| Basic Information | |
|---|---|
| Family ID | F040932 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 161 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MRKDELYLNLAKPLLKLGNYLFNKHVKALRKRQEKEGTRRL |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 72.67 % |
| % of genes near scaffold ends (potentially truncated) | 19.88 % |
| % of genes from short scaffolds (< 2000 bps) | 81.37 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.112 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (31.056 % of family members) |
| Environment Ontology (ENVO) | Unclassified (85.093 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (94.410 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.28% β-sheet: 0.00% Coil/Unstructured: 50.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF00959 | Phage_lysozyme | 14.29 |
| PF13392 | HNH_3 | 2.48 |
| PF01476 | LysM | 1.24 |
| PF00145 | DNA_methylase | 0.62 |
| PF01106 | NifU | 0.62 |
| PF03237 | Terminase_6N | 0.62 |
| PF11351 | GTA_holin_3TM | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.62 |
| COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.11 % |
| All Organisms | root | All Organisms | 37.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 31.06% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 19.25% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.32% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 7.45% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.83% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 4.97% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.11% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.11% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.48% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.86% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.86% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.24% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.24% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.24% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.62% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.62% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.62% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.62% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.62% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.62% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.62% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300012520 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020336 | Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289008-ERR315860) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025694 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300028137 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100295512 | 3300000101 | Marine | MRKDVLYLNLAKPLLKLGNYLFNKHVKALRERQKKEGKRRL* |
