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1053 | Open in IMG/M |
| 3300004635|Ga0062388_100970172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 823 | Open in IMG/M |
| 3300004635|Ga0062388_101654863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 652 | Open in IMG/M |
| 3300005560|Ga0066670_10256947 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300005591|Ga0070761_10002084 | All Organisms → cellular organisms → Bacteria | 12424 | Open in IMG/M |
| 3300005591|Ga0070761_10121297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1518 | Open in IMG/M |
| 3300005591|Ga0070761_10166584 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300005591|Ga0070761_11064023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 514 | Open in IMG/M |
| 3300005602|Ga0070762_10060306 | All Organisms → cellular organisms → Bacteria | 2112 | Open in IMG/M |
| 3300005602|Ga0070762_10455364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 833 | Open in IMG/M |
| 3300005610|Ga0070763_10520708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 682 | Open in IMG/M |
| 3300005712|Ga0070764_10280783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 956 | Open in IMG/M |
| 3300005712|Ga0070764_11016507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 523 | Open in IMG/M |
| 3300005921|Ga0070766_10019481 | All Organisms → cellular organisms → Bacteria | 3592 | Open in IMG/M |
| 3300005921|Ga0070766_10255054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1114 | Open in IMG/M |
| 3300006176|Ga0070765_100103815 | All Organisms → cellular organisms → Bacteria | 2462 | Open in IMG/M |
| 3300009623|Ga0116133_1000276 | All Organisms → cellular organisms → Bacteria | 16238 | Open in IMG/M |
| 3300009629|Ga0116119_1176979 | Not Available | 532 | Open in IMG/M |
| 3300009632|Ga0116102_1050614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_3_65_5 | 1305 | Open in IMG/M |
| 3300009632|Ga0116102_1153113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 634 | Open in IMG/M |
| 3300009645|Ga0116106_1036775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1666 | Open in IMG/M |
| 3300009646|Ga0116132_1229625 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300009665|Ga0116135_1094982 | Not Available | 1075 | Open in IMG/M |
| 3300010339|Ga0074046_10015813 | All Organisms → cellular organisms → Bacteria | 5421 | Open in IMG/M |
| 3300010341|Ga0074045_10016183 | All Organisms → cellular organisms → Bacteria | 5991 | Open in IMG/M |
| 3300010341|Ga0074045_10642329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
| 3300010341|Ga0074045_10946736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300010343|Ga0074044_10015918 | All Organisms → cellular organisms → Bacteria | 5535 | Open in IMG/M |
| 3300010343|Ga0074044_10036059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3452 | Open in IMG/M |
| 3300011120|Ga0150983_14439842 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300014164|Ga0181532_10001032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 27696 | Open in IMG/M |
| 3300014169|Ga0181531_10152417 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300014201|Ga0181537_10678271 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
| 3300014489|Ga0182018_10001157 | All Organisms → cellular organisms → Bacteria | 31090 | Open in IMG/M |
| 3300014489|Ga0182018_10015243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5264 | Open in IMG/M |
| 3300014495|Ga0182015_10809227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
| 3300014638|Ga0181536_10322247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
| 3300014654|Ga0181525_10067914 | All Organisms → cellular organisms → Bacteria | 1999 | Open in IMG/M |
| 3300014838|Ga0182030_10042212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 7556 | Open in IMG/M |
