NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F040938

Metagenome / Metatranscriptome Family F040938

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040938
Family Type Metagenome / Metatranscriptome
Number of Sequences 161
Average Sequence Length 41 residues
Representative Sequence MDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGPPASP
Number of Associated Samples 156
Number of Associated Scaffolds 161

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 96.89 %
% of genes from short scaffolds (< 2000 bps) 96.89 %
Associated GOLD sequencing projects 154
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.031 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil
(8.075 % of family members)
Environment Ontology (ENVO) Unclassified
(24.845 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.373 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 35.29%    β-sheet: 0.00%    Coil/Unstructured: 64.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 161 Family Scaffolds
PF01527HTH_Tnp_1 80.75
PF00248Aldo_ket_red 0.62
PF13701DDE_Tnp_1_4 0.62
PF07592DDE_Tnp_ISAZ013 0.62
PF02371Transposase_20 0.62
PF16355DUF4982 0.62
PF00589Phage_integrase 0.62
PF00440TetR_N 0.62
PF03050DDE_Tnp_IS66 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 161 Family Scaffolds
COG3436TransposaseMobilome: prophages, transposons [X] 0.62
COG3547TransposaseMobilome: prophages, transposons [X] 0.62

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.03 %
UnclassifiedrootN/A4.97 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908029|A2_v1_NODE_4257_len_2359_cov_7_792285All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2409Open in IMG/M
3300000655|AF_2010_repII_A100DRAFT_1088977All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300000878|AL9A1W_1101906All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria722Open in IMG/M
3300000886|AL3A1W_1358774All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria726Open in IMG/M
3300001385|JGI20193J14888_1048491All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300001537|A2065W1_10868865All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1120Open in IMG/M
3300002162|JGI24139J26690_1056469All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300002549|JGI24130J36418_10130329All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300002569|JGI24136J36422_10166552All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300003465|P52013CM_1104404All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300004081|Ga0063454_100750035All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300004267|Ga0066396_10039603All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300005340|Ga0070689_101832582All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300005355|Ga0070671_101978600All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300005436|Ga0070713_101382323All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300005454|Ga0066687_10254907All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300005712|Ga0070764_10274570All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300005827|Ga0074478_1654095All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300005833|Ga0074472_10438351All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300005836|Ga0074470_10714651All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300005873|Ga0075287_1026589All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300005886|Ga0075286_1074367All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300005898|Ga0075276_10171388All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005921|Ga0070766_10816867All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300006031|Ga0066651_10178341All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300006102|Ga0075015_100397594All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300006196|Ga0075422_10121255All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300006795|Ga0075520_1452040All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria509Open in IMG/M
3300006880|Ga0075429_100243920Not Available1574Open in IMG/M
3300006904|Ga0075424_101224499All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300009167|Ga0113563_11844690All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300009609|Ga0105347_1274052All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300009631|Ga0116115_1132816All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia634Open in IMG/M