| DelMOSum2010_100679394 | 3300000101 | Marine | MSKSVLYLNLAKPILKLGNYLFNKHVKALRENQKKEGKRRL* |
| DelMOSum2010_100922952 | 3300000101 | Marine | MRKDKLYLKLAKPFLRIGNYLMNKHVKALRERQQKDGVRRL* |
| DelMOSum2010_102105681 | 3300000101 | Marine | KDELYLKLAKPFLRIGNYLMNKHVKALRKRQLKDGYRRL* |
| DelMOSum2011_100271233 | 3300000115 | Marine | MRKDVLYLKLAKPFLRIGNYLMNKHVKALRKNQEKEGKRRL* |
| DelMOSum2011_100286953 | 3300000115 | Marine | MSKSVLYLNLAKPILKLGNYLFNKHVKALREKQQKEGARRL* |
| DelMOSum2011_100466673 | 3300000115 | Marine | MRKDVLYLKLAKPFLRIGNYLMNKHVKALRERQKKEGKRRL* |
| DelMOSum2011_100529673 | 3300000115 | Marine | MRKDVLYLNLAKPLLKLGNYLFNKHVKALRERQKEEGKRRL* |
| DelMOSum2011_100975722 | 3300000115 | Marine | MKKDELYLKLAKPFLRIGNYLMNKHVKALRERQLKEGLRRL* |
| DelMOSpr2010_101077523 | 3300000116 | Marine | MRKDKLYLNLAKPLLKLGNYLFNKHVKALREKQEKEGTRRL* |
| DelMOSpr2010_101194983 | 3300000116 | Marine | MRKDELYLXLAKPLLKLGNYLFNXHVKALRXKQEKEGTRRL* |
| DelMOWin2010_101953583 | 3300000117 | Marine | MKKDELYLKLAKPFLRIGNYLMNKHVKALRERQLKDGVRRL* |
| JGI11705J14877_101885971 | 3300001419 | Saline Water And Sediment | MRKEELYLKLAKPFLNIGNCLMRKHVIALRKRQAKEGTRQEIV |
| JGI24006J15134_101824171 | 3300001450 | Marine | MRKDELYLKLAKPILKLGNYLFNKHVKALRENQKKEGKRRL* |
| JGI24003J15210_100583093 | 3300001460 | Marine | MRKDVLYLKLAKPFLRIGNYLMNKHVKALRERQQKDGVRRL* |
| JGI24003J15210_100971413 | 3300001460 | Marine | MRKDVLYLNLAKPLLKLGNYLFNKHVKALREKQKKEGKRRL* |
| JGI24003J15210_101335982 | 3300001460 | Marine | MRKDVLYLNLAKPLLKLGNYLFNKHVKALRKRQEKEGKRRL* |
| JGI24005J15628_101447343 | 3300001589 | Marine | MRKDELYLKLAKPFLRIGNYLMNKHVKALRERQLKDGYRRL* |
| Ga0065861_10868363 | 3300004448 | Marine | MRKDELYLKLAKPFLRIGNYLIKKHVKALRERQKEEGKRRL* |
| Ga0098038_10431482 | 3300006735 | Marine | MKKEELYLKLAKPFLRIGNYLMNKHVKTLREKQRKDGIRRL* |
| Ga0098037_10371773 | 3300006737 | Marine | MKKEELYLKLAKPFLRIGNYLMNKHVKTLREKQKKDGIRRL* |
| Ga0098037_11207831 | 3300006737 | Marine | MKKEELYLNLAKPLLKLGNYLFNKHVKALRKRQEKEGTR |
| Ga0098037_12776933 | 3300006737 | Marine | MRKEELYLNLAKPLLKLGNYLFNKHVKALRRRQEKEGTRRL* |
| Ga0098042_10338505 | 3300006749 | Marine | MRKEELYLSLAKPLLKLGNYLFNKHVKALRKKQEKEGIRRL* |
