| Basic Information | |
|---|---|
| Family ID | F040928 |
| Family Type | Metagenome |
| Number of Sequences | 161 |
| Average Sequence Length | 42 residues |
| Representative Sequence | GLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.62 % |
| % of genes near scaffold ends (potentially truncated) | 98.76 % |
| % of genes from short scaffolds (< 2000 bps) | 91.93 % |
| Associated GOLD sequencing projects | 129 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.758 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.938 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.342 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (62.733 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.72% β-sheet: 0.00% Coil/Unstructured: 49.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF02563 | Poly_export | 60.25 |
| PF10531 | SLBB | 19.88 |
| PF02706 | Wzz | 3.11 |
| PF13807 | GNVR | 1.86 |
| PF14559 | TPR_19 | 1.24 |
| PF01061 | ABC2_membrane | 1.24 |
| PF12833 | HTH_18 | 0.62 |
| PF01370 | Epimerase | 0.62 |
| PF13424 | TPR_12 | 0.62 |
| PF04325 | DUF465 | 0.62 |
| PF14306 | PUA_2 | 0.62 |
| PF13181 | TPR_8 | 0.62 |
| PF13414 | TPR_11 | 0.62 |
| PF16363 | GDP_Man_Dehyd | 0.62 |
| PF13579 | Glyco_trans_4_4 | 0.62 |
| PF13578 | Methyltransf_24 | 0.62 |
| PF13432 | TPR_16 | 0.62 |
| PF00196 | GerE | 0.62 |
| PF14332 | DUF4388 | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG1596 | Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold | Cell wall/membrane/envelope biogenesis [M] | 60.25 |
| COG3206 | Exopolysaccharide export protein/domain GumC/Wzc1 | Cell wall/membrane/envelope biogenesis [M] | 3.11 |
| COG3524 | Capsule polysaccharide export protein KpsE/RkpR | Cell wall/membrane/envelope biogenesis [M] | 3.11 |
| COG3765 | LPS O-antigen chain length determinant protein, WzzB/FepE family | Cell wall/membrane/envelope biogenesis [M] | 3.11 |
| COG3944 | Capsular polysaccharide biosynthesis protein YveK | Cell wall/membrane/envelope biogenesis [M] | 3.11 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.76 % |
| Unclassified | root | N/A | 1.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320005|FACEOR_FY84VJD01B8PES | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300000559|F14TC_103350814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300000574|JGI1357J11328_10147682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300000789|JGI1027J11758_11333869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300001431|F14TB_101863455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300003993|Ga0055468_10198026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300004156|Ga0062589_101565566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300004480|Ga0062592_100845442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300004480|Ga0062592_101549963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300004643|Ga0062591_102101606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300005171|Ga0066677_10556866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300005177|Ga0066690_10005645 | All Organisms → cellular organisms → Bacteria | 5856 | Open in IMG/M |
| 3300005180|Ga0066685_10260977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1196 | Open in IMG/M |
| 3300005180|Ga0066685_10660616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300005289|Ga0065704_10288634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 908 | Open in IMG/M |
| 3300005293|Ga0065715_10164505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium | 1599 | Open in IMG/M |
| 3300005293|Ga0065715_10516329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300005294|Ga0065705_10106560 | All Organisms → cellular organisms → Bacteria | 6485 | Open in IMG/M |
| 3300005295|Ga0065707_10952964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300005329|Ga0070683_102036942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300005330|Ga0070690_100649755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
| 3300005334|Ga0068869_100603146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300005334|Ga0068869_102131696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300005337|Ga0070682_101247585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300005343|Ga0070687_100228831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1143 | Open in IMG/M |
| 3300005364|Ga0070673_100704953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
