NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F040928

Metagenome Family F040928

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040928
Family Type Metagenome
Number of Sequences 161
Average Sequence Length 42 residues
Representative Sequence GLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK
Number of Associated Samples 139
Number of Associated Scaffolds 161

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.62 %
% of genes near scaffold ends (potentially truncated) 98.76 %
% of genes from short scaffolds (< 2000 bps) 91.93 %
Associated GOLD sequencing projects 129
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.758 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(9.938 % of family members)
Environment Ontology (ENVO) Unclassified
(45.342 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(62.733 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.72%    β-sheet: 0.00%    Coil/Unstructured: 49.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 161 Family Scaffolds
PF02563Poly_export 60.25
PF10531SLBB 19.88
PF02706Wzz 3.11
PF13807GNVR 1.86
PF14559TPR_19 1.24
PF01061ABC2_membrane 1.24
PF12833HTH_18 0.62
PF01370Epimerase 0.62
PF13424TPR_12 0.62
PF04325DUF465 0.62
PF14306PUA_2 0.62
PF13181TPR_8 0.62
PF13414TPR_11 0.62
PF16363GDP_Man_Dehyd 0.62
PF13579Glyco_trans_4_4 0.62
PF13578Methyltransf_24 0.62
PF13432TPR_16 0.62
PF00196GerE 0.62
PF14332DUF4388 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 161 Family Scaffolds
COG1596Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp foldCell wall/membrane/envelope biogenesis [M] 60.25
COG3206Exopolysaccharide export protein/domain GumC/Wzc1Cell wall/membrane/envelope biogenesis [M] 3.11
COG3524Capsule polysaccharide export protein KpsE/RkpRCell wall/membrane/envelope biogenesis [M] 3.11
COG3765LPS O-antigen chain length determinant protein, WzzB/FepE familyCell wall/membrane/envelope biogenesis [M] 3.11
COG3944Capsular polysaccharide biosynthesis protein YveKCell wall/membrane/envelope biogenesis [M] 3.11


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.76 %
UnclassifiedrootN/A1.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2032320005|FACEOR_FY84VJD01B8PESAll Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300000559|F14TC_103350814All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300000574|JGI1357J11328_10147682All Organisms → cellular organisms → Bacteria → Acidobacteria670Open in IMG/M
3300000789|JGI1027J11758_11333869All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300001431|F14TB_101863455All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300003993|Ga0055468_10198026All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300004156|Ga0062589_101565566All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300004480|Ga0062592_100845442All Organisms → cellular organisms → Bacteria → Acidobacteria817Open in IMG/M
3300004480|Ga0062592_101549963All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M
3300004643|Ga0062591_102101606All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300005171|Ga0066677_10556866All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300005177|Ga0066690_10005645All Organisms → cellular organisms → Bacteria5856Open in IMG/M
3300005180|Ga0066685_10260977All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1196Open in IMG/M
3300005180|Ga0066685_10660616All Organisms → cellular organisms → Bacteria → Acidobacteria719Open in IMG/M
3300005289|Ga0065704_10288634All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes908Open in IMG/M
3300005293|Ga0065715_10164505All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium1599Open in IMG/M
3300005293|Ga0065715_10516329All Organisms → cellular organisms → Bacteria → Acidobacteria767Open in IMG/M
3300005294|Ga0065705_10106560All Organisms → cellular organisms → Bacteria6485Open in IMG/M
3300005295|Ga0065707_10952964All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300005329|Ga0070683_102036942All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300005330|Ga0070690_100649755All Organisms → cellular organisms → Bacteria → Acidobacteria805Open in IMG/M
3300005334|Ga0068869_100603146All Organisms → cellular organisms → Bacteria → Acidobacteria928Open in IMG/M
3300005334|Ga0068869_102131696All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300005337|Ga0070682_101247585All Organisms → cellular organisms → Bacteria → Acidobacteria629Open in IMG/M