| 3300016702|Ga0181511_1059541 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300016750|Ga0181505_10276072 | Not Available | 2049 | Open in IMG/M |
| 3300017935|Ga0187848_10186946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 896 | Open in IMG/M |
| 3300017935|Ga0187848_10262626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 726 | Open in IMG/M |
| 3300017938|Ga0187854_10094126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1413 | Open in IMG/M |
| 3300017938|Ga0187854_10357024 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300017940|Ga0187853_10066010 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
| 3300017946|Ga0187879_10599222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 612 | Open in IMG/M |
| 3300017946|Ga0187879_10808025 | Not Available | 524 | Open in IMG/M |
| 3300017948|Ga0187847_10137201 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300017970|Ga0187783_10046014 | All Organisms → cellular organisms → Bacteria | 3226 | Open in IMG/M |
| 3300017972|Ga0187781_11115625 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300018020|Ga0187861_10138465 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300018022|Ga0187864_10128082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1282 | Open in IMG/M |
| 3300018024|Ga0187881_10280474 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300018033|Ga0187867_10272223 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300018033|Ga0187867_10318696 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300018034|Ga0187863_10078302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1864 | Open in IMG/M |
| 3300018037|Ga0187883_10501189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300018040|Ga0187862_10103954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1964 | Open in IMG/M |
| 3300018042|Ga0187871_10181925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1179 | Open in IMG/M |
| 3300018042|Ga0187871_10200297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1116 | Open in IMG/M |
| 3300018047|Ga0187859_10082581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1691 | Open in IMG/M |
| 3300018062|Ga0187784_10837833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 733 | Open in IMG/M |
| 3300018062|Ga0187784_10837981 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 733 | Open in IMG/M |
| 3300018085|Ga0187772_10902294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 642 | Open in IMG/M |
| 3300018086|Ga0187769_10293418 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300019786|Ga0182025_1191270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1512 | Open in IMG/M |
| 3300019787|Ga0182031_1035888 | All Organisms → cellular organisms → Bacteria | 1812 | Open in IMG/M |
| 3300020580|Ga0210403_11401879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300020582|Ga0210395_10011083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6705 | Open in IMG/M |
| 3300021181|Ga0210388_10164077 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
| 3300021181|Ga0210388_10218259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1670 | Open in IMG/M |
| 3300021181|Ga0210388_10246110 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300021402|Ga0210385_10095889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2062 | Open in IMG/M |
| 3300021402|Ga0210385_11210959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300021407|Ga0210383_10906789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 751 | Open in IMG/M |
| 3300021433|Ga0210391_10502842 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300021433|Ga0210391_10980384 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
| 3300021433|Ga0210391_11466394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 3300021477|Ga0210398_10047170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 3549 | Open in IMG/M |