3300009698|Ga0116216_10320941All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300009943|Ga0117933_1610503All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300010048|Ga0126373_11340151All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300010371|Ga0134125_10914459All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300011084|Ga0138562_1021346All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300011998|Ga0120114_1099455All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia560Open in IMG/M
3300012035|Ga0137445_1127742All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300012152|Ga0137347_1105859All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300012171|Ga0137342_1064880All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium754Open in IMG/M
3300012200|Ga0137382_10511191All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300012204|Ga0137374_10728693All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300012207|Ga0137381_10897968All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300012285|Ga0137370_10557397All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300012684|Ga0136614_10286091All Organisms → cellular organisms → Bacteria1226Open in IMG/M
3300012910|Ga0157308_10430733All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300012913|Ga0157298_10075393All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300012958|Ga0164299_11686027All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300012964|Ga0153916_11686316All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300013297|Ga0157378_12943436All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300013307|Ga0157372_11767593All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300014158|Ga0181521_10027764All Organisms → cellular organisms → Bacteria4422Open in IMG/M
3300014161|Ga0181529_10355189All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300014201|Ga0181537_10790434All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300014266|Ga0075359_1155845All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300014490|Ga0182010_10599402All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300014491|Ga0182014_10447796All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300014493|Ga0182016_10454802All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300014501|Ga0182024_10939947All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300014502|Ga0182021_11490860All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300014502|Ga0182021_11565062All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium794Open in IMG/M
3300014502|Ga0182021_13295810All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300014654|Ga0181525_10684477Not Available575Open in IMG/M
3300014658|Ga0181519_10550660All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300015371|Ga0132258_13715521All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1041Open in IMG/M
3300017926|Ga0187807_1128181All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300017929|Ga0187849_1322010All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300017935|Ga0187848_10226490All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300017970|Ga0187783_10822009All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300018005|Ga0187878_1340682All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300018034|Ga0187863_10308157All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium880Open in IMG/M
3300018037|Ga0187883_10294391All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300018052|Ga0184638_1153237All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300018055|Ga0184616_10362749All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300018076|Ga0184609_10415496All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300018090|Ga0187770_11159417All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300018422|Ga0190265_13017451All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300018468|Ga0066662_10931764All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium855Open in IMG/M
3300018481|Ga0190271_11344542All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300019788|Ga0182028_1022612All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300021407|Ga0210383_10980126All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300021963|Ga0222712_10513696All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300021976|Ga0193742_1093141Not Available1080Open in IMG/M
