| Basic Information | |
|---|---|
| Family ID | F040899 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 161 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFE |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 86.96 % |
| % of genes near scaffold ends (potentially truncated) | 99.38 % |
| % of genes from short scaffolds (< 2000 bps) | 97.52 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.764 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.770 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.466 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.826 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 40.43% β-sheet: 0.00% Coil/Unstructured: 59.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF09912 | DUF2141 | 11.80 |
| PF06776 | IalB | 3.11 |
| PF00589 | Phage_integrase | 2.48 |
| PF04392 | ABC_sub_bind | 1.86 |
| PF01068 | DNA_ligase_A_M | 1.86 |
| PF08281 | Sigma70_r4_2 | 1.24 |
| PF00082 | Peptidase_S8 | 1.24 |
| PF03401 | TctC | 0.62 |
| PF01548 | DEDD_Tnp_IS110 | 0.62 |
| PF13505 | OMP_b-brl | 0.62 |
| PF00501 | AMP-binding | 0.62 |
| PF03091 | CutA1 | 0.62 |
| PF01734 | Patatin | 0.62 |
| PF00355 | Rieske | 0.62 |
| PF04542 | Sigma70_r2 | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG5342 | Invasion protein IalB, involved in pathogenesis | General function prediction only [R] | 3.11 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.86 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.86 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.86 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.62 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.62 |
| COG1324 | Divalent cation tolerance protein CutA | Inorganic ion transport and metabolism [P] | 0.62 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.62 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.62 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.62 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.62 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.62 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.62 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.76 % |
| All Organisms | root | All Organisms | 42.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY02H3V5W | Not Available | 538 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1073942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 600 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10103986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1056002 | Not Available | 558 | Open in IMG/M |
| 3300000858|JGI10213J12805_10004709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1180 | Open in IMG/M |
| 3300000955|JGI1027J12803_104281004 | Not Available | 529 | Open in IMG/M |
| 3300000956|JGI10216J12902_102264991 | Not Available | 905 | Open in IMG/M |
| 3300001661|JGI12053J15887_10545916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
| 3300004463|Ga0063356_104670056 | Not Available | 589 | Open in IMG/M |
| 3300004479|Ga0062595_102340711 | Not Available | 528 | Open in IMG/M |
| 3300004633|Ga0066395_10382581 | Not Available | 789 | Open in IMG/M |
| 3300004633|Ga0066395_10694445 | Not Available | 603 | Open in IMG/M |
| 3300005165|Ga0066869_10115810 | Not Available | 551 | Open in IMG/M |
| 3300005172|Ga0066683_10300217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 998 | Open in IMG/M |
| 3300005330|Ga0070690_101205164 | Not Available | 604 | Open in IMG/M |
| 3300005332|Ga0066388_106177504 | Not Available | 605 | Open in IMG/M |
| 3300005332|Ga0066388_107576331 | Not Available | 544 | Open in IMG/M |
| 3300005332|Ga0066388_108697023 | Not Available | 504 | Open in IMG/M |
| 3300005340|Ga0070689_100275343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1394 | Open in IMG/M |
| 3300005363|Ga0008090_15566003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1368 | Open in IMG/M |
| 3300005363|Ga0008090_15819407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300005436|Ga0070713_101036596 | Not Available | 792 | Open in IMG/M |
| 3300005471|Ga0070698_100339596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli | 1433 | Open in IMG/M |