| Ga0098048_10120925 | 3300006752 | Marine | MSKSVLYLKLAKPILKLGNYLFNKHVKALREKQEKEGTRRL* |
| Ga0098048_10795743 | 3300006752 | Marine | MRKEELYLNLAKPLLKLGNYLFNKHVKALRKRQEKEGTRRL* |
| Ga0098054_10125517 | 3300006789 | Marine | MKKEELYLNLAKPLLKLGNYLFNKHVKALRRRQEKEGTRRL* |
| Ga0098054_10511106 | 3300006789 | Marine | MRKDKLYLSLAKPLLKLGNYLFNKHVKALRKRQEKEGI |
| Ga0070749_106517182 | 3300006802 | Aqueous | MRKEELYLKLAKPFMRIGSYLYNLHVKALRKRQVKEGSRQERL* |
| Ga0075467_101020333 | 3300006803 | Aqueous | MRKDELYLSLAKPLLKLGNYLFNKHVKALREKQEKEGTRRL* |
| Ga0070754_100314363 | 3300006810 | Aqueous | MRKDELYLKLAKPFLRIGNYLMNKHVKALRERQLKEGLRRL* |
| Ga0070750_100126028 | 3300006916 | Aqueous | MRKDVLYLKLAKPFLKIGNYLMNKHVMALRKKQEKEGKKRL* |
| Ga0070748_102372011 | 3300006920 | Aqueous | MKKEELYLKLAKPFLNIGNCLMRKHVIALRKRQAKEGTRQ |
| Ga0098060_10450872 | 3300006921 | Marine | MRKEELYLKLAKPFLRIGNYLMNKHVKALREKQKKDGIRRL* |
| Ga0098060_10632773 | 3300006921 | Marine | MRKDKLYLSLAKPLLKLGNYLFNKHVKALRKRQEKEGIRRL* |
| Ga0098045_10121782 | 3300006922 | Marine | MRKEELYLNLAKPLLKLGNYLFNKHVKALRKRQKKEGTRRL* |
| Ga0098045_10517233 | 3300006922 | Marine | MRKEELYLNLAKPLLKLGNYLFNKHVIALRKRQEKEGTRRL* |
| Ga0098045_10555173 | 3300006922 | Marine | MRKEELYLSLAKPLLKLGNYLFNKHVKALRKRQEKEGTRRL* |
| Ga0099847_11862652 | 3300007540 | Aqueous | MRKDELYLNLAKPLLKLGNYLFNKHVKALREKQQKEGARRL* |
| Ga0102817_10762122 | 3300007555 | Estuarine | MRKDVLYLNLAKPLLKLGNYLFNKHVKALREKQKEEGKRRL* |
| Ga0102948_11449663 | 3300007623 | Water | MRKEELYLKLAKPFMKIGSYLYNLHVKALRKRQVKEGSRQERL* |
| Ga0105737_11485452 | 3300007862 | Estuary Water | MRKDVLYLNLAKPLLKLGNYLFNKHVIALRKRQEKEGTRRL* |
| Ga0114904_10461232 | 3300008218 | Deep Ocean | MRKDVLYLNLAKPLLKLGNYLFNKHVKALRERQNKEGKRRL* |
| Ga0114904_10997753 | 3300008218 | Deep Ocean | MKKEKLYLKLAKPFLKIGNYLMNKHVKALREKQKEEGKRRL* |
| Ga0114910_10364391 | 3300008220 | Deep Ocean | MRKDVFYLKLAKPFLRIGNYLMNRHVKALREKQKEEGKRRL* |
| Ga0102829_11879402 | 3300009026 | Estuarine | MRKDELYLKLAKPFLRIGNYLMNRHVKALRERQLKEGLRRL* |
| Ga0115550_10970714 | 3300009076 | Pelagic Marine | MSKSVLYLNLAKPILKLGNYLFNKHVKALREKQEKEGTRRL* |
| Ga0114903_11265142 | 3300009412 | Deep Ocean | MKKDELYLRLAKPLLKLGNYLFNKHVITLRKKQEKEGIRRL* |
| Ga0114902_11469442 | 3300009413 | Deep Ocean | MRKDVFYLKLAKPFLRIGNYLMNRHVKALRERQKKEGKRRL* |
| Ga0114909_10589941 | 3300009414 | Deep Ocean | MAMHWIYLFMAKPFLRIGNYFMMKHVKALRSRQNKE |
| Ga0115554_10581252 | 3300009472 | Pelagic Marine | MRKDELYLNLAKPLLKLGNYLFNKHVKALREKQEKEGTRRL* |
| Ga0115555_14464762 | 3300009476 | Pelagic Marine | MSKSVLYLNLAKPILKLGNYLFNKHVKALREKQQKEGTRRL* |