| 3300005439|Ga0070711_100490692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1011 | Open in IMG/M |
| 3300005441|Ga0070700_100625590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300005445|Ga0070708_100639107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
| 3300005445|Ga0070708_101605234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300005445|Ga0070708_101634377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300005454|Ga0066687_10523688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300005459|Ga0068867_100311108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1302 | Open in IMG/M |
| 3300005459|Ga0068867_100818238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300005539|Ga0068853_101221933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300005543|Ga0070672_101565526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300005545|Ga0070695_100489931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
| 3300005546|Ga0070696_100086891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2221 | Open in IMG/M |
| 3300005546|Ga0070696_101668337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300005549|Ga0070704_100451012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1107 | Open in IMG/M |
| 3300005553|Ga0066695_10307842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300005566|Ga0066693_10453701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300005575|Ga0066702_10421950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300005578|Ga0068854_101565299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300005615|Ga0070702_100220832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1267 | Open in IMG/M |
| 3300005616|Ga0068852_101751820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300005617|Ga0068859_100493266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1320 | Open in IMG/M |
| 3300005617|Ga0068859_102863075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300005618|Ga0068864_101690439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300005618|Ga0068864_101844211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300005764|Ga0066903_106224416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300005840|Ga0068870_10187602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1245 | Open in IMG/M |
| 3300005841|Ga0068863_101764399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300005842|Ga0068858_100506992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1166 | Open in IMG/M |
| 3300005843|Ga0068860_100867934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300006755|Ga0079222_10185805 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300006806|Ga0079220_11729426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300006845|Ga0075421_101501715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300006852|Ga0075433_10139440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2155 | Open in IMG/M |
| 3300006854|Ga0075425_100425163 | Not Available | 1530 | Open in IMG/M |
| 3300006903|Ga0075426_10966579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300006904|Ga0075424_101095878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300007004|Ga0079218_11269989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300007076|Ga0075435_100013953 | All Organisms → cellular organisms → Bacteria | 5992 | Open in IMG/M |
| 3300007076|Ga0075435_101459521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300009011|Ga0105251_10450113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 597 | Open in IMG/M |
| 3300009090|Ga0099827_11999145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300009093|Ga0105240_11810315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300009094|Ga0111539_12944845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300009098|Ga0105245_11642484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300009101|Ga0105247_10161080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1486 | Open in IMG/M |
| 3300009147|Ga0114129_12449564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300009156|Ga0111538_11136366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 987 | Open in IMG/M |
| 3300009156|Ga0111538_13994593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300009162|Ga0075423_12561327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300009177|Ga0105248_10496366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1376 | Open in IMG/M |