| 3300021478|Ga0210402_10267249 | Not Available | 1581 | Open in IMG/M |
| 3300022515|Ga0224546_1005789 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300022521|Ga0224541_1001272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2491 | Open in IMG/M |
| 3300022521|Ga0224541_1003796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1598 | Open in IMG/M |
| 3300022728|Ga0224566_100571 | All Organisms → cellular organisms → Bacteria | 2912 | Open in IMG/M |
| 3300022881|Ga0224545_1011690 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300023090|Ga0224558_1001122 | All Organisms → cellular organisms → Bacteria | 29187 | Open in IMG/M |
| 3300024220|Ga0224568_1000046 | All Organisms → cellular organisms → Bacteria | 35338 | Open in IMG/M |
| 3300024227|Ga0228598_1009066 | All Organisms → cellular organisms → Bacteria | 1999 | Open in IMG/M |
| 3300025453|Ga0208455_1014256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1958 | Open in IMG/M |
| 3300026215|Ga0209849_1061741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
| 3300027432|Ga0209421_1001542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3953 | Open in IMG/M |
| 3300027439|Ga0209332_1000056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 28156 | Open in IMG/M |
| 3300027505|Ga0209218_1095247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 621 | Open in IMG/M |
| 3300027545|Ga0209008_1027666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1321 | Open in IMG/M |
| 3300027559|Ga0209222_1003769 | All Organisms → cellular organisms → Bacteria | 3380 | Open in IMG/M |
| 3300027559|Ga0209222_1081845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
| 3300027609|Ga0209221_1022784 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300027629|Ga0209422_1002499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4434 | Open in IMG/M |
| 3300027641|Ga0208827_1052903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1349 | Open in IMG/M |
| 3300027648|Ga0209420_1015178 | All Organisms → cellular organisms → Bacteria | 2597 | Open in IMG/M |
| 3300027652|Ga0209007_1013472 | All Organisms → cellular organisms → Bacteria | 2147 | Open in IMG/M |
| 3300027676|Ga0209333_1018527 | All Organisms → cellular organisms → Bacteria | 1993 | Open in IMG/M |
| 3300027676|Ga0209333_1075818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 921 | Open in IMG/M |
| 3300027692|Ga0209530_1028028 | All Organisms → cellular organisms → Bacteria | 1687 | Open in IMG/M |
| 3300027698|Ga0209446_1050560 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1051 | Open in IMG/M |
| 3300027737|Ga0209038_10247048 | Not Available | 535 | Open in IMG/M |
| 3300027768|Ga0209772_10068252 | Not Available | 1071 | Open in IMG/M |
| 3300027783|Ga0209448_10063501 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300027812|Ga0209656_10272762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 791 | Open in IMG/M |
| 3300027853|Ga0209274_10196108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1026 | Open in IMG/M |
| 3300027853|Ga0209274_10419779 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300027879|Ga0209169_10493265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300027889|Ga0209380_10645249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300027895|Ga0209624_10232736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1225 | Open in IMG/M |
| 3300027908|Ga0209006_11029066 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300028565|Ga0302145_10148466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300028759|Ga0302224_10279265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300028906|Ga0308309_10064571 | All Organisms → cellular organisms → Bacteria | 2702 | Open in IMG/M |