3300005343|Ga0070687_100228831All Organisms → cellular organisms → Bacteria → Acidobacteria1143Open in IMG/M
3300005364|Ga0070673_100704953All Organisms → cellular organisms → Bacteria → Acidobacteria927Open in IMG/M
3300005439|Ga0070711_100490692All Organisms → cellular organisms → Bacteria → Acidobacteria1011Open in IMG/M
3300005441|Ga0070700_100625590All Organisms → cellular organisms → Bacteria → Acidobacteria847Open in IMG/M
3300005445|Ga0070708_100639107All Organisms → cellular organisms → Bacteria → Acidobacteria1003Open in IMG/M
3300005445|Ga0070708_101605234All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300005445|Ga0070708_101634377All Organisms → cellular organisms → Bacteria → Acidobacteria599Open in IMG/M
3300005454|Ga0066687_10523688All Organisms → cellular organisms → Bacteria → Acidobacteria702Open in IMG/M
3300005459|Ga0068867_100311108All Organisms → cellular organisms → Bacteria → Acidobacteria1302Open in IMG/M
3300005459|Ga0068867_100818238All Organisms → cellular organisms → Bacteria → Acidobacteria832Open in IMG/M
3300005539|Ga0068853_101221933All Organisms → cellular organisms → Bacteria → Acidobacteria726Open in IMG/M
3300005543|Ga0070672_101565526All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300005545|Ga0070695_100489931All Organisms → cellular organisms → Bacteria → Acidobacteria949Open in IMG/M
3300005546|Ga0070696_100086891All Organisms → cellular organisms → Bacteria → Acidobacteria2221Open in IMG/M
3300005546|Ga0070696_101668337All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300005549|Ga0070704_100451012All Organisms → cellular organisms → Bacteria → Acidobacteria1107Open in IMG/M
3300005553|Ga0066695_10307842All Organisms → cellular organisms → Bacteria → Acidobacteria998Open in IMG/M
3300005566|Ga0066693_10453701All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300005575|Ga0066702_10421950All Organisms → cellular organisms → Bacteria → Acidobacteria816Open in IMG/M
3300005578|Ga0068854_101565299All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300005615|Ga0070702_100220832All Organisms → cellular organisms → Bacteria → Acidobacteria1267Open in IMG/M
3300005616|Ga0068852_101751820All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300005617|Ga0068859_100493266All Organisms → cellular organisms → Bacteria → Acidobacteria1320Open in IMG/M
3300005617|Ga0068859_102863075All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300005618|Ga0068864_101690439All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M
3300005618|Ga0068864_101844211All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300005764|Ga0066903_106224416All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300005840|Ga0068870_10187602All Organisms → cellular organisms → Bacteria → Acidobacteria1245Open in IMG/M
3300005841|Ga0068863_101764399All Organisms → cellular organisms → Bacteria → Acidobacteria629Open in IMG/M
3300005842|Ga0068858_100506992All Organisms → cellular organisms → Bacteria → Acidobacteria1166Open in IMG/M
3300005843|Ga0068860_100867934All Organisms → cellular organisms → Bacteria → Acidobacteria918Open in IMG/M
3300006755|Ga0079222_10185805All Organisms → cellular organisms → Bacteria1231Open in IMG/M
3300006806|Ga0079220_11729426All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300006845|Ga0075421_101501715All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300006852|Ga0075433_10139440All Organisms → cellular organisms → Bacteria → Acidobacteria2155Open in IMG/M
3300006854|Ga0075425_100425163Not Available1530Open in IMG/M
3300006903|Ga0075426_10966579All Organisms → cellular organisms → Bacteria → Acidobacteria643Open in IMG/M
3300006904|Ga0075424_101095878All Organisms → cellular organisms → Bacteria → Acidobacteria849Open in IMG/M
3300007004|Ga0079218_11269989All Organisms → cellular organisms → Bacteria → Acidobacteria772Open in IMG/M
3300007076|Ga0075435_100013953All Organisms → cellular organisms → Bacteria5992Open in IMG/M
3300007076|Ga0075435_101459521All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300009011|Ga0105251_10450113All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes597Open in IMG/M
3300009090|Ga0099827_11999145All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300009093|Ga0105240_11810315All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300009094|Ga0111539_12944845All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300009098|Ga0105245_11642484All Organisms → cellular organisms → Bacteria → Acidobacteria695Open in IMG/M