| Ga0114932_1002378212 | 3300009481 | Deep Subsurface | MRKEELYLNLAKPLLKLGNYLFNKHVIALRKKQEKEGIRRL* |
| Ga0115567_106406893 | 3300009508 | Pelagic Marine | MSKSVLYLNLAKPILKLGNYLFNKHVKALREKQEKEGTRRL |
| Ga0098043_11604193 | 3300010148 | Marine | MKKEKLYLSLAKPLLKLGNYLFNKHVIALRKRQEKEGTRRL* |
| Ga0098043_11907292 | 3300010148 | Marine | MRKEKLYLLLAKPFLRIGNYLMDKHVKTLRQRQKKEGRRRL* |
| Ga0098049_11284193 | 3300010149 | Marine | MKKEELYLNLAKPLLKLGNYLFNKHVKALRKRQEKE |
| Ga0098049_11806753 | 3300010149 | Marine | MRKEELYLNLAKPLLKLGNYLFNKHVKALRKRQKKEG |
| Ga0098056_10985221 | 3300010150 | Marine | MRKEELYLNLAKPLLKLGNYLFNKHVKALRKRQEKE |
| Ga0098061_11448083 | 3300010151 | Marine | MRKEELYLNLAKPLLKLGNYLFNKHVIALRKKQEKEGTRRL* |
| Ga0098059_11782472 | 3300010153 | Marine | MRKDKLYLSLAKPLLKLGNYLFNKHVIALRKKQEKEGTRRL* |
| Ga0129351_11284602 | 3300010300 | Freshwater To Marine Saline Gradient | MRKDELYLNLAKPLLKLGNYLFNRHVKALREKQEKEGTRRL* |
| Ga0129351_11403592 | 3300010300 | Freshwater To Marine Saline Gradient | MRKDKLYLTLAKPFLRIGNYLMNKHVKALRKRQLKDGYRRL* |
| Ga0129324_103216413 | 3300010368 | Freshwater To Marine Saline Gradient | VLYLNLAKPLLKLGNYLFNKHVKALRERQKKEGKRRL* |
| Ga0129324_103503242 | 3300010368 | Freshwater To Marine Saline Gradient | MRKDVLYLNLAKPLLKLGNYLFKKHVKALRERQKEEGKRRL* |
| Ga0129344_11385561 | 3300012520 | Aqueous | MKKEELYLKLAKPFLNIGNCLMRKHVIALRKRQAKEGTRQEI |
| Ga0163180_100307026 | 3300012952 | Seawater | MRKDELYLNLAKPLLKLGNYLFNKHVKALRKRQEKEGTRRL* |
| Ga0181387_10447782 | 3300017709 | Seawater | MRKDKLYLSLAKPLLKLGNYLFNKHVKALREKQKKEGTRRL |
| Ga0181403_10199774 | 3300017710 | Seawater | MRKDKLYLSLAKPLLKLGNYLFNKHVKALREKQEKEGIRRL |
| Ga0181403_11287743 | 3300017710 | Seawater | MRKDELYLNLAKPLLKLGNYLFNKHVKALRKRQEKEGTRRL |
| Ga0181412_10247507 | 3300017714 | Seawater | MRKDVLYLKLAKPFLRIGNYLMNKHVKALREKQEKEGTRRL |
| Ga0181404_11088193 | 3300017717 | Seawater | MRKDVLYLNLAKPLLKLGNYLFNKHVKALRKRQEKEGIRRL |
| Ga0181383_10498303 | 3300017720 | Seawater | MRKDVFYLKLAKPFLRIGNYLMNRHVKALRERQKKEGKRRL |
| Ga0181373_10159134 | 3300017721 | Marine | MRKEELYLNLAKPLLKLGNYLFNKHVIALRKRQEKEGTR |
| Ga0181398_10960062 | 3300017725 | Seawater | MRKDVLYLNLAKPLLKLGNYLFNKHVKALRRRQEKEGTRRL |
| Ga0181381_10180314 | 3300017726 | Seawater | MRKEKLYLSLAKPLLKLGNYLFNKHVKALRRRQEKEGTRRL |
| Ga0181419_10504703 | 3300017728 | Seawater | MRKDVLYLKLAKPFLRIGNYLMNKHVKTLREKQRKDGIRRL |
| Ga0181417_10170134 | 3300017730 | Seawater | MRKDVLYLSLAKPLLKLGNYLFNKHVIALRKKQEKEGTRRL |