3300022520|Ga0224538_1038605All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300023077|Ga0247802_1064613All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300023101|Ga0224557_1231204All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300025130|Ga0209594_1208211All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300025322|Ga0209641_11074905All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300025432|Ga0208821_1078068All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300025548|Ga0208716_1091478All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300025619|Ga0207926_1131286All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300025625|Ga0208219_1147579All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300025725|Ga0209638_1253339All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300025852|Ga0209124_10328711All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300025865|Ga0209226_10403177All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300025865|Ga0209226_10439241All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300025888|Ga0209540_10434432All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300025918|Ga0207662_10605932All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300025923|Ga0207681_11856120All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300025928|Ga0207700_11046826All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300026089|Ga0207648_11469380All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300026217|Ga0209871_1079698All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300027334|Ga0209529_1054235All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300027364|Ga0209967_1024032All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300027439|Ga0209332_1087792All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300027634|Ga0209905_1099799All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300027680|Ga0207826_1118479All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300027783|Ga0209448_10164749All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium739Open in IMG/M
3300027787|Ga0209074_10193918All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300027825|Ga0209039_10249565All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300027890|Ga0209496_10676438All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300027911|Ga0209698_11010286All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300028746|Ga0302233_10140996All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300028747|Ga0302219_10137067All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium935Open in IMG/M
3300028859|Ga0302265_1189540All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300028867|Ga0302146_10227914All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300028870|Ga0302254_10274757All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300028906|Ga0308309_11544943All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300029956|Ga0302150_10163589All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300030007|Ga0311338_11512733All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300031028|Ga0302180_10234347All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300031232|Ga0302323_103360208All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300031238|Ga0265332_10218946Not Available790Open in IMG/M
3300031242|Ga0265329_10251922All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300031259|Ga0302187_10414078All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300031521|Ga0311364_11828538All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300031616|Ga0307508_10677243All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300031708|Ga0310686_100846438All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300031711|Ga0265314_10581139All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300031722|Ga0311351_10949668All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300031726|Ga0302321_102557553Not Available596Open in IMG/M
3300031740|Ga0307468_101889486All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300031772|Ga0315288_11420136All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300031781|Ga0318547_10589100All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300031831|Ga0318564_10427740All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300031885|Ga0315285_10568152All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300031896|Ga0318551_10440251All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300031913|Ga0310891_10389729All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300031939|Ga0308174_11312928All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300032342|Ga0315286_12004063All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300032401|Ga0315275_11952820All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300032828|Ga0335080_11645847All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300032892|Ga0335081_12440797All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300032954|Ga0335083_11305471All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300032954|Ga0335083_11483640All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300033402|Ga0326728_10294499All Organisms → cellular organisms → Bacteria1488Open in IMG/M