| 3300009545|Ga0105237_10004118 | All Organisms → cellular organisms → Bacteria | 16956 | Open in IMG/M |
| 3300009789|Ga0126307_11444889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 557 | Open in IMG/M |
| 3300010037|Ga0126304_11278453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300010038|Ga0126315_10460800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300010040|Ga0126308_10572516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 768 | Open in IMG/M |
| 3300010045|Ga0126311_11516309 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010046|Ga0126384_10243711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1449 | Open in IMG/M |
| 3300010046|Ga0126384_11213497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300010047|Ga0126382_10177720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1490 | Open in IMG/M |
| 3300010304|Ga0134088_10612979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300010360|Ga0126372_12403082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300010362|Ga0126377_11863166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300010362|Ga0126377_13594397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300010366|Ga0126379_10040339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3751 | Open in IMG/M |
| 3300010399|Ga0134127_11933716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 667 | Open in IMG/M |
| 3300010399|Ga0134127_12889226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 559 | Open in IMG/M |
| 3300010401|Ga0134121_11596008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300011119|Ga0105246_10892525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300011271|Ga0137393_11087659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300012184|Ga0136610_1239122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300012203|Ga0137399_10377146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1181 | Open in IMG/M |
| 3300012207|Ga0137381_10438351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1140 | Open in IMG/M |
| 3300012208|Ga0137376_10989780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300012208|Ga0137376_11424600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300012350|Ga0137372_10057949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3386 | Open in IMG/M |
| 3300012353|Ga0137367_10237926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1311 | Open in IMG/M |
| 3300012918|Ga0137396_10916115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300012922|Ga0137394_10223174 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
| 3300012923|Ga0137359_11472099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300012929|Ga0137404_11758028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300012929|Ga0137404_11997453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300012930|Ga0137407_10455469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1191 | Open in IMG/M |
| 3300012930|Ga0137407_12371520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300012948|Ga0126375_11384116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300012957|Ga0164303_10902878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 619 | Open in IMG/M |
| 3300012975|Ga0134110_10183602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
| 3300012977|Ga0134087_10515245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300013100|Ga0157373_10252050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1249 | Open in IMG/M |
| 3300013102|Ga0157371_11058750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300013296|Ga0157374_10629664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1084 | Open in IMG/M |
| 3300013297|Ga0157378_10849472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
| 3300013307|Ga0157372_12658776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300014325|Ga0163163_11830258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300015200|Ga0173480_10894063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300015371|Ga0132258_10310303 | All Organisms → cellular organisms → Bacteria | 3884 | Open in IMG/M |
| 3300017792|Ga0163161_11278471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300018422|Ga0190265_12564310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300018431|Ga0066655_11134100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300018468|Ga0066662_10457040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1146 | Open in IMG/M |