| 3300028906|Ga0308309_10167093 | Not Available | 1785 | Open in IMG/M |
| 3300029903|Ga0247271_100666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9328 | Open in IMG/M |
| 3300029943|Ga0311340_10359091 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300029999|Ga0311339_10000768 | All Organisms → cellular organisms → Bacteria | 58043 | Open in IMG/M |
| 3300030007|Ga0311338_10041680 | All Organisms → cellular organisms → Bacteria | 6255 | Open in IMG/M |
| 3300030007|Ga0311338_10066993 | All Organisms → cellular organisms → Bacteria | 4656 | Open in IMG/M |
| 3300030053|Ga0302177_10503709 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300030057|Ga0302176_10129855 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300030399|Ga0311353_10991442 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
| 3300030618|Ga0311354_10371515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1453 | Open in IMG/M |
| 3300030737|Ga0302310_10661330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300031708|Ga0310686_103376131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
| 3300031708|Ga0310686_111771807 | All Organisms → cellular organisms → Bacteria | 39700 | Open in IMG/M |
| 3300031708|Ga0310686_114161495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
| 3300031708|Ga0310686_119122523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 2348 | Open in IMG/M |
| 3300032805|Ga0335078_10068585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5190 | Open in IMG/M |
| 3300033405|Ga0326727_10401853 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300033807|Ga0314866_063020 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
| 3300033829|Ga0334854_002133 | All Organisms → cellular organisms → Bacteria | 4825 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 14.29% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 13.66% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 13.04% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 11.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.07% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.21% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.97% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.73% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 3.73% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 3.73% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.48% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.86% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.86% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.24% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.62% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.62% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.62% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.62% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.62% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001100 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 | Environmental | Open in IMG/M |
| 3300001170 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 | Environmental | Open in IMG/M |
| 3300001180 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022515 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5 | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300022728 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU2 | Environmental | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300024220 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_101761712 | 3300000567 | Peatlands Soil | MSTDTSTTTPSSKGTSLSLDAWAVILAFLLAMAVRFDILKNVPW* |
| JGI12703J13194_1007132 | 3300001100 | Forest Soil | MSTNSTKTTPSSKGTSISLDAWALIIAALLALAVRFDILKNVPW* |
| JGI12704J13340_10212473 | 3300001170 | Forest Soil | MSTAENTSKRNPVSLDTWAVIAALLLTLAVRFDILKNVSW* |