3300033408|Ga0316605_12194488All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300033482|Ga0316627_101642970All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300033513|Ga0316628_102959717All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300033513|Ga0316628_104202367All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300033521|Ga0316616_103651795All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300033798|Ga0334821_066991All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300033824|Ga0334840_139624All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300033891|Ga0334811_180734All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300033982|Ga0371487_0376607All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300034690|Ga0364923_0107791All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil8.07%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.35%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment3.11%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.11%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.11%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen3.11%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil3.11%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.11%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.48%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.48%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.48%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.48%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.48%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.86%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.86%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.86%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.86%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.86%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.86%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.86%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.24%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.24%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.24%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.24%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.24%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.24%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.24%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.24%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.24%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.24%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.24%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.62%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.62%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.62%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.62%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.62%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.62%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.62%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.62%
Hot Spring Fe-Si SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Fe-Si Sediment0.62%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.62%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.62%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.62%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.62%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.62%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.62%
Ore Pile And Mine Drainage Contaminated SoilEnvironmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil0.62%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.62%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.62%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.62%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.62%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.62%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.62%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.62%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.62%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908029Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2EnvironmentalOpen in IMG/M
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000878Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000886Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001385Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012EnvironmentalOpen in IMG/M
3300001537Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002162Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-21AEnvironmentalOpen in IMG/M
3300002549Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212EnvironmentalOpen in IMG/M
3300002569Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212EnvironmentalOpen in IMG/M
3300003465Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P5 sampleEnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004267Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBioEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005827Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBAEnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005873Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301EnvironmentalOpen in IMG/M
3300005886Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205EnvironmentalOpen in IMG/M
3300005898Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006795Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-BEnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009943Combined Assembly of Gp0139325, Gp0139347, Gp0139348EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300011084Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011998Permafrost microbial communities from Nunavut, Canada - A30_35cm_6MEnvironmentalOpen in IMG/M
3300012035Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2EnvironmentalOpen in IMG/M
3300012152Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2EnvironmentalOpen in IMG/M
3300012171Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014266Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D1EnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018005Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300021976Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c1EnvironmentalOpen in IMG/M
3300022520Peat soil microbial communities from Stordalen Mire, Sweden - 717 E2 20-24EnvironmentalOpen in IMG/M
3300023077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300025130Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring (SPAdes)EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025432Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025548Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025619Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025625Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025725Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes)EnvironmentalOpen in IMG/M
3300025852Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes)EnvironmentalOpen in IMG/M
3300025865Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes)EnvironmentalOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300027334Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027364Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027439Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027634Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1MEnvironmentalOpen in IMG/M
3300027680Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027844Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028859Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_1EnvironmentalOpen in IMG/M
3300028867Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3EnvironmentalOpen in IMG/M
3300028870Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029956Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031238Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaGHost-AssociatedOpen in IMG/M
3300031242Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaGHost-AssociatedOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033798Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-SEnvironmentalOpen in IMG/M
3300033824Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9EnvironmentalOpen in IMG/M
3300033891Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-DEnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300034690Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A2_v1_000669102124908029SoilMDAVTELCLAVGIESACDALGVARASFYRQRPPLGP