| 3300019767|Ga0190267_11145841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 564 | Open in IMG/M |
| 3300025325|Ga0209341_10580170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300025885|Ga0207653_10006374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3682 | Open in IMG/M |
| 3300025918|Ga0207662_11197114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300025927|Ga0207687_11549084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300025935|Ga0207709_11866966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300025936|Ga0207670_11550308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 563 | Open in IMG/M |
| 3300025940|Ga0207691_11280028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300025942|Ga0207689_10311836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1305 | Open in IMG/M |
| 3300025945|Ga0207679_10877709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300025945|Ga0207679_11853891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300025961|Ga0207712_10455301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1086 | Open in IMG/M |
| 3300025981|Ga0207640_10463824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1047 | Open in IMG/M |
| 3300026075|Ga0207708_10058550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2939 | Open in IMG/M |
| 3300026095|Ga0207676_10742205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 954 | Open in IMG/M |
| 3300026095|Ga0207676_10971635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 836 | Open in IMG/M |
| 3300026095|Ga0207676_11920605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300026116|Ga0207674_10713733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 968 | Open in IMG/M |
| 3300026118|Ga0207675_100120725 | All Organisms → cellular organisms → Bacteria | 2479 | Open in IMG/M |
| 3300026142|Ga0207698_11780515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 631 | Open in IMG/M |
| 3300026527|Ga0209059_1303088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300027654|Ga0209799_1040568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
| 3300027725|Ga0209178_1437848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300027875|Ga0209283_10249876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
| 3300028047|Ga0209526_10392740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300028381|Ga0268264_11507274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300028381|Ga0268264_12536927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300031731|Ga0307405_10340407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1153 | Open in IMG/M |
| 3300031740|Ga0307468_101358867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300031824|Ga0307413_11780185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300032005|Ga0307411_12256415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 511 | Open in IMG/M |
| 3300032074|Ga0308173_10721405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 912 | Open in IMG/M |
| 3300033475|Ga0310811_10932658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300034175|Ga0334939_0122031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_53_8 | 830 | Open in IMG/M |
| 3300034376|Ga0334923_029695 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Akkermansiaceae → Akkermansia | 1153 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 8.07% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.11% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.48% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.48% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.86% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.24% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.24% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.62% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.62% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.62% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.62% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.62% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320005 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012184 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ134 (22.06) | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034175 | Biocrust microbial communities from Mojave Desert, California, United States - 35SMC | Environmental | Open in IMG/M |