| JGI12695J13573_10148902 | 3300001180 | Forest Soil | MATDKSTTIPSSKGTSFSLGALSLDAWALIVAALLALAVRFDILKNVPW* |
| JGI12269J14319_103442742 | 3300001356 | Peatlands Soil | FIVRIKGELPMSTDTSTTTPSSKGTSLSLDAWAVILAFLLAMAVRFDILKNVPW* |
| JGI12712J15308_100036894 | 3300001471 | Forest Soil | MSTDKPAAAASNKSASLSLDTWAVIAALVLALAVRFDILKNVSW* |
| JGI12635J15846_100099271 | 3300001593 | Forest Soil | MSTDKPTATPSHKSASLSLDTWAVIAALVLALAVRFDILKNVSW* |
| JGIcombinedJ26739_1003120282 | 3300002245 | Forest Soil | MSTEQPTMSSKGGGVSLDVWAVIVALLLALAVRFDILKNVPW* |
| JGIcombinedJ51221_100052802 | 3300003505 | Forest Soil | MATDKSTTSSTGSSWLSLDIWAVIVALILALAVRFDILKNVPW* |
| Ga0062385_102570362 | 3300004080 | Bog Forest Soil | MAIEKSTTEAGKGLPLSLDTWAVIVALVLALAVKFDLFKNIPW* |
| Ga0062385_108419691 | 3300004080 | Bog Forest Soil | MSSDTSATTPSSKGTSLSLDAWALIVALLLALAVKFDIFKNIPW* |
| Ga0062384_1000147172 | 3300004082 | Bog Forest Soil | MAIEKSTTEAGKGFPLSVDTWAVIVALVLALTVKFNLFKNVPW* |
| Ga0062384_1000662352 | 3300004082 | Bog Forest Soil | MSTDKSTATRPSKGISLSLDTWAVIVALVLALAVRFDILKNVPW* |
| Ga0062384_1002424302 | 3300004082 | Bog Forest Soil | PNGESSMTADKSTSTESSKGALLSLDIWAVIVALVLALAVRFDILKNVPW* |
| Ga0062387_1001093111 | 3300004091 | Bog Forest Soil | MESHHTGTGEISMSTYTSTKTPSSKGPYLSLDTWAVIIALALALAVRFDVLKNVPW* |
| Ga0062387_1007845981 | 3300004091 | Bog Forest Soil | MSTDKSTNAPSRGPLLSLDTWAVIVALALALAVRFDILKNVPW* |
| Ga0062387_1009872742 | 3300004091 | Bog Forest Soil | MPTPTTLSRKGSALSLDVWAVIIALVLALAVRFDVFKNVPW* |
| Ga0062387_1017227301 | 3300004091 | Bog Forest Soil | MSTDKYTASSKRISLSLDAWAVIIALILALAVRLDILKNVPW* |
| Ga0062389_1003573532 | 3300004092 | Bog Forest Soil | MSKDTSGSTSSKGSLLSLDAWAVIVALALALAVKFDVLKSVPW* |
| Ga0062389_1009091191 | 3300004092 | Bog Forest Soil | MSESDLAPATTNSGKRNTLSLDAWAVIVALLLALAVRFDLVKNIPW* |
| Ga0062389_1029126812 | 3300004092 | Bog Forest Soil | TADKSTSTESSKGALLSLDIWAVIVALVLALAVRFDILKNVPW* |
| Ga0062389_1038093661 | 3300004092 | Bog Forest Soil | MAMKTSTTKTSDKGGSLSLDTWAVIFALVLALAVKFGVLKSVPW* |
| Ga0062386_1001091953 | 3300004152 | Bog Forest Soil | MSDLTSTTTTSAMRNTLSLDAWAVIVALLLALAVRFDVLKNIPW* |
| Ga0062388_1005402411 | 3300004635 | Bog Forest Soil | KMESHHTGTGEISMSTYTSTKTPSSKGPYLSLDTWAVIIALALALAVRFDVLKNVPW* |
| Ga0062388_1009701722 | 3300004635 | Bog Forest Soil | MSTTEQSASSTKRPSLTLDTWAVIVALALALAVRLDILKNVPW* |
| Ga0062388_1016548632 | 3300004635 | Bog Forest Soil | MSTDKSTNTPSSKGPLLSVDIWAVIVALALALAVKFNILKDVPW* |
| Ga0066670_102569472 | 3300005560 | Soil | MSTDSSNTPVSKGTVLSLDTWAVILGLALALAVKLGLLSNVPW* |
| Ga0070761_100020841 | 3300005591 | Soil | MPTETSMNPSSSKVISLSLDTWVLIVAVVLALAVRFGILDNVPW* |
| Ga0070761_101212971 | 3300005591 | Soil | MSTDKPTATASNKSASLSLDTWAVIAALVLALAVRFDILKNVSW* |
| Ga0070761_101665842 | 3300005591 | Soil | MATDKSTAPSGSASRLSLDVWAVIVALILALAVRFDIIKNVPW* |
| Ga0070761_110640232 | 3300005591 | Soil | PMSTDKSNPSNNSFSLSLDTWAVIAALLLALAVKLDILKNVSW* |
| Ga0070762_100603062 | 3300005602 | Soil | MVIAAEKVPMSTDKSNPSNNSFSLSLDTWAVIAALLLALAVKLDILKNVSW* |
| Ga0070762_104553642 | 3300005602 | Soil | MSTDKSTNTPSSKGPLLSLDAWAVIVAFALALAVRLNILKDVPW* |
| Ga0070763_105207082 | 3300005610 | Soil | MSTDKSTNTPSSKGPLLSLDSWAVIVAVALALAVKFDILKNVPW* |
| Ga0070764_102807832 | 3300005712 | Soil | MATDKSTRVPSSTGSSWLSLDVWAVIVALILALAVRFDILKNVPW* |
| Ga0070764_110165071 | 3300005712 | Soil | PSNNSFSLSLDTWAVIAALLLALAVKLDILKNVSW* |
| Ga0070766_100194812 | 3300005921 | Soil | MSTDKPTATAYNKSALLSLDTWAVIAALVLALAVRFDILKNVSW* |
| Ga0070766_102550542 | 3300005921 | Soil | TDKSTNTPSSKGPLLSLDSWAVIVAVALALAVKFDILKNVPW* |
| Ga0070765_1001038153 | 3300006176 | Soil | MSTDKSTATPSNSSALLSLDSWAVIAALLLALAVRLDILKNVSW* |
| Ga0116133_100027611 | 3300009623 | Peatland | MSTDTSDSSRKGTSFSLDTWALIVAFLLALAVRFGVLKNIPW* |
| Ga0116119_11769791 | 3300009629 | Peatland | MSTDTSPTVPSKSNSLSLDTLAVIVALVLALAVRFDIFRNVPW* |