| 3300005536|Ga0070697_101020611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 735 | Open in IMG/M |
| 3300005548|Ga0070665_100285819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1651 | Open in IMG/M |
| 3300005555|Ga0066692_11010609 | Not Available | 509 | Open in IMG/M |
| 3300005616|Ga0068852_100245368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1714 | Open in IMG/M |
| 3300005713|Ga0066905_101160992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
| 3300005713|Ga0066905_101372971 | Not Available | 638 | Open in IMG/M |
| 3300005713|Ga0066905_101463914 | Not Available | 620 | Open in IMG/M |
| 3300005713|Ga0066905_101603443 | Not Available | 595 | Open in IMG/M |
| 3300005713|Ga0066905_101816070 | Not Available | 562 | Open in IMG/M |
| 3300005713|Ga0066905_102117500 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005713|Ga0066905_102152077 | Not Available | 519 | Open in IMG/M |
| 3300005764|Ga0066903_102038059 | Not Available | 1103 | Open in IMG/M |
| 3300005764|Ga0066903_105949175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 639 | Open in IMG/M |
| 3300005764|Ga0066903_106139172 | Not Available | 628 | Open in IMG/M |
| 3300005840|Ga0068870_10064861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1973 | Open in IMG/M |
| 3300005842|Ga0068858_101626677 | Not Available | 637 | Open in IMG/M |
| 3300006038|Ga0075365_11317121 | Not Available | 507 | Open in IMG/M |
| 3300006163|Ga0070715_10098309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1360 | Open in IMG/M |
| 3300006178|Ga0075367_10558960 | Not Available | 727 | Open in IMG/M |
| 3300006237|Ga0097621_101052312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis | 763 | Open in IMG/M |
| 3300006606|Ga0074062_12636655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum lipoferum | 540 | Open in IMG/M |
| 3300006846|Ga0075430_101501132 | Not Available | 554 | Open in IMG/M |
| 3300006852|Ga0075433_10858587 | Not Available | 792 | Open in IMG/M |
| 3300006904|Ga0075424_101790240 | Not Available | 650 | Open in IMG/M |
| 3300009156|Ga0111538_11127556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 992 | Open in IMG/M |
| 3300009792|Ga0126374_10827866 | Not Available | 710 | Open in IMG/M |
| 3300010041|Ga0126312_11437507 | Not Available | 511 | Open in IMG/M |
| 3300010043|Ga0126380_10839809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 756 | Open in IMG/M |
| 3300010046|Ga0126384_12471673 | Not Available | 504 | Open in IMG/M |
| 3300010047|Ga0126382_10841655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 787 | Open in IMG/M |
| 3300010359|Ga0126376_10553703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1077 | Open in IMG/M |
| 3300010361|Ga0126378_10785072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1062 | Open in IMG/M |
| 3300010361|Ga0126378_10994456 | Not Available | 943 | Open in IMG/M |
| 3300010361|Ga0126378_13176602 | Not Available | 523 | Open in IMG/M |
| 3300010366|Ga0126379_11364978 | Not Available | 815 | Open in IMG/M |
| 3300010366|Ga0126379_11617258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 753 | Open in IMG/M |
| 3300010373|Ga0134128_10355530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1637 | Open in IMG/M |
| 3300010375|Ga0105239_10609484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1246 | Open in IMG/M |
| 3300010376|Ga0126381_101329979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1039 | Open in IMG/M |
| 3300010398|Ga0126383_10412695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1390 | Open in IMG/M |
| 3300010398|Ga0126383_12209675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300010398|Ga0126383_12697214 | Not Available | 580 | Open in IMG/M |
| 3300010399|Ga0134127_10672337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1072 | Open in IMG/M |
| 3300012202|Ga0137363_10441482 | Not Available | 1088 | Open in IMG/M |
| 3300012205|Ga0137362_10689097 | Not Available | 878 | Open in IMG/M |
| 3300012355|Ga0137369_10918775 | Not Available | 587 | Open in IMG/M |
| 3300012359|Ga0137385_11565999 | Not Available | 523 | Open in IMG/M |