3300009101|Ga0105247_10161080All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1486Open in IMG/M
3300009147|Ga0114129_12449564All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300009156|Ga0111538_11136366All Organisms → cellular organisms → Bacteria → Acidobacteria987Open in IMG/M
3300009156|Ga0111538_13994593All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300009162|Ga0075423_12561327All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300009177|Ga0105248_10496366All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1376Open in IMG/M
3300009545|Ga0105237_10004118All Organisms → cellular organisms → Bacteria16956Open in IMG/M
3300009789|Ga0126307_11444889All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes557Open in IMG/M
3300010037|Ga0126304_11278453All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300010038|Ga0126315_10460800All Organisms → cellular organisms → Bacteria → Acidobacteria806Open in IMG/M
3300010040|Ga0126308_10572516All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes768Open in IMG/M
3300010045|Ga0126311_11516309All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300010046|Ga0126384_10243711All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1449Open in IMG/M
3300010046|Ga0126384_11213497All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium696Open in IMG/M
3300010047|Ga0126382_10177720All Organisms → cellular organisms → Bacteria → Acidobacteria1490Open in IMG/M
3300010304|Ga0134088_10612979All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300010360|Ga0126372_12403082All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300010362|Ga0126377_11863166All Organisms → cellular organisms → Bacteria → Acidobacteria677Open in IMG/M
3300010362|Ga0126377_13594397All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300010366|Ga0126379_10040339All Organisms → cellular organisms → Bacteria → Acidobacteria3751Open in IMG/M
3300010399|Ga0134127_11933716All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes667Open in IMG/M
3300010399|Ga0134127_12889226All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes559Open in IMG/M
3300010401|Ga0134121_11596008All Organisms → cellular organisms → Bacteria → Acidobacteria672Open in IMG/M
3300011119|Ga0105246_10892525All Organisms → cellular organisms → Bacteria → Acidobacteria796Open in IMG/M
3300011271|Ga0137393_11087659All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300012184|Ga0136610_1239122All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300012203|Ga0137399_10377146All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium1181Open in IMG/M
3300012207|Ga0137381_10438351All Organisms → cellular organisms → Bacteria → Acidobacteria1140Open in IMG/M
3300012208|Ga0137376_10989780All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300012208|Ga0137376_11424600All Organisms → cellular organisms → Bacteria → Acidobacteria584Open in IMG/M
3300012350|Ga0137372_10057949All Organisms → cellular organisms → Bacteria → Acidobacteria3386Open in IMG/M
3300012353|Ga0137367_10237926All Organisms → cellular organisms → Bacteria → Acidobacteria1311Open in IMG/M
3300012918|Ga0137396_10916115All Organisms → cellular organisms → Bacteria → Acidobacteria641Open in IMG/M
3300012922|Ga0137394_10223174All Organisms → cellular organisms → Bacteria1611Open in IMG/M
3300012923|Ga0137359_11472099All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300012929|Ga0137404_11758028All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300012929|Ga0137404_11997453All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300012930|Ga0137407_10455469All Organisms → cellular organisms → Bacteria → Acidobacteria1191Open in IMG/M
3300012930|Ga0137407_12371520All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300012948|Ga0126375_11384116All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300012957|Ga0164303_10902878All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes619Open in IMG/M
3300012975|Ga0134110_10183602All Organisms → cellular organisms → Bacteria → Acidobacteria873Open in IMG/M
3300012977|Ga0134087_10515245All Organisms → cellular organisms → Bacteria → Acidobacteria604Open in IMG/M
3300013100|Ga0157373_10252050All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1249Open in IMG/M
3300013102|Ga0157371_11058750All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300013296|Ga0157374_10629664All Organisms → cellular organisms → Bacteria → Acidobacteria1084Open in IMG/M