| 3300034376 | Biocrust microbial communities from Mojave Desert, California, United States - 19HNC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORA_1260880 | 2032320005 | Soil | YDDLMVLVSNTVLNLARPNHMREALLSRRIGLGGK |
| F14TC_1033508142 | 3300000559 | Soil | EHEELLVLLSNTVLNLANPNHMREALLSRRIGIAGK* |
| JGI1357J11328_101476822 | 3300000574 | Groundwater | YEELMVLVSNTVLNLAHPNHMREALLSRRMGLGGK* |
| JGI1027J11758_113338692 | 3300000789 | Soil | GPLTGAFAREHEELMILLSNTVLNLAHPNHIREAMLSRRMAMGH* |
| F14TB_1018634552 | 3300001431 | Soil | EHEELLVLLSNTVLNLAHPNHMREALLSRRVGMSGK* |
| Ga0055468_101980262 | 3300003993 | Natural And Restored Wetlands | RGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK* |
| Ga0062589_1015655662 | 3300004156 | Soil | FRRQHEELLVLLSNTILNLAHPNHMREALLSRRIGISGK* |
| Ga0062592_1008454422 | 3300004480 | Soil | VVKTGEQPLTGLFRREHQELLVLLSNTVLNLAHPNHMREALLSRRLGVSGR* |
| Ga0062592_1015499631 | 3300004480 | Soil | LTGVFVRDNEELMVVLSNTVLNVANQNHLNEALSSRRLKKTKGS* |
| Ga0062591_1021016062 | 3300004643 | Soil | LTGSFKREHEELMVLLSNTVLNLAHPNHMREALLSRRVGLARK* |
| Ga0066677_105568661 | 3300005171 | Soil | GTFLREYGELMVLVSNTVLNLAHPNHMREALLSRRSGLGRK* |
| Ga0066690_100056451 | 3300005177 | Soil | GAFRREHDELMVLVSNTVLNLAHPNHMREALLSRRIGLAGK* |
| Ga0066685_102609771 | 3300005180 | Soil | NPLTGMFLRDHEELMVLVSNTVLNLAHPNHMREALLSRRIGLGKK* |
| Ga0066685_106606161 | 3300005180 | Soil | QDKPLTGMFQREHEELLVLVSNTVLNLAHPNHMREALLSRRVGLSGK* |
| Ga0065704_102886342 | 3300005289 | Switchgrass Rhizosphere | GEQPLTGIFKREHEELLVILSNTVLNLAHPNHMREALLSRRIGIAGK* |
| Ga0065715_101645051 | 3300005293 | Miscanthus Rhizosphere | EQPLTGIFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGIAGK* |
| Ga0065715_105163292 | 3300005293 | Miscanthus Rhizosphere | VVKTGEQPLTGLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK* |
| Ga0065705_101065601 | 3300005294 | Switchgrass Rhizosphere | LFKREHEELLVLLSNTVLNLAHPNHMREALMSRRIGMTGR* |
| Ga0065707_109529642 | 3300005295 | Switchgrass Rhizosphere | LTGSFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMAGK* |
| Ga0070683_1020369422 | 3300005329 | Corn Rhizosphere | QPLTGLFRREHEELMVLLSNTILNLAHPNHMREALLSRRIGMSGK* |
| Ga0070690_1006497551 | 3300005330 | Switchgrass Rhizosphere | LTGLFRREHEELMVLLSNTVLNLACPNHMREALLSRRVGMAGK* |
| Ga0068869_1006031462 | 3300005334 | Miscanthus Rhizosphere | FRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSSRG* |
| Ga0068869_1021316961 | 3300005334 | Miscanthus Rhizosphere | GEQPLTGLFKREHEELMVLLSNTVLNLAHPNHMREALLSRKTGMVGK* |
| Ga0070682_1012475852 | 3300005337 | Corn Rhizosphere | LFRREHEELMVLLSNTVLNLAHPNHMREALLSRRVGMSGHR* |
| Ga0070687_1002288311 | 3300005343 | Switchgrass Rhizosphere | EFSREHSELMVLVSNTVLNLAHPNHMREALLSRRMGLGGK* |
| Ga0070673_1007049532 | 3300005364 | Switchgrass Rhizosphere | KTGEQPLTGLFKREHEELMVLLSNTVLNLAHPNHMREALLSRRTGMSGK* |
| Ga0070711_1004906921 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | DNPLTGAFRRDHEELMVLVSNTVLNLAHPNHMREALASRRIGLGGK* |
| Ga0070700_1006255902 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | FNREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK* |
| Ga0070708_1006391071 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GDQPLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMAGK* |
| Ga0070708_1016052342 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GLFRREHQELLVLLSNTVLNLAHPNHMREALLSRRLGISGR* |
| Ga0070708_1016343771 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | DQPLTGQFRREHEELMVLLSNTVLNLAHPNHMREALLSRKVGLSSR* |
| Ga0066687_105236882 | 3300005454 | Soil | GMFRRDHEELMVLVSNTVLNLAHPNHMREALASRRIGLGGK* |
| Ga0068867_1003111081 | 3300005459 | Miscanthus Rhizosphere | GLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRLGMSGK* |
| Ga0068867_1008182382 | 3300005459 | Miscanthus Rhizosphere | LTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGIAGK* |
| Ga0068853_1012219332 | 3300005539 | Corn Rhizosphere | EQPLTGLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRVGMSGHR* |
| Ga0070672_1015655262 | 3300005543 | Miscanthus Rhizosphere | HEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK* |
| Ga0070695_1004899312 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRLGMSGK* |
| Ga0070696_1000868911 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LFKREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK* |
| Ga0070696_1016683372 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | TKTGEQPLTGLFNREHEELLVLLSNTILNLAHPNHMREALLSRRVGISGK* |