| Ga0116102_10506141 | 3300009632 | Peatland | MSTDTSSNTPLSKVISLSLDTWAVIIAVALALAVRFDILKNVPW* |
| Ga0116102_11531132 | 3300009632 | Peatland | MSTDTSTTTPSSTGTSLSLDVWALIVAFLLALAVRFDILKNVPW* |
| Ga0116106_10367752 | 3300009645 | Peatland | MSTDTSTTTPSSKGTSLSLDAWAVILAFLLALAVRFDILKNVPW* |
| Ga0116132_12296251 | 3300009646 | Peatland | MSTDTSTTTPSSKGTSLSLDAWAVILAFLLALAVRFDILKSVPW* |
| Ga0116135_10949821 | 3300009665 | Peatland | MATDKSAVPSGSASRLSLDVWAVIVALILALAVRFDIIKNVPW* |
| Ga0074046_100158135 | 3300010339 | Bog Forest Soil | MSDLTSTTTTSAKRNTLSLDGWAVIVALLLALAVRFNVLKNIPW* |
| Ga0074045_100161838 | 3300010341 | Bog Forest Soil | MTTDTSMETSSSKGTALSLDTWALIVAFVLALAVRFDILKNVPW* |
| Ga0074045_106423292 | 3300010341 | Bog Forest Soil | MTTTEKATSLSKSYSLSLDTWAVIVALALALAVRFDIFGNVPW* |
| Ga0074045_109467361 | 3300010341 | Bog Forest Soil | MSESDLASTTNSGKRNPLSLDAWAVIVALLLALAVRFDVVKNILW* |
| Ga0074044_100159186 | 3300010343 | Bog Forest Soil | MSTDKSAHTPASKGTALSLDTWAVIIACLLALAVRFDILKHVGW* |
| Ga0074044_100360596 | 3300010343 | Bog Forest Soil | MSTDTSSNTPLSKGGSLSLDTWAVIVAVVLALAVRFGILKNVPW* |
| Ga0150983_144398423 | 3300011120 | Forest Soil | AAEKVPMSTDKSNPSNNSFSLSLDTWAVIAALLLALAVKLDILKNVSW* |
| Ga0181532_100010322 | 3300014164 | Bog | MSSDTSATTPASNGTSLSLDAWALIVALLLALAVRFDILKNIPW* |
| Ga0181531_101524171 | 3300014169 | Bog | MSTDKPTTTPSNKSASLSLDTWAVIAALVLALAVRFDILKNVSW* |
| Ga0181537_106782712 | 3300014201 | Bog | MQWTGQSLSGKGEIPMSTDKSATTSPRKENSLSLDGWALIVATLLALAVKFDILKNVPW* |
| Ga0182018_100011577 | 3300014489 | Palsa | MSMATDKSAKTSSKQSNWLSLDIWAVLIALALALAVRFDILKNVPW* |
| Ga0182018_100152435 | 3300014489 | Palsa | MSTDKSTNAGSRKGSLLSLDAWAVIVALALALAVRFDILKDVPW* |
| Ga0182015_108092272 | 3300014495 | Palsa | GEMPMPTDKSANTSSKQSNWLSLDTWAVLVALALALAVRFDILKNVPW* |
| Ga0181536_103222472 | 3300014638 | Bog | MIKGEVPMSTDTSTTTPSSKGTSLSLDAWAVILAFLLALAVRFDILKNVPW* |
| Ga0181525_100679143 | 3300014654 | Bog | MTADKSTSTETSKGALLSLDTWAVAIALILALAVKFGILKNVPW* |
| Ga0182030_100422126 | 3300014838 | Bog | MSTDKSPATPSSRSAALSLDTWAVIAALLLALAVRFDILKNVPW* |
| Ga0181511_10595412 | 3300016702 | Peatland | MSSDTSATTPASNGTSLSLDAWALIVALLLALAVRFDILKNIPW |
| Ga0181505_102760721 | 3300016750 | Peatland | MSSDTSATTPSSNGNSLSLDAWALIVAFLLALAVRFDI |
| Ga0187848_101869462 | 3300017935 | Peatland | MSTDTSSNTPLSKVISLSLDTWAVIIAVARALAVRFDILKNVPW |
| Ga0187848_102626262 | 3300017935 | Peatland | MSTDTSDSSRKGTSFSLDTWALIVAFLLALAVRFGVLKNIPW |
| Ga0187854_100941262 | 3300017938 | Peatland | MSTDTSTTTPSSKGTSLSLDAWAVILAFLLALAVRFDILKNVPW |
| Ga0187854_103570242 | 3300017938 | Peatland | MSTTENTTSSSKGNLLSLDTWAVIVALVLALAVRFDILKNVPW |
| Ga0187853_100660104 | 3300017940 | Peatland | MSTDTSSNTPLSKVISLSLDTWAVIIAVALALAVRFDILKNVPW |
| Ga0187879_105992221 | 3300017946 | Peatland | VIGELSMSTTENTTSSSKGNLLSLDTWAVIVALVLALAVRFDILKNVPW |
| Ga0187879_108080251 | 3300017946 | Peatland | MVIAAEKVPMSTDKSNPSNNSFSLSLDTWAVIAALLLALAVKLDILKNVSW |
| Ga0187847_101372011 | 3300017948 | Peatland | VRIKGGVQMSKETSTTTHSSNGASLSPDTWAVIVAFLLALAVRFGILKNVPW |
| Ga0187783_100460142 | 3300017970 | Tropical Peatland | MSTTDNSTSSSNHALSLDTWAVIVALLVALAVRLDVLKNVPW |
| Ga0187781_111156252 | 3300017972 | Tropical Peatland | MSKDTTTPSSTGTSLSLDVWAVIVAFLLALAVRFDILKNVPW |
| Ga0187861_101384651 | 3300018020 | Peatland | IRGSMIKGEVPMSTDTSTTTPSSKGTSLSLDAWAVILAFLLALAVRFDILKNVPW |
| Ga0187864_101280822 | 3300018022 | Peatland | MSTDTSTTTPSSTGTSLSLDVWALIVAFLLALAVRFDILKNVPW |
| Ga0187881_102804742 | 3300018024 | Peatland | MLTDTSTTTPSSKGTSLSLDAWAVILAFLLALAVRF |
| Ga0187867_102722231 | 3300018033 | Peatland | TSTTTPSSKGTSLSLDAWAVILAFLLALAVRFDILKNVPW |
| Ga0187867_103186961 | 3300018033 | Peatland | MSTDTSTTTPSSKGTSLSLDAWAVILAFLLALAVRFDIL |
| Ga0187863_100783023 | 3300018034 | Peatland | MSTDKSASTASSKSNSLSLDTWAVIVALVLALAVRFDIFRNVPW |
| Ga0187883_105011892 | 3300018037 | Peatland | MATDKSAVPSGSASRLSLDVWAVIVALILALAVRFDIIKNVPW |