3300013297|Ga0157378_10849472All Organisms → cellular organisms → Bacteria → Acidobacteria941Open in IMG/M
3300013307|Ga0157372_12658776All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300014325|Ga0163163_11830258All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300015200|Ga0173480_10894063All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300015371|Ga0132258_10310303All Organisms → cellular organisms → Bacteria3884Open in IMG/M
3300017792|Ga0163161_11278471All Organisms → cellular organisms → Bacteria → Acidobacteria637Open in IMG/M
3300018422|Ga0190265_12564310All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300018431|Ga0066655_11134100All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300018468|Ga0066662_10457040All Organisms → cellular organisms → Bacteria → Acidobacteria1146Open in IMG/M
3300019767|Ga0190267_11145841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi564Open in IMG/M
3300025325|Ga0209341_10580170All Organisms → cellular organisms → Bacteria → Acidobacteria882Open in IMG/M
3300025885|Ga0207653_10006374All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes3682Open in IMG/M
3300025918|Ga0207662_11197114All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300025927|Ga0207687_11549084All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300025935|Ga0207709_11866966All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300025936|Ga0207670_11550308All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes563Open in IMG/M
3300025940|Ga0207691_11280028All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300025942|Ga0207689_10311836All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1305Open in IMG/M
3300025945|Ga0207679_10877709All Organisms → cellular organisms → Bacteria → Acidobacteria820Open in IMG/M
3300025945|Ga0207679_11853891All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300025961|Ga0207712_10455301All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1086Open in IMG/M
3300025981|Ga0207640_10463824All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1047Open in IMG/M
3300026075|Ga0207708_10058550All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2939Open in IMG/M
3300026095|Ga0207676_10742205All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes954Open in IMG/M
3300026095|Ga0207676_10971635All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes836Open in IMG/M
3300026095|Ga0207676_11920605All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300026116|Ga0207674_10713733All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes968Open in IMG/M
3300026118|Ga0207675_100120725All Organisms → cellular organisms → Bacteria2479Open in IMG/M
3300026142|Ga0207698_11780515All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes631Open in IMG/M
3300026527|Ga0209059_1303088All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300027654|Ga0209799_1040568All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1038Open in IMG/M
3300027725|Ga0209178_1437848All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300027875|Ga0209283_10249876All Organisms → cellular organisms → Bacteria → Acidobacteria1176Open in IMG/M
3300028047|Ga0209526_10392740All Organisms → cellular organisms → Bacteria → Acidobacteria922Open in IMG/M
3300028381|Ga0268264_11507274All Organisms → cellular organisms → Bacteria → Acidobacteria683Open in IMG/M
3300028381|Ga0268264_12536927All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300031731|Ga0307405_10340407All Organisms → cellular organisms → Bacteria → Acidobacteria1153Open in IMG/M
3300031740|Ga0307468_101358867All Organisms → cellular organisms → Bacteria → Acidobacteria650Open in IMG/M
3300031824|Ga0307413_11780185All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300032005|Ga0307411_12256415All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes511Open in IMG/M
3300032074|Ga0308173_10721405All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes912Open in IMG/M
3300033475|Ga0310811_10932658All Organisms → cellular organisms → Bacteria → Acidobacteria776Open in IMG/M
3300034175|Ga0334939_0122031All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_53_8830Open in IMG/M