| 3300012360|Ga0137375_11184270 | Not Available | 586 | Open in IMG/M |
| 3300012361|Ga0137360_10451389 | Not Available | 1089 | Open in IMG/M |
| 3300012930|Ga0137407_12254674 | Not Available | 520 | Open in IMG/M |
| 3300012948|Ga0126375_11260465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 619 | Open in IMG/M |
| 3300012951|Ga0164300_10400360 | Not Available | 754 | Open in IMG/M |
| 3300012971|Ga0126369_11218549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 842 | Open in IMG/M |
| 3300012998|Ga0157362_1216539 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300014325|Ga0163163_13078456 | Not Available | 520 | Open in IMG/M |
| 3300014968|Ga0157379_11376475 | Not Available | 683 | Open in IMG/M |
| 3300014969|Ga0157376_12461785 | Not Available | 560 | Open in IMG/M |
| 3300014969|Ga0157376_13099941 | Not Available | 503 | Open in IMG/M |
| 3300015373|Ga0132257_100391323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1688 | Open in IMG/M |
| 3300015373|Ga0132257_100684151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1274 | Open in IMG/M |
| 3300015373|Ga0132257_101209646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 957 | Open in IMG/M |
| 3300016294|Ga0182041_10618247 | Not Available | 953 | Open in IMG/M |
| 3300016341|Ga0182035_10543155 | Not Available | 998 | Open in IMG/M |
| 3300016341|Ga0182035_11269828 | Not Available | 659 | Open in IMG/M |
| 3300016341|Ga0182035_11631992 | Not Available | 582 | Open in IMG/M |
| 3300016371|Ga0182034_10815480 | Not Available | 799 | Open in IMG/M |
| 3300016371|Ga0182034_10870175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 774 | Open in IMG/M |
| 3300016404|Ga0182037_10779320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 823 | Open in IMG/M |
| 3300016445|Ga0182038_11851760 | Not Available | 545 | Open in IMG/M |
| 3300018027|Ga0184605_10104974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1250 | Open in IMG/M |
| 3300018468|Ga0066662_12434033 | Not Available | 551 | Open in IMG/M |
| 3300018469|Ga0190270_10462277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1197 | Open in IMG/M |
| 3300018481|Ga0190271_11910706 | Not Available | 704 | Open in IMG/M |
| 3300020005|Ga0193697_1123268 | Not Available | 601 | Open in IMG/M |
| 3300021479|Ga0210410_11178817 | Not Available | 657 | Open in IMG/M |
| 3300022756|Ga0222622_10842053 | Not Available | 671 | Open in IMG/M |
| 3300025899|Ga0207642_11001607 | Not Available | 538 | Open in IMG/M |
| 3300025903|Ga0207680_10435412 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 930 | Open in IMG/M |
| 3300025910|Ga0207684_10432639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1130 | Open in IMG/M |
| 3300025916|Ga0207663_10228594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1358 | Open in IMG/M |
| 3300025929|Ga0207664_10330948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1345 | Open in IMG/M |
| 3300025931|Ga0207644_11851421 | Not Available | 505 | Open in IMG/M |
| 3300025941|Ga0207711_11372607 | Not Available | 649 | Open in IMG/M |
| 3300026095|Ga0207676_10932243 | Not Available | 853 | Open in IMG/M |
| 3300026116|Ga0207674_10440627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1259 | Open in IMG/M |
| 3300026319|Ga0209647_1071419 | Not Available | 1757 | Open in IMG/M |
| 3300026327|Ga0209266_1068455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum | 1661 | Open in IMG/M |
| 3300026327|Ga0209266_1239048 | Not Available | 595 | Open in IMG/M |
| 3300027866|Ga0209813_10117655 | Not Available | 922 | Open in IMG/M |
| 3300027874|Ga0209465_10595770 | Not Available | 548 | Open in IMG/M |
| 3300028381|Ga0268264_11916868 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300028714|Ga0307309_10220780 | Not Available | 506 | Open in IMG/M |
| 3300028814|Ga0307302_10628015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGB12 | 534 | Open in IMG/M |
| 3300028828|Ga0307312_10601665 | Not Available | 727 | Open in IMG/M |
| 3300028876|Ga0307286_10409658 | Not Available | 509 | Open in IMG/M |
| 3300028880|Ga0307300_10306996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 538 | Open in IMG/M |