| Ga0181417_10468703 | 3300017730 | Seawater | MKKEELYLSLAKPLLKLGNYLFNKHVIALRKRQEKEGTRRL |
| Ga0181417_11836031 | 3300017730 | Seawater | DVLYLKLAKPFLRIGNYLMNKHVKALRERQKKEGKRRL |
| Ga0181416_10385803 | 3300017731 | Seawater | MRKDKLYLNLAKPLLKLGNYLFNKHVKALRKRQEKEGTRRL |
| Ga0181415_11324132 | 3300017732 | Seawater | MRKDKLYLTLAKPFLRIGNYLMNKHVKALRERQQKDGVRRL |
| Ga0187222_11574972 | 3300017734 | Seawater | MKKEELYLKLAKPFLRIGNYLMNKHVKTLREKQRKD |
| Ga0181433_11219671 | 3300017739 | Seawater | MRKDVLYLKLAKPFLRIGNYLMNKHVKALRKNQEKEGKR |
| Ga0181393_10135178 | 3300017748 | Seawater | MRKDVLYLNLAKPLLKLGNYLFNKHVKALREKQEKEGTRRL |
| Ga0181411_10661373 | 3300017755 | Seawater | MRKNELYLKLAKPFLRIGNYLMNKHVKALREKQLKDGYRRL |
| Ga0181382_11949992 | 3300017756 | Seawater | MRKDELYLNLAKPLLKLGNYLFNKHVKALRRRQEKEGTSIL |
| Ga0181410_10257433 | 3300017763 | Seawater | MRKDELYLKLAKPFLRIGNYLMNKHVKALRERQLKDGYRRL |
| Ga0181385_11347673 | 3300017764 | Seawater | MRKDELYLNLAKPLLKLGNYLMNKHVKALRERQLKEGYRRL |
| Ga0181413_10716021 | 3300017765 | Seawater | MRKDVLYLKLAKPFLRIGNYLMNKHVKALREKQLKDGYRR |
| Ga0181430_11235692 | 3300017772 | Seawater | MRKEELYLNLAKPLLKLGNYLFNKQVIALRKRQEKEGTRRL |
| Ga0181386_10968613 | 3300017773 | Seawater | MRKDVFYLKLAKPFLRIGNYLMNRHVKALRERQKNEGT |
| Ga0181394_11721752 | 3300017776 | Seawater | MRKDKLYLNLAKPLLKLGNYLFNKHVKALRKRQEKEGIRRL |
| Ga0181395_12083773 | 3300017779 | Seawater | MRKDVLYLNLAKPLLKLGNYLFNKHVKALREKQKEEGK |
| Ga0181379_10737182 | 3300017783 | Seawater | MRKDKLYLILAKPFLRIGNYLMNKHVKALRERQEKDGYRRL |
| Ga0194029_10033945 | 3300019751 | Freshwater | MRKDELYLSLAKPLLKLGNYLFNKHVKALREKQEKEGTRRL |
| Ga0206125_102281994 | 3300020165 | Seawater | MRKDKLYLNLAKPLLKLGNYLFNKHVKALREKQEKEGTRRL |
| Ga0211510_10014388 | 3300020336 | Marine | MRKYELYLKLAKPFQKVGNYLMNKHVKALREIQKKEGKRRL |
| Ga0211659_101672673 | 3300020404 | Marine | MKKEELYLSLAKPLLKLGNYLFNKHVKALRKRQEKEGTRRL |
| Ga0211521_101046093 | 3300020428 | Marine | MRKDVLYLNLAKPLLKLGNYLFNKHVKALRKRQEKEGKRRL |
| Ga0211577_100740726 | 3300020469 | Marine | MKKEKLYLSLAKPLLKLGNYLFNKHVIALRKRQEKEGTRRL |
| Ga0211577_100911643 | 3300020469 | Marine | MRKEELYLNLAKPLLKLGNYLFNKHVKALRRRQEKEGTRRL |
| Ga0211577_102977672 | 3300020469 | Marine | MRKDVLYLNLAKPLLKLGNYLFNKHVKALREKQKEEGKRRL |
| Ga0211547_104780352 | 3300020474 | Marine | MRKDVLYLKLAKPFLRIGNYLMNKHVKALREKQKEEGKRRL |
| Ga0206126_100572294 | 3300020595 | Seawater | MRKDELYLNLAKPLLKLGNYLFNKHVKALREKQEKEGTRRL |
| Ga0213860_105184692 | 3300021368 | Seawater | MRKEKLYLLLAKPFLRIGNYLMDKHVKTLRQRQKKEGRRRL |