3300034376|Ga0334923_029695All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Akkermansiaceae → Akkermansia1153Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere8.07%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.45%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.97%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.11%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.48%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.48%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.48%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.86%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.86%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.86%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.86%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.86%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.24%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.24%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.24%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.24%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.24%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.24%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.24%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.24%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.24%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.62%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.62%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.62%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.62%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.62%
BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust0.62%
Hypolithic BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust0.62%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.62%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2032320005Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2-EnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000574Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 mEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012184Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ134 (22.06)EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034175Biocrust microbial communities from Mojave Desert, California, United States - 35SMCEnvironmentalOpen in IMG/M
3300034376Biocrust microbial communities from Mojave Desert, California, United States - 19HNCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACEORA_12608802032320005SoilYDDLMVLVSNTVLNLARPNHMREALLSRRIGLGGK
F14TC_10335081423300000559SoilEHEELLVLLSNTVLNLANPNHMREALLSRRIGIAGK*
JGI1357J11328_1014768223300000574GroundwaterYEELMVLVSNTVLNLAHPNHMREALLSRRMGLGGK*
JGI1027J11758_1133386923300000789SoilGPLTGAFAREHEELMILLSNTVLNLAHPNHIREAMLSRRMAMGH*
F14TB_10186345523300001431SoilEHEELLVLLSNTVLNLAHPNHMREALLSRRVGMSGK*
Ga0055468_1019802623300003993Natural And Restored WetlandsRGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0062589_10156556623300004156SoilFRRQHEELLVLLSNTILNLAHPNHMREALLSRRIGISGK*
Ga0062592_10084544223300004480SoilVVKTGEQPLTGLFRREHQELLVLLSNTVLNLAHPNHMREALLSRRLGVSGR*
Ga0062592_10154996313300004480SoilLTGVFVRDNEELMVVLSNTVLNVANQNHLNEALSSRRLKKTKGS*
Ga0062591_10210160623300004643SoilLTGSFKREHEELMVLLSNTVLNLAHPNHMREALLSRRVGLARK*
Ga0066677_1055686613300005171SoilGTFLREYGELMVLVSNTVLNLAHPNHMREALLSRRSGLGRK*
Ga0066690_1000564513300005177SoilGAFRREHDELMVLVSNTVLNLAHPNHMREALLSRRIGLAGK*
Ga0066685_1026097713300005180SoilNPLTGMFLRDHEELMVLVSNTVLNLAHPNHMREALLSRRIGLGKK*
Ga0066685_1066061613300005180SoilQDKPLTGMFQREHEELLVLVSNTVLNLAHPNHMREALLSRRVGLSGK*
Ga0065704_1028863423300005289Switchgrass RhizosphereGEQPLTGIFKREHEELLVILSNTVLNLAHPNHMREALLSRRIGIAGK*
Ga0065715_1016450513300005293Miscanthus RhizosphereEQPLTGIFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGIAGK*
Ga0065715_1051632923300005293Miscanthus RhizosphereVVKTGEQPLTGLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0065705_1010656013300005294Switchgrass RhizosphereLFKREHEELLVLLSNTVLNLAHPNHMREALMSRRIGMTGR*
Ga0065707_1095296423300005295Switchgrass RhizosphereLTGSFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMAGK*
Ga0070683_10203694223300005329Corn RhizosphereQPLTGLFRREHEELMVLLSNTILNLAHPNHMREALLSRRIGMSGK*
Ga0070690_10064975513300005330Switchgrass RhizosphereLTGLFRREHEELMVLLSNTVLNLACPNHMREALLSRRVGMAGK*
Ga0068869_10060314623300005334Miscanthus RhizosphereFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSSRG*
Ga0068869_10213169613300005334Miscanthus RhizosphereGEQPLTGLFKREHEELMVLLSNTVLNLAHPNHMREALLSRKTGMVGK*
Ga0070682_10124758523300005337Corn RhizosphereLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRVGMSGHR*
Ga0070687_10022883113300005343Switchgrass RhizosphereEFSREHSELMVLVSNTVLNLAHPNHMREALLSRRMGLGGK*