| Ga0070704_1004510122 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | DNPLTGTFKREHEELLVLLSNTVLNLAHPNHMREALLSRRVGLARK* |
| Ga0066695_103078422 | 3300005553 | Soil | QDGPLTGEFLREHEELMVLVSNTVLSLAHPNHMREALLSRRIGLGGK* |
| Ga0066693_104537011 | 3300005566 | Soil | TGTFRRDHEELMVMVSNTVLNLAHPNHMREALLSRRLGLGGK* |
| Ga0066702_104219502 | 3300005575 | Soil | TGAFRREHDDLMVLVSNTVLNLARPNHMREALLSRRIGLGGK* |
| Ga0068854_1015652992 | 3300005578 | Corn Rhizosphere | KTGEQPLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK* |
| Ga0070702_1002208322 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | LFRREHEELMVLLSNTILNLAHPNHMREALLSRRIGMSGK* |
| Ga0068852_1017518201 | 3300005616 | Corn Rhizosphere | GLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK* |
| Ga0068859_1004932662 | 3300005617 | Switchgrass Rhizosphere | GDNPLTGAFRRDHEELLVLVSNTVLNLAHPNHMREALASRRIGLGGK* |
| Ga0068859_1028630751 | 3300005617 | Switchgrass Rhizosphere | FNREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGHR* |
| Ga0068864_1016904392 | 3300005618 | Switchgrass Rhizosphere | GLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGHR* |
| Ga0068864_1018442112 | 3300005618 | Switchgrass Rhizosphere | EHEELLVLLSNTVLNLAHPNHMREALTSRRIGISGK* |
| Ga0066903_1062244162 | 3300005764 | Tropical Forest Soil | TFRRDHEELMVLVSNTVLNLAHPNHMREALLSRRIGLGGK* |
| Ga0068870_101876023 | 3300005840 | Miscanthus Rhizosphere | GLFNREHEELMVLLSNTVLNLAHPNHMREALLSRRIAMSGK* |
| Ga0068863_1017643991 | 3300005841 | Switchgrass Rhizosphere | REHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSSRG* |
| Ga0068858_1005069921 | 3300005842 | Switchgrass Rhizosphere | EHEELMVLLSNTVLNLACPNHMREALLSRRVGMAGK* |
| Ga0068860_1008679342 | 3300005843 | Switchgrass Rhizosphere | EELMVLLSNTVLNLAHPNHMREALLSRRLGMSGK* |
| Ga0079222_101858051 | 3300006755 | Agricultural Soil | GLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRLGMSGK* |
| Ga0079220_117294261 | 3300006806 | Agricultural Soil | TGEQPLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK* |
| Ga0075421_1015017152 | 3300006845 | Populus Rhizosphere | EQPLTGLFRREHQELLVLLSNTVLNLAHPNHMREALLSRRLGISGR* |
| Ga0075433_101394401 | 3300006852 | Populus Rhizosphere | HEELLVLLSNTVLNLAHPNHMREALLSRRVGMAGK* |
| Ga0075425_1004251633 | 3300006854 | Populus Rhizosphere | RENEELMVLLANTVLNVAHPIHLREALLARRTGLARR* |
| Ga0075426_109665792 | 3300006903 | Populus Rhizosphere | QDQPLTGAYVREYDDLMVLVSNTVLNLARPNHMREALLSRRIGLGGK* |
| Ga0075424_1010958782 | 3300006904 | Populus Rhizosphere | QPLRGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRVGMAGK* |
| Ga0079218_112699891 | 3300007004 | Agricultural Soil | DSPLTGTFKRDHEELMVLLSNTVLNLAHPNHMREALLSRRVGLARK* |
| Ga0075435_1000139531 | 3300007076 | Populus Rhizosphere | ENEELMIVLSNTVLNLAHPNHIREAMMSRRTALGH* |
| Ga0075435_1014595212 | 3300007076 | Populus Rhizosphere | FKREHEELLVLLSNTVLNLAHPNHMREALLSRRVGMAGK* |
| Ga0105251_104501132 | 3300009011 | Switchgrass Rhizosphere | GLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMGHR* |
| Ga0099827_119991452 | 3300009090 | Vadose Zone Soil | GPLTGEFLREYEELMVLVSNTVLNLAHPNHMREALLSRRIGLGGK* |
| Ga0105240_118103151 | 3300009093 | Corn Rhizosphere | LTGLFRREHEELMVLLSNTVLNLAHPNHIREALLSRRIGMSGK* |
| Ga0111539_129448451 | 3300009094 | Populus Rhizosphere | KREHEELLVILSNTVLNLAHPNHMREALLSRRIGIAGK* |
| Ga0105245_116424841 | 3300009098 | Miscanthus Rhizosphere | TFKREHEELLVLLSNTVLNLAHPNHMREALLSRRVGLARK* |
| Ga0105247_101610803 | 3300009101 | Switchgrass Rhizosphere | LTGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMGHR* |
| Ga0114129_124495642 | 3300009147 | Populus Rhizosphere | FRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMAGK* |
| Ga0111538_111363661 | 3300009156 | Populus Rhizosphere | REHEELMVLLSNTVLNLAHPNHMREALLSRKTGMVGK* |
| Ga0111538_139945932 | 3300009156 | Populus Rhizosphere | EHEELLVLLSNTVLNLAHPNHMREALLSRRIGIAGK* |
| Ga0075423_125613272 | 3300009162 | Populus Rhizosphere | EHEELLVLLRNTVLNLAHPNHMREALLSRRVGMAGK* |
| Ga0105248_104963661 | 3300009177 | Switchgrass Rhizosphere | FKREHEELMVLLSNTVLNLAHPNNMREALLSRKTGMGK* |
| Ga0105237_1000411816 | 3300009545 | Corn Rhizosphere | LFRREHEELMVLLSNTVLNLACPNHMREALLSRRVGMAGK* |
| Ga0126307_114448892 | 3300009789 | Serpentine Soil | EGIVVKTGEQPLTGLFKREHEELLVLLSNTILNLAHPNHMREALLSRRIGMSGK* |
| Ga0126304_112784532 | 3300010037 | Serpentine Soil | TGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK* |