AF_2010_repII_A100DRAFT_108897713300000655Forest SoilMDAVTHLAPTVGVVAACDVLGVARASFYRQRPVLGPSA
AL9A1W_110190613300000878PermafrostMDAVSQLAPTVGIESACDALGVARASFYRLRPPLGPPPTAVLS
AL3A1W_135877423300000886PermafrostMDAVSQLAPTVGIESACDALGVARASFYRLRPPLGP
JGI20193J14888_104849113300001385Arctic Peat SoilMDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGPP
A2065W1_1086886513300001537PermafrostMNAVDQLAPTVGIASACEALGVARASFYRQPVFGPALPVPPRS
JGI24139J26690_105646923300002162Arctic Peat SoilMDAVTHLAPTVGIVAACDALAVSRASFYRQRPVLGPPAS
JGI24130J36418_1013032913300002549Arctic Peat SoilMDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGPPASPAPEPALP
JGI24136J36422_1016655223300002569Arctic Peat SoilMDAVTRLAPTVGIVAACDLLAVARASFYRQRPVLGPSVSPAPEPALPLER
P52013CM_110440413300003465Ore Pile And Mine Drainage Contaminated SoilMDAVTHLAPTVGVVAACVFLGVARASFYRQRPVLGPPAAPAPEAA
Ga0063454_10075003523300004081SoilMDAVLQLSSTIGIESACDALGVARASFYRQRPLLGPALSIQLSM
Ga0066396_1003960333300004267Tropical Forest SoilMDAVTQLAPTVGIVAACDFLGVARASFYRQRPVLGPSAVPP
Ga0070689_10183258223300005340Switchgrass RhizosphereMDAVLQLSSTIGIESACDALGVARASFYRQRPLLGPALTIQLSTP
Ga0070671_10197860013300005355Switchgrass RhizosphereMDAVIHLAPTVGVVAACALLAVARASFYRQRPLLGPSASPGPEP
Ga0070713_10138232323300005436Corn, Switchgrass And Miscanthus RhizosphereMDAVIHLAPTVGVVAACDFLAVARASFYRERPVLGPPPSPV
Ga0066687_1025490733300005454SoilMDAVARLAPTVGIVAACDCLAVARASFYRQRPVLGPPASPA
Ga0070764_1027457023300005712SoilMDAVTQLAPTVGIVAACDFLAVARASFYRQRPVLVPPPSPA
Ga0074478_165409513300005827Sediment (Intertidal)MDAVTYLSPSVGVVSACDVLGVARASFYRQRPVLGPPA
Ga0074472_1043835123300005833Sediment (Intertidal)MDAALSLSSSVGIQPACAHLGVARASFYRQRPLLGPLQKPGLLASP
Ga0074470_1071465133300005836Sediment (Intertidal)MDAAAVLASTVGVQAACDVLAVPRATFYRHRPLLGPAPLAASPAS
Ga0075287_102658913300005873Rice Paddy SoilMDAVTHLAPTVGVVAACDALSVARASFYRQRPVLGPPPASPGPGP
Ga0075286_107436723300005886Rice Paddy SoilMEGVTQLAPTVGIVAACDFLGVARASFYRQRPVLGP
Ga0075276_1017138823300005898Rice Paddy SoilMDAVTHLAPTVGVLAACDVLGVARASFYRQRPLFGPPASPAPE
Ga0070766_1081686723300005921SoilMDAVLQLSSTVGVESACDVLGVARASFYRRRPLLGP
Ga0066651_1017834113300006031SoilMDAVTHLAPTVGIVAACNFLAVARASFYRQRPVLGPSASPAPEP
Ga0075015_10039759413300006102WatershedsMDAVLQLSPTVGIESACDALGVARASFYRLRPPLG
Ga0075422_1012125533300006196Populus RhizosphereMEAVLALAPTVGLQAACDHLAVARASFYRQRPRFGP
Ga0075520_145204013300006795Arctic Peat SoilMDAVNQLAPTVGIESACNVLGLPRAAFYRRPVFGPKLL
Ga0075429_10024392023300006880Populus RhizosphereMDAVTQLAPTVGVVAACDFLAVARASFYRQRRVLGDTTK*
Ga0075424_10122449913300006904Populus RhizosphereMDAVTHLAPSVGVLAACDVLGVARASFYRQRPMFGPP
Ga0113563_1184469023300009167Freshwater WetlandsMDAVTHLAPTVGVVAACDSLGVARASFYRQRPVLGPPVSPAPDPVLPGER
Ga0116108_119798813300009519PeatlandMDAVAHLAPTVGIVAACDCLAVARASFYRQRPILGPLASPPPEPVTPSERP
Ga0105347_127405213300009609SoilMDAVLTLSPTVGIQAACDHLAVARASLYRQRPTFGP
Ga0116115_113281623300009631PeatlandMDAVTHLAPTVGVLAACDVLGVARASFYRQRPVLGPPASAPPE
Ga0116216_1032094133300009698Peatlands SoilMDAVAHLAPTVGIVAACDCLAVARASFYRQRPVLGPS
Ga0117933_161050313300009943Hot Spring Fe-Si SedimentMDAVTHLAPTVGVVAACEFLGVARASFYRQRSVLGPSAA
Ga0126373_1134015113300010048Tropical Forest SoilMDAVTRLAPTVGIASACDFLGVARASFYRQRPALGPLATPAPASPDRA
Ga0134125_1091445913300010371Terrestrial SoilMDAVTHLAPTVGVVAACDALGVARASFYRQRPVLGPSS
Ga0138562_102134623300011084Peatlands SoilMDAVTHLAPTVGVVAACDFLGVARASFYRQRPVFGPPA
Ga0120114_109945523300011998PermafrostMNAVDQLAPAVGIESACEALGVARASFYRQPVFGPMPLQSRP
Ga0137445_112774213300012035SoilMDAVDQLAPAVGIESACDALGVSRASFYRQPVFGPALPAPVMV
Ga0137347_110585923300012152SoilMDAVTHLAPTVGVVAACDVLGVARASFYRQRPVLGPPAS
Ga0137342_106488023300012171SoilMDAVQQLAPTIGVESACDVLGLPRASFYRKRPVAGSAL
Ga0137382_1051119123300012200Vadose Zone SoilMDAVTHLAPTVGIVAACDFLAVARASFYRQRPVLSPSVSPVPE
Ga0137374_1072869333300012204Vadose Zone SoilMASVAELGPLVGVTAACETLGVARASFYRQAQPRA
Ga0137381_1089796813300012207Vadose Zone SoilMDAVTHLAPTVGIVAACDFLAVALASFYRQRPVLG
Ga0137370_1055739713300012285Vadose Zone SoilMDATTQLSSIVGIVTACVVLGVSRASFYRQRPLVGPIP
Ga0136614_1028609143300012684Polar Desert SandMEAVEHLAPTVGTAAACHALGVARSRVYRARRRTPDA
Ga0157308_1043073323300012910SoilMEAVLALAPTVGLQAACDHLAVARASFYRQRPRFGPLAA
Ga0157298_1007539323300012913SoilMEAVLALAPTVGLQAACDHLAVARASFYRQRPRFGPLAAPLGPAAI
Ga0164299_1168602723300012958SoilMDAVQELAPAVGIESACDALGVSRASFYRRTAFGPA
Ga0153916_1168631613300012964Freshwater WetlandsMDAVTHLAPTVGVVAACDVLGVARASFYRQRPVLGPSASPAPEL
Ga0157378_1294343613300013297Miscanthus RhizosphereMDAVTHLAPTVGVLAACDVLGVARASFYRQRPVFGLQFHP