Ga0070673_10070495323300005364Switchgrass RhizosphereKTGEQPLTGLFKREHEELMVLLSNTVLNLAHPNHMREALLSRRTGMSGK*
Ga0070711_10049069213300005439Corn, Switchgrass And Miscanthus RhizosphereDNPLTGAFRRDHEELMVLVSNTVLNLAHPNHMREALASRRIGLGGK*
Ga0070700_10062559023300005441Corn, Switchgrass And Miscanthus RhizosphereFNREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0070708_10063910713300005445Corn, Switchgrass And Miscanthus RhizosphereGDQPLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMAGK*
Ga0070708_10160523423300005445Corn, Switchgrass And Miscanthus RhizosphereGLFRREHQELLVLLSNTVLNLAHPNHMREALLSRRLGISGR*
Ga0070708_10163437713300005445Corn, Switchgrass And Miscanthus RhizosphereDQPLTGQFRREHEELMVLLSNTVLNLAHPNHMREALLSRKVGLSSR*
Ga0066687_1052368823300005454SoilGMFRRDHEELMVLVSNTVLNLAHPNHMREALASRRIGLGGK*
Ga0068867_10031110813300005459Miscanthus RhizosphereGLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRLGMSGK*
Ga0068867_10081823823300005459Miscanthus RhizosphereLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGIAGK*
Ga0068853_10122193323300005539Corn RhizosphereEQPLTGLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRVGMSGHR*
Ga0070672_10156552623300005543Miscanthus RhizosphereHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0070695_10048993123300005545Corn, Switchgrass And Miscanthus RhizosphereLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRLGMSGK*
Ga0070696_10008689113300005546Corn, Switchgrass And Miscanthus RhizosphereLFKREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0070696_10166833723300005546Corn, Switchgrass And Miscanthus RhizosphereTKTGEQPLTGLFNREHEELLVLLSNTILNLAHPNHMREALLSRRVGISGK*
Ga0070704_10045101223300005549Corn, Switchgrass And Miscanthus RhizosphereDNPLTGTFKREHEELLVLLSNTVLNLAHPNHMREALLSRRVGLARK*
Ga0066695_1030784223300005553SoilQDGPLTGEFLREHEELMVLVSNTVLSLAHPNHMREALLSRRIGLGGK*
Ga0066693_1045370113300005566SoilTGTFRRDHEELMVMVSNTVLNLAHPNHMREALLSRRLGLGGK*
Ga0066702_1042195023300005575SoilTGAFRREHDDLMVLVSNTVLNLARPNHMREALLSRRIGLGGK*
Ga0068854_10156529923300005578Corn RhizosphereKTGEQPLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0070702_10022083223300005615Corn, Switchgrass And Miscanthus RhizosphereLFRREHEELMVLLSNTILNLAHPNHMREALLSRRIGMSGK*
Ga0068852_10175182013300005616Corn RhizosphereGLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0068859_10049326623300005617Switchgrass RhizosphereGDNPLTGAFRRDHEELLVLVSNTVLNLAHPNHMREALASRRIGLGGK*
Ga0068859_10286307513300005617Switchgrass RhizosphereFNREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGHR*
Ga0068864_10169043923300005618Switchgrass RhizosphereGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGHR*
Ga0068864_10184421123300005618Switchgrass RhizosphereEHEELLVLLSNTVLNLAHPNHMREALTSRRIGISGK*
Ga0066903_10622441623300005764Tropical Forest SoilTFRRDHEELMVLVSNTVLNLAHPNHMREALLSRRIGLGGK*
Ga0068870_1018760233300005840Miscanthus RhizosphereGLFNREHEELMVLLSNTVLNLAHPNHMREALLSRRIAMSGK*
Ga0068863_10176439913300005841Switchgrass RhizosphereREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSSRG*
Ga0068858_10050699213300005842Switchgrass RhizosphereEHEELMVLLSNTVLNLACPNHMREALLSRRVGMAGK*
Ga0068860_10086793423300005843Switchgrass RhizosphereEELMVLLSNTVLNLAHPNHMREALLSRRLGMSGK*
Ga0079222_1018580513300006755Agricultural SoilGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRLGMSGK*
Ga0079220_1172942613300006806Agricultural SoilTGEQPLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0075421_10150171523300006845Populus RhizosphereEQPLTGLFRREHQELLVLLSNTVLNLAHPNHMREALLSRRLGISGR*
Ga0075433_1013944013300006852Populus RhizosphereHEELLVLLSNTVLNLAHPNHMREALLSRRVGMAGK*
Ga0075425_10042516333300006854Populus RhizosphereRENEELMVLLANTVLNVAHPIHLREALLARRTGLARR*
Ga0075426_1096657923300006903Populus RhizosphereQDQPLTGAYVREYDDLMVLVSNTVLNLARPNHMREALLSRRIGLGGK*
Ga0075424_10109587823300006904Populus RhizosphereQPLRGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRVGMAGK*
Ga0079218_1126998913300007004Agricultural SoilDSPLTGTFKRDHEELMVLLSNTVLNLAHPNHMREALLSRRVGLARK*
Ga0075435_10001395313300007076Populus RhizosphereENEELMIVLSNTVLNLAHPNHIREAMMSRRTALGH*
Ga0075435_10145952123300007076Populus RhizosphereFKREHEELLVLLSNTVLNLAHPNHMREALLSRRVGMAGK*
Ga0105251_1045011323300009011Switchgrass RhizosphereGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMGHR*
Ga0099827_1199914523300009090Vadose Zone SoilGPLTGEFLREYEELMVLVSNTVLNLAHPNHMREALLSRRIGLGGK*