| Ga0126315_104608002 | 3300010038 | Serpentine Soil | EELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK* |
| Ga0126308_105725161 | 3300010040 | Serpentine Soil | EQPLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGISGK* |
| Ga0126311_115163091 | 3300010045 | Serpentine Soil | EYEELMVIMSNTVLNLAHPNHTREALASRHLGLAKR* |
| Ga0126384_102437111 | 3300010046 | Tropical Forest Soil | IVIKTGEQPLTGLFKREHEALMVLLSNTVLNLAHPNHMREALLSRRIGMSGK* |
| Ga0126384_112134972 | 3300010046 | Tropical Forest Soil | EYEELMVLVSNTVLNLAHPNHMREALASRRIALGRK* |
| Ga0126382_101777202 | 3300010047 | Tropical Forest Soil | GKYRREYDELMVLVSNTVLNLAHPNHMREALASRRIGLGGK* |
| Ga0134088_106129791 | 3300010304 | Grasslands Soil | REHDELMVLVSNTVLNLAHPNHMREALLSRRIGLAGK* |
| Ga0126372_124030821 | 3300010360 | Tropical Forest Soil | REHQELLVLLSNTVLNLAHPNHMREALLSRRMGISGR* |
| Ga0126377_118631661 | 3300010362 | Tropical Forest Soil | PLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK* |
| Ga0126377_135943972 | 3300010362 | Tropical Forest Soil | TGLFSREHQELMVLLSNTVLNLAHPNHMREALLSRRLGMSGR* |
| Ga0126379_100403391 | 3300010366 | Tropical Forest Soil | TADQPLTGTFRRDHEELMVLVSNTVLNLAHPNHMREALLSRRIGLGGK* |
| Ga0134127_119337162 | 3300010399 | Terrestrial Soil | GDQPLTGLFRRQHEELLVLLSNTILNLAHPNHMREALLSRRIGISGK* |
| Ga0134127_128892261 | 3300010399 | Terrestrial Soil | EQPLTGLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK* |
| Ga0134121_115960081 | 3300010401 | Terrestrial Soil | KREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK* |
| Ga0105246_108925251 | 3300011119 | Miscanthus Rhizosphere | PLTGLFRREHEELMVLLSNTILNLAHPNHMREALLSRRIGIAGK* |
| Ga0137393_110876591 | 3300011271 | Vadose Zone Soil | NPLTGTFLREYGELMVLVSNTVLNLAHPNHMREALLSRRRGLGRK* |
| Ga0136610_12391221 | 3300012184 | Polar Desert Sand | HEELLVILSNTVLNLAHPNHMREALLSRRIGMGGK* |
| Ga0137399_103771461 | 3300012203 | Vadose Zone Soil | LTGALRREHEELMVVLSNTILNLAHPNHLHEALALRRVGMSGR* |
| Ga0137381_104383511 | 3300012207 | Vadose Zone Soil | REYDDLMVLISNTVLNLARPNHMREALLSRRIGLGGK* |
| Ga0137376_109897801 | 3300012208 | Vadose Zone Soil | KTDDHPLTGTFRRDHEQLMVLVSNTVLNLAHPNHMREALMSRRMGLGGK* |
| Ga0137376_114246002 | 3300012208 | Vadose Zone Soil | CEQPLTGSCSREHEELIVLVSNTVLNLAHPNHMREALLSRRIGISGK* |
| Ga0137372_100579491 | 3300012350 | Vadose Zone Soil | ITKTQDKPLTGMFVRDHEELMVLVSNTILNLAHPNHMREALLSRRTGVGRK* |
| Ga0137367_102379261 | 3300012353 | Vadose Zone Soil | HEELLVLLSNTVLNLAHPNHMREALLSRRMGKQN* |
| Ga0137396_109161151 | 3300012918 | Vadose Zone Soil | DHPLTGTFVREHEELMVLVSKTVLNLAHPNHMREALLSRRLGVAGR* |
| Ga0137394_102231743 | 3300012922 | Vadose Zone Soil | EHEELMVLLSNTVLNLAHPNHMREALLSRRVGLARK* |
| Ga0137359_114720992 | 3300012923 | Vadose Zone Soil | LREHGELMVLISNTVLNLAHPNHMREALMSRRLGIGGK* |
| Ga0137404_117580281 | 3300012929 | Vadose Zone Soil | DHPLTGTFRRDHEELMVMVSNTVLNLAHPNHMREALLSRRLGLGGK* |
| Ga0137404_119974532 | 3300012929 | Vadose Zone Soil | SPLTGTFNREHEELLVLLSNTVLNMAHPNHMREALLSRRVGLARK* |
| Ga0137407_104554691 | 3300012930 | Vadose Zone Soil | GEFLREYEELMVLVSNTVLNLAYPNHMREALLSRRIGLGGK* |
| Ga0137407_123715202 | 3300012930 | Vadose Zone Soil | HEELMVLVSNTVLNLAHPNHMREDMLSRRTGLGGK* |
| Ga0126375_113841162 | 3300012948 | Tropical Forest Soil | TGEFKREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK* |
| Ga0164303_109028781 | 3300012957 | Soil | RDQPLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMAGK* |
| Ga0134110_101836022 | 3300012975 | Grasslands Soil | DELMVLVSNTVLNLAHPNHMREALLSRRIGLAGK* |
| Ga0134087_105152452 | 3300012977 | Grasslands Soil | GRARLRTVLMVLVSNTVLNLARPNHMREALLSRRLGLGGK* |
| Ga0157373_102520501 | 3300013100 | Corn Rhizosphere | GEQPLTGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGIAGK* |
| Ga0157371_110587501 | 3300013102 | Corn Rhizosphere | REHEELMVLLSNTVLNLACPNHMREALLSRRVGMAGK* |
| Ga0157374_106296641 | 3300013296 | Miscanthus Rhizosphere | PLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRLGMSGHR* |
| Ga0157378_108494721 | 3300013297 | Miscanthus Rhizosphere | GIFVREDEELFIVLSNTVLNLANPNHLGEALASRRLRRLKKA* |
| Ga0157372_126587761 | 3300013307 | Corn Rhizosphere | HEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK* |
| Ga0163163_118302582 | 3300014325 | Switchgrass Rhizosphere | KRDHEELWVLLSNTVLNLADPNHMREALLSRRIGIAGK* |
| Ga0173480_108940631 | 3300015200 | Soil | FSREHSEFMVLVSNTVLNLAHPNHMREALLSRRMGLGGK* |