| 3300030902|Ga0308202_1067010 | Not Available | 689 | Open in IMG/M |
| 3300030903|Ga0308206_1050099 | Not Available | 826 | Open in IMG/M |
| 3300031091|Ga0308201_10061061 | Not Available | 980 | Open in IMG/M |
| 3300031092|Ga0308204_10164922 | Not Available | 668 | Open in IMG/M |
| 3300031226|Ga0307497_10223249 | Not Available | 828 | Open in IMG/M |
| 3300031546|Ga0318538_10355313 | Not Available | 791 | Open in IMG/M |
| 3300031561|Ga0318528_10072518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1774 | Open in IMG/M |
| 3300031564|Ga0318573_10254362 | Not Available | 936 | Open in IMG/M |
| 3300031573|Ga0310915_10106594 | All Organisms → cellular organisms → Bacteria | 1899 | Open in IMG/M |
| 3300031573|Ga0310915_10628040 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300031682|Ga0318560_10264820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 924 | Open in IMG/M |
| 3300031719|Ga0306917_10105509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2029 | Open in IMG/M |
| 3300031736|Ga0318501_10511162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300031744|Ga0306918_10337365 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300031771|Ga0318546_10219920 | Not Available | 1301 | Open in IMG/M |
| 3300031777|Ga0318543_10394190 | Not Available | 620 | Open in IMG/M |
| 3300031796|Ga0318576_10176287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1002 | Open in IMG/M |
| 3300031819|Ga0318568_10978177 | Not Available | 523 | Open in IMG/M |
| 3300031833|Ga0310917_10091458 | All Organisms → cellular organisms → Bacteria | 1944 | Open in IMG/M |
| 3300031854|Ga0310904_11000804 | Not Available | 595 | Open in IMG/M |
| 3300031879|Ga0306919_11012079 | Not Available | 635 | Open in IMG/M |
| 3300031890|Ga0306925_11584504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300031910|Ga0306923_10753502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1079 | Open in IMG/M |
| 3300031954|Ga0306926_12046895 | Not Available | 642 | Open in IMG/M |
| 3300032000|Ga0310903_10589281 | Not Available | 591 | Open in IMG/M |
| 3300032009|Ga0318563_10635849 | Not Available | 575 | Open in IMG/M |
| 3300032013|Ga0310906_10376275 | Not Available | 931 | Open in IMG/M |
| 3300032035|Ga0310911_10048015 | All Organisms → cellular organisms → Bacteria | 2211 | Open in IMG/M |
| 3300032035|Ga0310911_10886987 | Not Available | 514 | Open in IMG/M |
| 3300032051|Ga0318532_10072393 | Not Available | 1200 | Open in IMG/M |
| 3300032060|Ga0318505_10288868 | Not Available | 773 | Open in IMG/M |
| 3300032060|Ga0318505_10467325 | Not Available | 596 | Open in IMG/M |
| 3300032065|Ga0318513_10238872 | Not Available | 879 | Open in IMG/M |
| 3300032066|Ga0318514_10151816 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300032066|Ga0318514_10506947 | Not Available | 642 | Open in IMG/M |
| 3300032090|Ga0318518_10017106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3132 | Open in IMG/M |
| 3300032094|Ga0318540_10114864 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300032205|Ga0307472_102003962 | Not Available | 580 | Open in IMG/M |
| 3300032261|Ga0306920_100143914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3549 | Open in IMG/M |
| 3300033289|Ga0310914_10597338 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300033289|Ga0310914_11147961 | Not Available | 678 | Open in IMG/M |
| 3300033290|Ga0318519_10241994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1041 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.73% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.86% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.24% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.24% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.24% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.24% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.62% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.62% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.62% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.62% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.62% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Fungus Garden | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012998 | Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta laevigata ALBM3 | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_08693380 | 2170459010 | Grass Soil | MFAGVRAIATALAMVSVSFAAVAQGVPPGAQIVPPSDQPGRERERFE |