Ga0105240_1181031513300009093Corn RhizosphereLTGLFRREHEELMVLLSNTVLNLAHPNHIREALLSRRIGMSGK*
Ga0111539_1294484513300009094Populus RhizosphereKREHEELLVILSNTVLNLAHPNHMREALLSRRIGIAGK*
Ga0105245_1164248413300009098Miscanthus RhizosphereTFKREHEELLVLLSNTVLNLAHPNHMREALLSRRVGLARK*
Ga0105247_1016108033300009101Switchgrass RhizosphereLTGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMGHR*
Ga0114129_1244956423300009147Populus RhizosphereFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMAGK*
Ga0111538_1113636613300009156Populus RhizosphereREHEELMVLLSNTVLNLAHPNHMREALLSRKTGMVGK*
Ga0111538_1399459323300009156Populus RhizosphereEHEELLVLLSNTVLNLAHPNHMREALLSRRIGIAGK*
Ga0075423_1256132723300009162Populus RhizosphereEHEELLVLLRNTVLNLAHPNHMREALLSRRVGMAGK*
Ga0105248_1049636613300009177Switchgrass RhizosphereFKREHEELMVLLSNTVLNLAHPNNMREALLSRKTGMGK*
Ga0105237_10004118163300009545Corn RhizosphereLFRREHEELMVLLSNTVLNLACPNHMREALLSRRVGMAGK*
Ga0126307_1144488923300009789Serpentine SoilEGIVVKTGEQPLTGLFKREHEELLVLLSNTILNLAHPNHMREALLSRRIGMSGK*
Ga0126304_1127845323300010037Serpentine SoilTGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0126315_1046080023300010038Serpentine SoilEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0126308_1057251613300010040Serpentine SoilEQPLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGISGK*
Ga0126311_1151630913300010045Serpentine SoilEYEELMVIMSNTVLNLAHPNHTREALASRHLGLAKR*
Ga0126384_1024371113300010046Tropical Forest SoilIVIKTGEQPLTGLFKREHEALMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0126384_1121349723300010046Tropical Forest SoilEYEELMVLVSNTVLNLAHPNHMREALASRRIALGRK*
Ga0126382_1017772023300010047Tropical Forest SoilGKYRREYDELMVLVSNTVLNLAHPNHMREALASRRIGLGGK*
Ga0134088_1061297913300010304Grasslands SoilREHDELMVLVSNTVLNLAHPNHMREALLSRRIGLAGK*
Ga0126372_1240308213300010360Tropical Forest SoilREHQELLVLLSNTVLNLAHPNHMREALLSRRMGISGR*
Ga0126377_1186316613300010362Tropical Forest SoilPLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0126377_1359439723300010362Tropical Forest SoilTGLFSREHQELMVLLSNTVLNLAHPNHMREALLSRRLGMSGR*
Ga0126379_1004033913300010366Tropical Forest SoilTADQPLTGTFRRDHEELMVLVSNTVLNLAHPNHMREALLSRRIGLGGK*
Ga0134127_1193371623300010399Terrestrial SoilGDQPLTGLFRRQHEELLVLLSNTILNLAHPNHMREALLSRRIGISGK*
Ga0134127_1288922613300010399Terrestrial SoilEQPLTGLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0134121_1159600813300010401Terrestrial SoilKREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0105246_1089252513300011119Miscanthus RhizospherePLTGLFRREHEELMVLLSNTILNLAHPNHMREALLSRRIGIAGK*
Ga0137393_1108765913300011271Vadose Zone SoilNPLTGTFLREYGELMVLVSNTVLNLAHPNHMREALLSRRRGLGRK*
Ga0136610_123912213300012184Polar Desert SandHEELLVILSNTVLNLAHPNHMREALLSRRIGMGGK*
Ga0137399_1037714613300012203Vadose Zone SoilLTGALRREHEELMVVLSNTILNLAHPNHLHEALALRRVGMSGR*
Ga0137381_1043835113300012207Vadose Zone SoilREYDDLMVLISNTVLNLARPNHMREALLSRRIGLGGK*
Ga0137376_1098978013300012208Vadose Zone SoilKTDDHPLTGTFRRDHEQLMVLVSNTVLNLAHPNHMREALMSRRMGLGGK*
Ga0137376_1142460023300012208Vadose Zone SoilCEQPLTGSCSREHEELIVLVSNTVLNLAHPNHMREALLSRRIGISGK*
Ga0137372_1005794913300012350Vadose Zone SoilITKTQDKPLTGMFVRDHEELMVLVSNTILNLAHPNHMREALLSRRTGVGRK*
Ga0137367_1023792613300012353Vadose Zone SoilHEELLVLLSNTVLNLAHPNHMREALLSRRMGKQN*
Ga0137396_1091611513300012918Vadose Zone SoilDHPLTGTFVREHEELMVLVSKTVLNLAHPNHMREALLSRRLGVAGR*
Ga0137394_1022317433300012922Vadose Zone SoilEHEELMVLLSNTVLNLAHPNHMREALLSRRVGLARK*
Ga0137359_1147209923300012923Vadose Zone SoilLREHGELMVLISNTVLNLAHPNHMREALMSRRLGIGGK*
Ga0137404_1175802813300012929Vadose Zone SoilDHPLTGTFRRDHEELMVMVSNTVLNLAHPNHMREALLSRRLGLGGK*
Ga0137404_1199745323300012929Vadose Zone SoilSPLTGTFNREHEELLVLLSNTVLNMAHPNHMREALLSRRVGLARK*
Ga0137407_1045546913300012930Vadose Zone SoilGEFLREYEELMVLVSNTVLNLAYPNHMREALLSRRIGLGGK*
Ga0137407_1237152023300012930Vadose Zone SoilHEELMVLVSNTVLNLAHPNHMREDMLSRRTGLGGK*
Ga0126375_1138411623300012948Tropical Forest SoilTGEFKREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0164303_1090287813300012957SoilRDQPLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMAGK*
Ga0134110_1018360223300012975Grasslands SoilDELMVLVSNTVLNLAHPNHMREALLSRRIGLAGK*
Ga0134087_1051524523300012977Grasslands SoilGRARLRTVLMVLVSNTVLNLARPNHMREALLSRRLGLGGK*
Ga0157373_1025205013300013100Corn RhizosphereGEQPLTGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGIAGK*
Ga0157371_1105875013300013102Corn RhizosphereREHEELMVLLSNTVLNLACPNHMREALLSRRVGMAGK*