| Ga0132258_103103031 | 3300015371 | Arabidopsis Rhizosphere | QPLTGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRVGMAGK* |
| Ga0163161_112784712 | 3300017792 | Switchgrass Rhizosphere | KREHEELLVLLSNTVLNLAHPNHMREALMSRRIGISGK |
| Ga0190265_125643101 | 3300018422 | Soil | HEELMVLLSNTVLNLAHPNHMREALLSRRVGLARK |
| Ga0066655_111341002 | 3300018431 | Grasslands Soil | GEFLREHEELMVLISNTVLNLAHPNHMREALLSRRIGLGGK |
| Ga0066662_104570401 | 3300018468 | Grasslands Soil | REHEELLVILSNTVLDLAHPNHVREALSSRRTGLGKR |
| Ga0190267_111458412 | 3300019767 | Soil | FSREHEELLVLVSNTVLNLACPNHLSEALRSRKLSSGSK |
| Ga0213882_102844112 | 3300021362 | Exposed Rock | VVCKTGDNPLTGHFSREHQESLVVLSNTILNRAHPNHLQEALRTRRAALTRR |
| Ga0209341_105801702 | 3300025325 | Soil | WREHQELMVLISNTVLNLAHPNHMREALLSRRVGLAGK |
| Ga0207653_100063741 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | RREHEELMVLLSNTVLNLACPNHMREALLSRRVGIAGK |
| Ga0207662_111971142 | 3300025918 | Switchgrass Rhizosphere | TGAFLREYEELMVLVSNTVLNLAHPNHMREALASRRIALGRK |
| Ga0207687_115490842 | 3300025927 | Miscanthus Rhizosphere | LTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGIAGK |
| Ga0207709_118669661 | 3300025935 | Miscanthus Rhizosphere | TGSFKREHEELMVLLSNTVLNLAHPNHMREALLSRRVGLARK |
| Ga0207670_115503082 | 3300025936 | Switchgrass Rhizosphere | TGDQPLTGLFRRQHEELLVLLSNTILNLAHPNHMREALLSRRIGISGK |
| Ga0207691_112800282 | 3300025940 | Miscanthus Rhizosphere | LFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK |
| Ga0207689_103118363 | 3300025942 | Miscanthus Rhizosphere | FRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSSRG |
| Ga0207679_108777091 | 3300025945 | Corn Rhizosphere | DQPLQGLFKREHEELLVLLSNTVLNLAHPNHMREALMSRRIGISGK |
| Ga0207679_118538912 | 3300025945 | Corn Rhizosphere | PLTGLFKREHEELLVLLSNTILNLAHPNHMREALLSRRVGIAGK |
| Ga0207712_104553012 | 3300025961 | Switchgrass Rhizosphere | GVVIKTGEQPLTGLFRREHQELLVLLSNTVLNLAHPNHMREALLSRRVGLARK |
| Ga0207640_104638241 | 3300025981 | Corn Rhizosphere | DRPLTGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGVSGK |
| Ga0207708_100585501 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | HEELLVLLSNTILNLAHPNHMREALLSRRIGISGK |
| Ga0207676_107422052 | 3300026095 | Switchgrass Rhizosphere | TGEQPLTGLFRREHEELMVLLSNTVLNLAHPNHIREALLSRRIGMSGK |
| Ga0207676_109716352 | 3300026095 | Switchgrass Rhizosphere | EQPLTGLFRREHQELLVLLSNTVLNLAHPNHMREALLSRRLGVSGR |
| Ga0207676_119206052 | 3300026095 | Switchgrass Rhizosphere | RREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSSRG |
| Ga0207674_107137332 | 3300026116 | Corn Rhizosphere | GEQPLTGLFKREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK |
| Ga0207675_1001207254 | 3300026118 | Switchgrass Rhizosphere | LFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGIAGK |
| Ga0207698_117805152 | 3300026142 | Corn Rhizosphere | GDQPLTGLFKREHEELLVLLSNTVLNLAHPNHMREALMSRRIGMGNR |
| Ga0209059_13030882 | 3300026527 | Soil | TGTFRRDHEELMVLVSNTVLNLAHPNHMREALMSRRLGLGGK |
| Ga0209799_10405682 | 3300027654 | Tropical Forest Soil | TGMFLRDHEELMVLVSNTVLNLAHPHHMREALLSRRIGLGKK |
| Ga0209178_14378482 | 3300027725 | Agricultural Soil | GLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRLGMSGK |
| Ga0209283_102498762 | 3300027875 | Vadose Zone Soil | FLREYEELMVLVSNTVLNLAHPNHMREALLSRRIGLGGK |
| Ga0209526_103927402 | 3300028047 | Forest Soil | GTFAREHEELMVLLSNTVLNLAHPNHMREALLSRRVGLAGK |
| Ga0268264_115072741 | 3300028381 | Switchgrass Rhizosphere | EELLVLLSNTVLNLAHPNHMREALLSRRIGMSSRG |
| Ga0268264_125369271 | 3300028381 | Switchgrass Rhizosphere | LTGLFKREHEELMVLLSNTVLNLAHPNHMREALLSRKIGMT |
| Ga0307405_103404072 | 3300031731 | Rhizosphere | PLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK |
| Ga0307468_1013588672 | 3300031740 | Hardwood Forest Soil | PLTGKFKRDHEELLVLVSNTVLNLAHPNHMREALLSRRIGLGK |
| Ga0307413_117801851 | 3300031824 | Rhizosphere | GLFNREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGHR |
| Ga0307411_122564152 | 3300032005 | Rhizosphere | GEQPLTGLFNREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGHR |
| Ga0308173_107214052 | 3300032074 | Soil | VVKTGEQPLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRLGMSGK |
| Ga0310811_109326581 | 3300033475 | Soil | HEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK |
| Ga0334939_0122031_670_801 | 3300034175 | Biocrust | LTGAFHREHEELMVVMSNTVLNLAHPNHVREALSSRRLGLAKK |
| Ga0334923_029695_1043_1153 | 3300034376 | Hypolithic Biocrust | EHEESLIVLSNTVLNLEHPNHLREALMSRRLGMSGK |
| ⦗Top⦘ |