| Ga0187862_101039543 | 3300018040 | Peatland | DGEVAMSTDTSDSSRKGTSFSLDTWALIVAFLLALAVRFGVLKNIPW |
| Ga0187871_101819252 | 3300018042 | Peatland | MPMSTVTPATTGSGKGSTISLDGWAVIVALLLALAVRFDVLKNIPW |
| Ga0187871_102002972 | 3300018042 | Peatland | MSTDTSNTTPSSKGTSLSLDVWAVIVAFLLALAVRFDILKSVPW |
| Ga0187859_100825812 | 3300018047 | Peatland | MSTDTSTTTPSSKGTSLSLDAWAVILAFLLALAVRFDILKSVPW |
| Ga0187784_108378332 | 3300018062 | Tropical Peatland | MSKDTTTPSSTETSLSLDLWAVIVAFLLALAVRFDILKNVPW |
| Ga0187784_108379812 | 3300018062 | Tropical Peatland | MSKDTTTPSSTGASLSLDVWAVIVAFLLALAVRFDILKNVPW |
| Ga0187772_109022942 | 3300018085 | Tropical Peatland | MSTDTTTPSSTGASLSLDVWAVIVAFLLALAVRFDILKNVPW |
| Ga0187769_102934183 | 3300018086 | Tropical Peatland | MSTDTTTPSSTGASLSLDVWAVIVAFLLALAVRFDILKKVPW |
| Ga0182025_11912702 | 3300019786 | Permafrost | MSTDKSSTTPSSKGTSFSLDTWALIVAMLLALAVRFDILKNVPW |
| Ga0182031_10358882 | 3300019787 | Bog | MSTDTSDSSRKGTSFSLDTWALIVAFLLALAVRFGVLKDIPW |
| Ga0210403_114018791 | 3300020580 | Soil | MSLKTSANTSASKPNLLSLDTWAVIVALALALAVKFDILKN |
| Ga0210395_100110834 | 3300020582 | Soil | MATDKSTTSSTGSSWLSLDIWAVIVALILALAVRFDILKNVPW |
| Ga0210388_101640772 | 3300021181 | Soil | MSSKTSASTSAGKPSLLSLDTWAVIVALALALAVKFDILKNVPW |
| Ga0210388_102182592 | 3300021181 | Soil | MSTDKSTNTPSSKGPLLSLDAWAVIVAFALALAVRLNILKDVPW |
| Ga0210388_102461102 | 3300021181 | Soil | MSTDKPTATASNKSASLSLDTWAVIAALVLALAVRFDILKNVSW |
| Ga0210385_100958894 | 3300021402 | Soil | MSTDKSTNTPSSKGPLLSLDAWAVIVAFALALAVRLNILKD |
| Ga0210385_112109592 | 3300021402 | Soil | KLPMSTDKSTNTPSSKGPLLSLDAWAVIVAFALALAVRLNILKDVPW |
| Ga0210383_109067892 | 3300021407 | Soil | MSTDKPAAAASNKSASLSLDTWAVIAALVLALAVRFDILKNVSW |
| Ga0210391_105028422 | 3300021433 | Soil | AQGEVSMSTDKPTATASNKSASLSLDTWAVIAALVLALAVRFDILKNVSW |
| Ga0210391_109803842 | 3300021433 | Soil | MATDKSTAAPYSTGSTWLSLDVWAVIVALLLALAVKFDILKNVPW |
| Ga0210391_114663941 | 3300021433 | Soil | MVIAAEKVPMSTDKSNPSNNSFSLSLDTSAVIAALLLALAVKLDILKNVSW |
| Ga0210398_100471702 | 3300021477 | Soil | MSTDKPTATASNKSALLSLDTWAVIAALVLALAVRFDILKNVSW |
| Ga0210402_102672492 | 3300021478 | Soil | MSLKTSANTSASKPNLLSLDTWAVIVALALALAVKFDILKNVPW |
| Ga0224546_10057892 | 3300022515 | Soil | MATDKSTAPSGSASRLSLDVWAVIVALLLALAVRFDIVKNVPW |
| Ga0224541_10012724 | 3300022521 | Soil | MSTDKSTNAGSRKGSLLSLDAWAVIVALALALAVRFDILKDVPW |
| Ga0224541_10037963 | 3300022521 | Soil | MATDKSAKTSSKQSNWLSLDIWAVLIALALALAVRFDILKNVPW |
| Ga0224566_1005711 | 3300022728 | Plant Litter | MSTAENTSKRNPVSLDTWAVITALLLALAVRFDILKNVSVKP |
| Ga0224545_10116904 | 3300022881 | Soil | MSTDKSTPTPSQNSPLLSLDTWAVIAALVLALAVRFDILKNVSW |
| Ga0224558_100112234 | 3300023090 | Soil | MSTDTSTTTPSSTRTSLSLDVWAVIVAFLLALAVRLDILKNVPW |
| Ga0224568_10000464 | 3300024220 | Plant Litter | MSTAENTSKRNPVSLDTWAVITALLLALAVRFDILKNVSVKPATPQFRQ |
| Ga0228598_10090662 | 3300024227 | Rhizosphere | MATDKSTTVPFSTGSSWLSLDVWAVIVALILALAVRFDILKNVPW |
| Ga0208455_10142562 | 3300025453 | Peatland | MSTDTSPTVPSKSNSLSLDTLAVIVALVLALAVRFDIFRNVPW |
| Ga0209849_10617412 | 3300026215 | Soil | MPTSSSKSFALSLDTWAVVLALVLALAVRFDIFKKVPW |
| Ga0209421_10015422 | 3300027432 | Forest Soil | MSTDTRTTPNKAPLLSLDTWAVIVAIALAMAVRFDIFKNVPW |
| Ga0209332_100005615 | 3300027439 | Forest Soil | MSTNSTKTTPSSKGTSISLDAWALIIAALLALAVRFDILKNVPW |
| Ga0209218_10952472 | 3300027505 | Forest Soil | MSTDKPAAAASNKSASLSLDTWAVIAALVLALAVRFDI |
| Ga0209008_10276662 | 3300027545 | Forest Soil | MSTDKPTATASNKSASLSLDTWAVIAALVLALAVRFDILKN |
| Ga0209222_10037694 | 3300027559 | Forest Soil | VIAAEKVPMSTDKSNPSNNSFSLSLDTWAVIAALLLALAVKLDILKNVSW |
| Ga0209222_10818451 | 3300027559 | Forest Soil | MSTDKPTATPSHKSASLSLDTWAVIAALVLALAVRFDILKNVSW |
| Ga0209221_10227843 | 3300027609 | Forest Soil | MSTAENTSKRNPVSLDTWAVIAALLLTLAVRFDILKNVSW |