Ga0157372_1176759333300013307Corn RhizosphereMDAVAHLAPTVGIVAACDCLAVPRASFYRQRPVLGPSASPAPDEPSMPA
Ga0181521_1002776413300014158BogMDAVTHRVPTGGVVAAGDVLEVARARFYRRRPVLGPLASPAPEPAWPGERSAPA
Ga0181529_1035518913300014161BogMDAVAHLAPTVGIVAACDCLAVARASFYRQRPVLGPSASPAP
Ga0181537_1079043423300014201BogMDAVAHLAPTVGIVAACDCLAVARASFYRQRPVLGPSASPAPE
Ga0075359_115584523300014266Natural And Restored WetlandsMDAVTHLAPTVGVVAACDSLGVVRASFYRQRPVLGPSASPPPA
Ga0182010_1059940213300014490FenMDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGPLASPAPGPALPS
Ga0182014_1044779623300014491BogMDAVAHLAPTVGIVAACDCLAVARASFYRQRPVLGPSASPAPEP
Ga0182016_1045480233300014493BogMDAVTHLSPTVGVVAACDVLGVARASFYRQRPVLGPSAAPLPELPLA
Ga0182024_1093994713300014501PermafrostMDAVHQLAPTVGIEWACDALGVARASFYRQPVFGPALP
Ga0182021_1149086033300014502FenMDAVTHLAPTVGVVAACDSLGVARASFYRQRPVLGPPASPA
Ga0182021_1156506233300014502FenMDAVLQLSSTVGIESACDALGVARASFYRLRPLLGPA
Ga0182021_1329581023300014502FenMDAVVHLAPTVGIVAACDCLAVARASFYRQRPVLGPSASPAPEPV
Ga0181525_1068447723300014654BogMAAVTQLAPSVGVVAACECLGMARASFYRQRPVVGPPTAPPSESTLPCPRP
Ga0181519_1055066023300014658BogMDAVTHLAPTVGIVAACDFLAVARSSFYRQRPVLGSSAW
Ga0132258_1371552133300015371Arabidopsis RhizosphereMMDAVLQLSSTVGIESACDVLGVARASFYRQRPLLGPALSI
Ga0187807_112818123300017926Freshwater SedimentMDAVTQLASTVGVVAACDFLAVARASFYRRRPVLGPSASLAPEPAPP
Ga0187849_132201013300017929PeatlandMDAVTHLAPTVGVVAACDFLGVARASFYRQRPVPGPTASPVPEPVLPAA
Ga0187848_1022649023300017935PeatlandMDAVIHLAPTVGVGAACDALGVARASFYRQRPALGPPPASPV
Ga0187783_1082200923300017970Tropical PeatlandMDAVTHLAPTVGIVAACDFLGVARASFYRQRPVLGPLAT
Ga0187878_134068223300018005PeatlandMDAVTHLAPTVGVVAACDFRGVARASFYRQRPVLGPPASAALEPAVPM
Ga0187863_1030815733300018034PeatlandMDATLQLSCTVGIESACDALGVARASFYRRRPLFG
Ga0187883_1029439133300018037PeatlandMNAVTALAPTVGIVAACDCLAVARASFYRQRPVLGPSASPAPEPVTPSE
Ga0184638_115323713300018052Groundwater SedimentMDAVTRLAPTVGIVAACDFLAVARASFYRQRPVLGPPVSSAP
Ga0184616_1036274913300018055Groundwater SedimentMDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGPPASP
Ga0184609_1041549623300018076Groundwater SedimentMDAVSQLAPTVGVESACDVLGVARASFYRTLPLLRPMLASHMPLTLR
Ga0187770_1115941713300018090Tropical PeatlandMDAVTHLAPTVGVAAACDFLGVARASFYRQRPVLGPPAAPV
Ga0190265_1301745113300018422SoilMDAVTHLAPTVGVLAACDVLGVARASFYRQRPMLGPPASLA
Ga0066662_1093176423300018468Grasslands SoilMDAVLQLSSTVGIESACAVLGVARASFYRQRPLLGPAL
Ga0190271_1134454213300018481SoilMDAVAHLASTVGIVAACDCLTVARASFYRQRPVLGPPASLTAEPALPA
Ga0182028_102261213300019788FenMDAVTHLAPTVGVVAACDFLGVARASFYSFYRQRPVLGPTASP
Ga0210383_1098012623300021407SoilMDAVTHLSPTVGVVAAGDFLGVARASFYRQRPLLGP
Ga0222712_1051369613300021963Estuarine WaterMDAVLSLSPQIGIHSACSCLGVARATFYRQRPFLGPHE
Ga0193742_109314113300021976SoilMDAVSHLSSTVGIESACGALGVARASYYRQRPLLGPFPLAQF
Ga0224538_103860523300022520SoilMDAVTHLAPTVGVFAACDSLGVARASFYRQRPVLGPPP
Ga0247802_106461313300023077SoilMDAVLTLSPTVGIQAACDHLAVARASLYRQRPTFG
Ga0224557_123120413300023101SoilMDAVLLLSVTVGIESACDALGVARASFYRQRPLLGPT
Ga0209594_120821113300025130GroundwaterMNAVTELSPSVGIVTACQALGVARASFYRQRPRLGPPAAPLPEPEPAAA
Ga0209641_1107490513300025322SoilMDAVTHLAPTVGVVAACDLLGVARASFYRQRPILGPPTSPP
Ga0208821_107806823300025432PeatlandMDAVTHLASTVGVRAACDFLGVARASFYRQRPVFGPSASPAPEPALAE
Ga0208716_109147813300025548Arctic Peat SoilMDAVVHLAPTVGTVAACDFLGVARASFYRQRPVLGPS
Ga0207926_113128613300025619Arctic Peat SoilMDAVTHLAPTVGIVAACDALAVSRASFYRQRPVLGPPASP
Ga0208219_114757913300025625Arctic Peat SoilMNAVDQLAPTIGIEPACEALGVARASFYRQPVFGPAW
Ga0209638_125333923300025725Arctic Peat SoilMDAVTHLAPTVGIVAACDALAVSRASFYRQRPVLG
Ga0209124_1032871113300025852Arctic Peat SoilMDAVTHLAPTVGIVAACDALAVSRASFYRQRPVLGPPASPAP
Ga0209226_1040317723300025865Arctic Peat SoilMDAVVHLAPTVGTVAACDFLGVARASFYRQRPVLGPSASPAPEP
Ga0209226_1043924113300025865Arctic Peat SoilMDAVTRLAPTVGIVAACDLLAVARASFYRQRPVLGPSVSPAPEPALP
Ga0209540_1043443213300025888Arctic Peat SoilMDAVTHLAPTVGIVAACDALAVSRASFYRQRPVLGPP
Ga0207662_1060593213300025918Switchgrass RhizosphereMDAVQELAPAVGIESACDALGVSRASFYRRPAFGP
Ga0207681_1185612013300025923Switchgrass RhizosphereMDAVQQLAPTVGIESACDALGVSRASFYRQPAFGPAL
Ga0207700_1104682623300025928Corn, Switchgrass And Miscanthus RhizosphereMDAVIHLAPTVGVVAACDFLAVARASFYRERPVLGPPPSPVPE
Ga0207648_1146938013300026089Miscanthus RhizosphereMDAVLTLSPTVGIQAACDHLAVARASLYRQRPTFGPLAA
Ga0209871_107969813300026217Permafrost SoilMDAVLQLSSTVGIESACDALGVARASFYRRRPLVGPAPSG
Ga0209529_105423513300027334Forest SoilMEAVQELAPTVGIESACDALGVARASFYRQRPVLGPTLPVPVI