| Ga0213861_105887901 | 3300021378 | Seawater | YLTLAKPFLRIGNHLMNKHVKALRKRQEKEGIRRL |
| Ga0222718_100697911 | 3300021958 | Estuarine Water | MRKEELYLKLAKPFMKIGSYLYNLHVKALRKRQVKE |
| Ga0222718_101533353 | 3300021958 | Estuarine Water | MRKEELYLKLAKPFMRIGSYLYNLHVKALRKRQVKEGSRQERL |
| Ga0222718_101939614 | 3300021958 | Estuarine Water | MRKEELYLKLAKPFMRIGSYLYNLHVKALRKRQVKEGSR |
| Ga0222718_101942363 | 3300021958 | Estuarine Water | MRKEELYLKLAKPFMRIGSYLYNLHVKALRKRQAKEGSRQERL |
| Ga0222719_100035542 | 3300021964 | Estuarine Water | MRKEELYLKLAKPFMKIGSYLYNLHVKALRKRQVKEGSRQERL |
| Ga0224906_10055806 | 3300022074 | Seawater | MKKEELYLKLAKPFLRIGNYLMNKHVKTLREKQRKDGIRRL |
| Ga0224906_10296255 | 3300022074 | Seawater | MKKDVLYLNLAKPLLKLGNYLFNKHVKALRERQKKEGKRRL |
| Ga0224906_10591663 | 3300022074 | Seawater | MRKDVLYLKLAKPFLRIGNYLMNKHVKALRERQKKEGKRRL |
| Ga0224906_11759983 | 3300022074 | Seawater | MRKEELYLNLAKPLLKLGNYLFNKHVIALRKRQEKEGTRR |
| Ga0196887_10836862 | 3300022178 | Aqueous | MSKSVLYLNLAKPILKLGNYLFNKHVKALRENQKKEGKRRL |
| Ga0196887_11211072 | 3300022178 | Aqueous | MRKDKLYLTLAKPFLRIGNYLMNKHVKALRKRQLKDGYRRL |
| Ga0196899_10113503 | 3300022187 | Aqueous | MRKDELYLKLAKPFLRIGNYLMNKHVKALRERQLKEGLRRL |
| Ga0209992_100575853 | 3300024344 | Deep Subsurface | MRKEELYLNLAKPLLKLGNYLFNKHVIALRKKQEKEGIRRL |
| Ga0244775_108333713 | 3300024346 | Estuarine | NGEIEMRKDKLYLNLAKPLLKLGNYLFNKHVKALRKRQEKEGTRRL |
| Ga0207905_10560762 | 3300025048 | Marine | MRKDELYLKLAKPILKLGNYLFNKHVKALRENQKKEGKRRL |
| Ga0207905_10609173 | 3300025048 | Marine | MRKDELYLRLAKPLLKLGNYLFNKHVKALRENQKKEGKRRL |
| Ga0208667_100070414 | 3300025070 | Marine | MRKEELYLNLAKPLLKLGNYLFNKHVKALRKRQEKEGTRRL |
| Ga0208667_10129365 | 3300025070 | Marine | MSKSVLYLKLAKPILKLGNYLFNKHVKALREKQEKEGTRRL |
| Ga0208667_10174152 | 3300025070 | Marine | MRKEELYLSLAKPLLKLGNYLFNKHVKALRKRQEKEGTRRL |
| Ga0207896_10266993 | 3300025071 | Marine | MRKDELYLKLAKPILKLGNYLFNKHVKALRENQKKEGK |
| Ga0207896_10350503 | 3300025071 | Marine | MKKDELYLKLAKPFLRIGNYLMNRHVKALRERQLKEGLRRL |
| Ga0208791_10161943 | 3300025083 | Marine | MRKEELYLSLAKPLLKLGNYLFNKHVKALRKKQEKEGIRRL |
| Ga0208791_10427273 | 3300025083 | Marine | MRKEELYLNLAKPLLKLGNYLFNKHVIALRKRQEKEGTRRL |
| Ga0208791_10560873 | 3300025083 | Marine | MKKEELYLNLAKPLLKLGNYLFNKHVKALRKRQEKEGT |
| Ga0208157_10499672 | 3300025086 | Marine | MRKDKLYLSLAKPLLKLGNYLFNKHVKALRKRQEKEGIRRL |
| Ga0208434_10495513 | 3300025098 | Marine | MKKEELYLNLAKPLLKLGNYLFNKHVKALRKRQEKEGTRRL |