| Ga0209422_10024996 | 3300027629 | Forest Soil | MATDKSTTIPSSKGTSFSLGALSLDAWALIVAALLALAVRFDILKNVPW |
| Ga0208827_10529033 | 3300027641 | Peatlands Soil | MSTDTSTTTPSSKGTSLSLDAWAVILAFLLAMAVRFDILKNVPW |
| Ga0209420_10151781 | 3300027648 | Forest Soil | LHLAGLTGAQGEVSMSTDKPTATASNKSASLSLDTWAVIAALVLALAVRFDILKNVSW |
| Ga0209007_10134721 | 3300027652 | Forest Soil | VTIICVTIKGEVSMSTDKPTATASNKSASLSLDTWAVIAALVLALAVRFDILKNVSW |
| Ga0209333_10185272 | 3300027676 | Forest Soil | MSTDKSNPSNNSFSLSLDTWAVIAALLLALAVKLDILKNVSW |
| Ga0209333_10758181 | 3300027676 | Forest Soil | MSTAEKSTSSRKRNSVSLDTWAVIVALVLAMLVRFDILKDVPW |
| Ga0209530_10280283 | 3300027692 | Forest Soil | MSTAENTSKRNPVSLDTWAVIAALLLALAVRFDILKNVSW |
| Ga0209446_10505601 | 3300027698 | Bog Forest Soil | MSESDLAPATTNSGKRNTLSLDAWAVIVALLLALAVRFDLVKNIPW |
| Ga0209038_102470481 | 3300027737 | Bog Forest Soil | MTADKSTSTESSKGALLSLDIWAVMIAFILALAVKFGILKNVPW |
| Ga0209772_100682522 | 3300027768 | Bog Forest Soil | MAIEKSTTEAGKGFPLSVDTWAVIVALVLALTVKFNLFKNVPW |
| Ga0209448_100635012 | 3300027783 | Bog Forest Soil | MSSDTSATTPSSKGTSLSLDAWALIVALLLALAVKFDIFKNIPW |
| Ga0209656_102727622 | 3300027812 | Bog Forest Soil | MSDLTSTTTTSAMRNTLSLDAWAVIVALLLALAVRFDVLKNIPW |
| Ga0209274_101961082 | 3300027853 | Soil | MPTETSMNPSSSKVISLSLDTWVLIVAVVLALAVRFGILDNVPW |
| Ga0209274_104197792 | 3300027853 | Soil | MATDKSTAPSGSASRLSLDVWAVIVALILALAVRFDIIKNVPW |
| Ga0209169_104932651 | 3300027879 | Soil | PESTYIKEKVPMATDKSTRVPSSTGSSWLSLDVWAVIVALILALAVRFDILKNVPW |
| Ga0209380_106452492 | 3300027889 | Soil | TDKSTNTPSSKGPLLSLDSWAVIVAVALALAVKFDILKNVPW |
| Ga0209624_102327362 | 3300027895 | Forest Soil | MSTEQPTMSSKGGGVSLDVWAVIVALLLALAVRFDILKNVPW |
| Ga0209006_110290662 | 3300027908 | Forest Soil | MSTDKSTGSPTNNSASLSLDSWAVIAALVLALAVRFDILKNVPW |
| Ga0302145_101484661 | 3300028565 | Bog | DARLIACPGHDGEVAMSTDTSDSSRKGTSFSLDTWALIVAFLLALAVRFGVLKNIPW |
| Ga0302224_102792651 | 3300028759 | Palsa | SANTSSKQSNWLSLDTWAVLVALALALAVRFDILKNVPW |
| Ga0308309_100645712 | 3300028906 | Soil | MSTDKSTATPSNSSALLSLDSWAVIAALLLALAVRLDILKNVSW |
| Ga0308309_101670932 | 3300028906 | Soil | MSTDKSTNTPSSKGPLLSLDSWAVIVAVALALAVKFDILKNVPW |
| Ga0247271_1006662 | 3300029903 | Soil | MSTDTPTTPNQAPLLSLDTWAVIVALVLALAVRFDIFRNVPW |
| Ga0311340_103590911 | 3300029943 | Palsa | SATTSSKGSSLSLDTWAVIAALLLALALRFDIIKNVPW |
| Ga0311339_1000076850 | 3300029999 | Palsa | MSSNKSATTSSKGSSLSLDTWAVIAALLLALALRFDIIKNVPW |
| Ga0311338_100416807 | 3300030007 | Palsa | KSANTSSKQSNWLSLDTWAVLVALALALAVRFDILKNVPW |
| Ga0311338_100669931 | 3300030007 | Palsa | MPTGKSANTSSKQSNWLSLDTWAVLVALALALAVRFDILKNVPW |
| Ga0302177_105037092 | 3300030053 | Palsa | MPTDKSANTSSKQSNWLSLDTWAVLVALALALAVRFDILKNVPW |
| Ga0302176_101298551 | 3300030057 | Palsa | MSSEQNSTSSSKRNLLSLDTWAVIVALLLALAVRFDILKNVPW |
| Ga0311353_109914422 | 3300030399 | Palsa | MTADKWTSTETSKDALLSLDTWAVAIALILALAVKFGILKNVPW |
| Ga0311354_103715152 | 3300030618 | Palsa | MSSEQNSTSSSKRNLLSLDTWAVIVALLLALAVRFD |
| Ga0302310_106613301 | 3300030737 | Palsa | EEMSMSTDKSTNAGSRKGSLLSLDAWAVIVALALALAVRFDILKDVPW |
| Ga0310686_1033761311 | 3300031708 | Soil | MSTDTSTASSKRISLSLDAWAVIVALILALAVRFDVLKNVPW |
| Ga0310686_1117718079 | 3300031708 | Soil | MSTEKPIATRSNHSASLSLDTWAMIAALVLALAVRFGILKNVSW |
| Ga0310686_1141614951 | 3300031708 | Soil | MSTDKSTTTPSNNRGSLSLDTWAVIAALVLALAVKFDILKNVSW |
| Ga0310686_1191225233 | 3300031708 | Soil | MSTKKSLAAKSNNSAALSLDTWAVIAGILLALAVKFDILKNVSSAS |
| Ga0335078_100685855 | 3300032805 | Soil | MSKDASPNAISKTSLLSLDTWAVIVALALALAVKFDVFKNVPW |
| Ga0326727_104018532 | 3300033405 | Peat Soil | MSTDKSTATPSSRSAALSLDTWAVIAALLLALAVRFDILKNVPW |
| Ga0314866_063020_126_254 | 3300033807 | Peatland | MATETESKKPQGPLLSLDTWAVIVALVLALAVRFDILKKVPW |
| Ga0334854_002133_3267_3401 | 3300033829 | Soil | MATDKSAKTSSKQSNWLSLDIWAVLIALALAPAVRFDILKNVPW |
| ⦗Top⦘ |