Ga0209967_102403213300027364Arabidopsis Thaliana RhizosphereMDAVAHLAPTVGVVAACDFLAAARASFYRQRPVLGPLTALAPEPN
Ga0209332_108779223300027439Forest SoilMEAVTHLSPAVGVVAACDSLGVARASFYRQRPILGPSASPAPDPAL
Ga0209905_109979913300027634Thawing PermafrostMDAVTHLSPTVGVVAACDVLGVARASFYRQRPVLGPSASPLPEPCLLYTSRCV
Ga0207826_111847913300027680Tropical Forest SoilMDAVTHLAPTVGTVAACDFLGVARASFYRQRPVLGPS
Ga0209448_1016474913300027783Bog Forest SoilMDAVRQLVPTVGVESACEALGVARASFYRQPVFGPVLPATV
Ga0209074_1019391823300027787Agricultural SoilMDAVTHLAPTVGVLAACDVLGVARASFYRRRPMLGPPPASPP
Ga0209039_1024956513300027825Bog Forest SoilMDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGPPASPAPEPVLPA
Ga0209501_1053040423300027844MarineMAAAWQLSATVGVESACDALGVARASFYRRRRPSVPRAA
Ga0209496_1067643813300027890WetlandMDAVTHLAPTVGVLAACDFLGVARGSFYRQRPVFGPPALP
Ga0209698_1101028613300027911WatershedsMDAVTHLAPTVGIVAACDVLAVSRASFYRQRPVLGP
Ga0302233_1014099613300028746PalsaMDAVTHLSPTVGVVAACDVLGVARASFYRQRPVLGPSASPLPEPSLA
Ga0302219_1013706723300028747PalsaMDAVLQLSTTVGIESACDALGVARASFYRQRPLLGPT
Ga0302265_118954013300028859BogMNAVTDLAPTVGILAACDFLSVSRASFYRQRPVLGPPVAPA
Ga0302146_1022791423300028867BogMNAVTDLAPTVGIVAACDFLAVSRASFYRQRPILGPPVAPAPGPA
Ga0302254_1027475713300028870FenMDAVTHLAPTVGVVAACDSLGVARASFYRQRPVLGPPASPMPEL
Ga0308309_1154494313300028906SoilMDAVTHLSPTVGVVAACDFLGVARATFYRQRPLLGPSAS
Ga0302150_1016358923300029956BogMNAVTDLAPTVGIVAACDFLAVSRASFYRKRPILGPPVAPAPGPALPVE
Ga0311338_1151273313300030007PalsaMDAVTHLSPTVGVVAACDVLGVARATFYRQRPVLCPSASLLL
Ga0302180_1023434723300031028PalsaMDAVLQLSTTVGIESACDALGVARASFYRQRPLLGPTDGGA
Ga0302323_10336020823300031232FenMDAVVQLAPTVGIVAACDFLAVARASFYRQRPVLGPPSSSAT
Ga0265332_1021894613300031238RhizosphereMDAVIQLVPTVGVVAACDSLGVARASFYRQRPVLGPP
Ga0265329_1025192223300031242RhizosphereMDAVLQLSSTVGIESACDVLDVSRASFYRQRPLLGPA
Ga0302187_1041407813300031259BogMDATLQLSCTVGIESACDALGVARATFYRRRPVFG
Ga0311364_1182853823300031521FenMDAVTHLAPAVGVVAACGSLGVARASFYRQRPVLG
Ga0307508_1067724313300031616EctomycorrhizaMDAVTQLAPAVGIVAACDCLGVSRASFYRLRPVLGPSRLPMPELIPPVD
Ga0310686_10084643813300031708SoilMDAVTQLAPTVGLVAACDFLAVARASFYRQRPVFGPPSSP
Ga0265314_1058113923300031711RhizosphereMDAVLQLSTTVGIESACDALDVARASFYRQRPLLGPTLSALFPA
Ga0311351_1094966823300031722FenMDAVIHLAPTVGFVAACDCLGVPRASFYRQRPVLGPPASSIPEPPLPS
Ga0302321_10255755313300031726FenMDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGSPASPA
Ga0307468_10188948623300031740Hardwood Forest SoilMDAVHQLAPSVGIESACDALGVARASFYRQPVFGPAPF
Ga0315288_1142013613300031772SedimentMDAVTQLAPTVGVVAACDFLGVPRASFYRQRPVLGPPASP
Ga0318547_1058910023300031781SoilMDAVAQLAPTVGVVAACDFLAVARASFYRQRPVLGPSASPA
Ga0318564_1042774023300031831SoilMDAVTRLATAVGVVAACDFLSVARASFYRQRPILGPAAVPAPPAE
Ga0315285_1056815213300031885SedimentMDAVSQLAPTVGIESACDVLGVARASFYRQRLRLGPRLAAP
Ga0318551_1044025123300031896SoilMDAVAQLAPTVGVVAACDFLAVARASFYRQRPVLGPSASPAPEPAPPSE
Ga0310891_1038972923300031913SoilMDAVTHLAPTVGIVAACDCLGVARASFYRQRPVLGPLALPPP
Ga0308174_1131292813300031939SoilMDAVTHLAPTVGIVSACDFLAVARASFYRQRPVLGPSPSPVPE
Ga0315270_1083050113300032275SedimentMDAVTQLAPTVGVVAACDFLAVARASFYRQRPVLGPPVSSAPDPALPLE
Ga0315286_1200406313300032342SedimentMDAVTHLAPTVGVFAACDFLGVARASFYRQRPVLGPPASPA
Ga0315275_1195282013300032401SedimentMDAVRQLAPTVGIESACDVLGVARASFYRQRPRLGPR
Ga0335080_1164584723300032828SoilMDAVTHLAPTVGVAAACDSLGAARASFYRQRPVFGPPLLPPP
Ga0335081_1244079713300032892SoilMDAVTQLAPTVGIVAACDFLGAARASFYRQRPILGPSAVPAAEPTS
Ga0335083_1130547113300032954SoilMDAVTHLAPTVGVVAACDALGVARASFYRQRPVLGPPPA
Ga0335083_1148364023300032954SoilMNAVTELSPAVGVLSACEVLGVARASFYRHRPRLGP
Ga0326728_1029449913300033402Peat SoilMDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGPPAAPTPEPVLAAER
Ga0316605_1219448823300033408SoilMQAVTELSAIVGIVAACDALGIARAAFYRRRPRLRLVEG
Ga0316627_10164297023300033482SoilMDAVTHLAPTVGVLAACDFLGVARGSFYRQRPVFGPPALPPPE
Ga0316628_10295971723300033513SoilMDAVTHLAPTVGVLAACDVLGVARASCYRQRPMLGPPASPASELALPAQ
Ga0316628_10420236713300033513SoilMDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGPPASPAPE
Ga0316616_10365179513300033521SoilMNAVTELTPTVGILAACDFLGVARASFYRQRPRLGPAASSV
Ga0334821_066991_606_7133300033798SoilMDAVAHLAPTVGIVAACDCFAVARASFYRQRPVLGP
Ga0334840_139624_499_6423300033824SoilMDAVTRLAPTVGIVAACDFLAVARASFYRQRPVLGPSASPAPEPVTPS
Ga0334811_180734_3_1163300033891SoilMDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGPAA
Ga0371487_0376607_488_6193300033982Peat SoilMDAVAHLAPTVGIVAACDCLAVARASFYRQRPVLGPPASPAPKP
Ga0364923_0107791_3_1103300034690SedimentMDAVLTLSPTVGIQAACDHLAVARASLYRQRPRFGP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.