| Ga0208669_10055507 | 3300025099 | Marine | MRKEELYLNLAKPLLKLGNYLFNKHVKALRKRQKKEGTRRL |
| Ga0208669_10314414 | 3300025099 | Marine | MRKEELYLKLAKPFLRIGNYLMNKHVKALREKQKKDGIRRL |
| Ga0208669_11070711 | 3300025099 | Marine | MRKEELYLSLAKPLLKLGNYLFNKHVIALRKRQEKEGTRRL |
| Ga0208666_11174083 | 3300025102 | Marine | MKKEELYLNLAKPLLKLGNYLFNKHVKALRKRQEKEG |
| Ga0209349_11772432 | 3300025112 | Marine | MKKEELYLSLAKPLLKLGNYLFNKHVIALRKRQEKEGVRRL |
| Ga0209535_10161876 | 3300025120 | Marine | MRKDVLYLKLAKPFLRIGNYLMNKHVKALRERQQKDGVRRL |
| Ga0208919_12090983 | 3300025128 | Marine | MRKDVLYLKLAKPFLRIGNYLMNKHVMALRKKQEKEGKKR |
| Ga0209232_10149577 | 3300025132 | Marine | MRKDRLYLTLAKPFLRIGNYLMNKHVKALREKQLKDGYRRL |
| Ga0209232_11374402 | 3300025132 | Marine | MRKDVLYLNLAKPLLKLGNYLFNKHVIALRKRQEKEGTRRL |
| Ga0209232_11381452 | 3300025132 | Marine | MRKEKLYLNLAKPLLKLGNYLFNKHVIALRKKQAKEGTRRL |
| Ga0209337_10053276 | 3300025168 | Marine | MRKDVLYLNLAKPLLKLGNYLFNKHVKALRKNQEKEGKRRL |
| Ga0208182_10246033 | 3300025251 | Deep Ocean | MRKDVLYLNLAKPLLKLGNYLFNKHVKALRERQKKEGKRRL |
| Ga0208450_11208461 | 3300025301 | Deep Ocean | MRKDVFYLKLAKPFLRIGNYLMNRHVKALREKQKEEGKRRL |
| Ga0208148_10216904 | 3300025508 | Aqueous | MRKDELYLNLAKPLLKLGNYLFNRHVKALREKQEKEGTRRL |
| Ga0208643_11178303 | 3300025645 | Aqueous | MSKSVLYLNLAKPILKLGNYLFNKHVKALREKQQKEGARRL |
| Ga0208134_10154502 | 3300025652 | Aqueous | MRKDVFYLKLAKPFLRIGNYLMNRHVKALRERQKNEGTRRL |
| Ga0208134_11221462 | 3300025652 | Aqueous | MKKDELYLKLAKPFLRIGNYLMNKHVKALRERQLKEGLRRL |
| Ga0209406_10357205 | 3300025694 | Pelagic Marine | MSKSVLYLNLAKPLLKLGNYLFNKHVKALREKQEKEGTR |
| Ga0208899_10140542 | 3300025759 | Aqueous | MRKDVLYLKLAKPFLKIGNYLMNKHVMALRKKQEKEGKKRL |
| Ga0256412_12796671 | 3300028137 | Seawater | MRKDELYLNLAKPLLKLGNYLFNKHVKALRRRQEKEGTRRL |
| Ga0183755_10022085 | 3300029448 | Marine | MKKEKLYLKLAKPFLKIGNYLMNKHVKALREKQKEEGKRRL |
| Ga0183755_10041675 | 3300029448 | Marine | MRKDVFYLKLAKPFLRIGNYLMNKHVKALRERQKKEGKRRL |
| Ga0183755_10264393 | 3300029448 | Marine | MRKDVLYLNLAKPLLKLGNYLFNKHVKALRERQKEEGKRRL |
| Ga0183757_10352243 | 3300029787 | Marine | MKKEKLYLKLAKPFLRIGNYLMNKHVKALREKQKEEGKRRL |
| Ga0315320_106640573 | 3300031851 | Seawater | MRKDKLYLSLAKPLLKLGNYLFNKHVKALRKRQEKEGTRRL |
| Ga0316203_11316112 | 3300032274 | Microbial Mat | MRKDKLYLKLAKPFLRIGNYLMNKHVKALRERQQKDGVRRL |
| Ga0316203_12367421 | 3300032274 | Microbial Mat | MRKDKLYLNLAKPLLKLGNYLFNKHVKALRRRQEKEGTRRL |
| Ga0316202_106163712 | 3300032277 | Microbial Mat | MRKDKLYLSLAKPLLKLGNYLFNKHVKALREKQEKEGTRRL |
| ⦗Top⦘ |