Ga0157374_1062966413300013296Miscanthus RhizospherePLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRLGMSGHR*
Ga0157378_1084947213300013297Miscanthus RhizosphereGIFVREDEELFIVLSNTVLNLANPNHLGEALASRRLRRLKKA*
Ga0157372_1265877613300013307Corn RhizosphereHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0163163_1183025823300014325Switchgrass RhizosphereKRDHEELWVLLSNTVLNLADPNHMREALLSRRIGIAGK*
Ga0173480_1089406313300015200SoilFSREHSEFMVLVSNTVLNLAHPNHMREALLSRRMGLGGK*
Ga0132258_1031030313300015371Arabidopsis RhizosphereQPLTGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRVGMAGK*
Ga0163161_1127847123300017792Switchgrass RhizosphereKREHEELLVLLSNTVLNLAHPNHMREALMSRRIGISGK
Ga0190265_1256431013300018422SoilHEELMVLLSNTVLNLAHPNHMREALLSRRVGLARK
Ga0066655_1113410023300018431Grasslands SoilGEFLREHEELMVLISNTVLNLAHPNHMREALLSRRIGLGGK
Ga0066662_1045704013300018468Grasslands SoilREHEELLVILSNTVLDLAHPNHVREALSSRRTGLGKR
Ga0190267_1114584123300019767SoilFSREHEELLVLVSNTVLNLACPNHLSEALRSRKLSSGSK
Ga0213882_1028441123300021362Exposed RockVVCKTGDNPLTGHFSREHQESLVVLSNTILNRAHPNHLQEALRTRRAALTRR
Ga0209341_1058017023300025325SoilWREHQELMVLISNTVLNLAHPNHMREALLSRRVGLAGK
Ga0207653_1000637413300025885Corn, Switchgrass And Miscanthus RhizosphereRREHEELMVLLSNTVLNLACPNHMREALLSRRVGIAGK
Ga0207662_1119711423300025918Switchgrass RhizosphereTGAFLREYEELMVLVSNTVLNLAHPNHMREALASRRIALGRK
Ga0207687_1154908423300025927Miscanthus RhizosphereLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGIAGK
Ga0207709_1186696613300025935Miscanthus RhizosphereTGSFKREHEELMVLLSNTVLNLAHPNHMREALLSRRVGLARK
Ga0207670_1155030823300025936Switchgrass RhizosphereTGDQPLTGLFRRQHEELLVLLSNTILNLAHPNHMREALLSRRIGISGK
Ga0207691_1128002823300025940Miscanthus RhizosphereLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK
Ga0207689_1031183633300025942Miscanthus RhizosphereFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSSRG
Ga0207679_1087770913300025945Corn RhizosphereDQPLQGLFKREHEELLVLLSNTVLNLAHPNHMREALMSRRIGISGK
Ga0207679_1185389123300025945Corn RhizospherePLTGLFKREHEELLVLLSNTILNLAHPNHMREALLSRRVGIAGK
Ga0207712_1045530123300025961Switchgrass RhizosphereGVVIKTGEQPLTGLFRREHQELLVLLSNTVLNLAHPNHMREALLSRRVGLARK
Ga0207640_1046382413300025981Corn RhizosphereDRPLTGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGVSGK
Ga0207708_1005855013300026075Corn, Switchgrass And Miscanthus RhizosphereHEELLVLLSNTILNLAHPNHMREALLSRRIGISGK
Ga0207676_1074220523300026095Switchgrass RhizosphereTGEQPLTGLFRREHEELMVLLSNTVLNLAHPNHIREALLSRRIGMSGK
Ga0207676_1097163523300026095Switchgrass RhizosphereEQPLTGLFRREHQELLVLLSNTVLNLAHPNHMREALLSRRLGVSGR
Ga0207676_1192060523300026095Switchgrass RhizosphereRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSSRG
Ga0207674_1071373323300026116Corn RhizosphereGEQPLTGLFKREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK
Ga0207675_10012072543300026118Switchgrass RhizosphereLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGIAGK
Ga0207698_1178051523300026142Corn RhizosphereGDQPLTGLFKREHEELLVLLSNTVLNLAHPNHMREALMSRRIGMGNR
Ga0209059_130308823300026527SoilTGTFRRDHEELMVLVSNTVLNLAHPNHMREALMSRRLGLGGK
Ga0209799_104056823300027654Tropical Forest SoilTGMFLRDHEELMVLVSNTVLNLAHPHHMREALLSRRIGLGKK
Ga0209178_143784823300027725Agricultural SoilGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRLGMSGK
Ga0209283_1024987623300027875Vadose Zone SoilFLREYEELMVLVSNTVLNLAHPNHMREALLSRRIGLGGK
Ga0209526_1039274023300028047Forest SoilGTFAREHEELMVLLSNTVLNLAHPNHMREALLSRRVGLAGK
Ga0268264_1150727413300028381Switchgrass RhizosphereEELLVLLSNTVLNLAHPNHMREALLSRRIGMSSRG
Ga0268264_1253692713300028381Switchgrass RhizosphereLTGLFKREHEELMVLLSNTVLNLAHPNHMREALLSRKIGMT
Ga0307405_1034040723300031731RhizospherePLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK
Ga0307468_10135886723300031740Hardwood Forest SoilPLTGKFKRDHEELLVLVSNTVLNLAHPNHMREALLSRRIGLGK
Ga0307413_1178018513300031824RhizosphereGLFNREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGHR
Ga0307411_1225641523300032005RhizosphereGEQPLTGLFNREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGHR
Ga0308173_1072140523300032074SoilVVKTGEQPLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRLGMSGK
Ga0310811_1093265813300033475SoilHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK
Ga0334939_0122031_670_8013300034175BiocrustLTGAFHREHEELMVVMSNTVLNLAHPNHVREALSSRRLGLAKK
Ga0334923_029695_1043_11533300034376Hypolithic BiocrustEHEESLIVLSNTVLNLEHPNHLREALMSRRLGMSGK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.