| AF_2010_repII_A100DRAFT_10739421 | 3300000655 | Forest Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPGRER |
| AF_2010_repII_A001DRAFT_101039861 | 3300000793 | Forest Soil | MLAGVRPIAAALAMVSVSFAAVAQTVPPGAQLVPPSDQPGRERERFGR |
| AP72_2010_repI_A100DRAFT_10560022 | 3300000837 | Forest Soil | MLAGVRAIAAALAMVSVSFAAVAQVVPPGAQIVPP |
| JGI10213J12805_100047093 | 3300000858 | Soil | MLAGVRAIAAALALVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFERPPV |
| JGI1027J12803_1042810041 | 3300000955 | Soil | MLAGVRAIAPALAMASVSFAAVAQVVPPGAQIVPPSDQPGRERERF |
| JGI10216J12902_1022649912 | 3300000956 | Soil | MFAGVRAIATALAMVSVSFAAVAQGVPPGAQIVPPSDQPGRERERFERPAVPLAQPGGP |
| JGI12053J15887_105459162 | 3300001661 | Forest Soil | MLAGVRAIAAALAIVSVSFVAAFAQIVPPSDLPGRERFRFETPSPPLAQPGGPII |
| Ga0063356_1046700561 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MFAGARAIATALAMVSVSFAAVAQGIPPGAQIVPPSDQPGRERERFERPPVP |
| Ga0062595_1023407111 | 3300004479 | Soil | MLAGVRAIAPALAMASVSFAAVAQVVPPGAQIVPPSDQPGRERERFERPP |
| Ga0066395_103825811 | 3300004633 | Tropical Forest Soil | MLAGVRVIAAALAMVSISFAAVAQAIPPGAQIVPPSDQPGRERERFERPAV |
| Ga0066395_106944451 | 3300004633 | Tropical Forest Soil | MPAGVRTIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFERPPVPLAQ |
| Ga0066869_101158103 | 3300005165 | Soil | MFAGVRAIATAVAMVSVSFAAVAQGVPPGAQIVPPSDQPG |
| Ga0066683_103002172 | 3300005172 | Soil | MVACVRPIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFERP |
| Ga0070690_1012051641 | 3300005330 | Switchgrass Rhizosphere | MFAGARAIATALAMVSVSFAAVAQGVPPGAQIVPPSDQPGRERE |
| Ga0066388_1061775042 | 3300005332 | Tropical Forest Soil | MLASARAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFERPP |
| Ga0066388_1075763311 | 3300005332 | Tropical Forest Soil | MPAGVRTIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGR |
| Ga0066388_1086970231 | 3300005332 | Tropical Forest Soil | MFAGVRAVALAMAMASISFAAVAQIVPPSDQPGRERQRFEVPAVP |
| Ga0070689_1002753431 | 3300005340 | Switchgrass Rhizosphere | MFAGVRAIATALAMVSVSCAAVAQGVPPGAQIVPPSDQPGRERERFERPAVPLAQ |
| Ga0008090_155660033 | 3300005363 | Tropical Rainforest Soil | MLAGARAIAAAMAMVCVSFAAVAQVVPSGAQLVPPSDQPGRERERFE |
| Ga0008090_158194071 | 3300005363 | Tropical Rainforest Soil | MLAGVRPIAAALAMVSVSFAAVAQTVPPGAQLVPPSDQPG |
| Ga0070713_1010365964 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MFAGARAIATALAMVSVSFAAVAQGVPPGAQIVPPSDQPGRERERFE |
| Ga0070698_1003395964 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAGVRAIAPALAMASVSFAAVAQVVPPGAQIVPPSDQPGRERERFERPPVPLAQPGGP |
| Ga0070697_1010206111 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAGVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFERPPVP |
| Ga0070665_1002858195 | 3300005548 | Switchgrass Rhizosphere | MFAGVRAIATALAMGSVSFAAVAQGVPPGAQIVPPSDQPGRERERFE |
| Ga0066692_110106091 | 3300005555 | Soil | MVACVRAVAAALAMVSGSFAAVAQVVPPGAQIVPPSDQPGRERERFERP |
| Ga0068852_1002453681 | 3300005616 | Corn Rhizosphere | MFAGVRAIATALAMVSVSCAAVAQGVPPGAQIVPPSDQPG |
| Ga0066905_1011609921 | 3300005713 | Tropical Forest Soil | MLAGVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRER |
| Ga0066905_1013729711 | 3300005713 | Tropical Forest Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFERPPV |
| Ga0066905_1014639141 | 3300005713 | Tropical Forest Soil | MLAGVRVIAAAFAMVSISFAAVAQAIPPGAQIVPPSDQPGRERERFERPAVP |
| Ga0066905_1016034431 | 3300005713 | Tropical Forest Soil | MLACVRAVAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPGRERERFE |
| Ga0066905_1018160701 | 3300005713 | Tropical Forest Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPGRERERFERPP |
| Ga0066905_1021175001 | 3300005713 | Tropical Forest Soil | MLSCVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRE |
| Ga0066905_1021520772 | 3300005713 | Tropical Forest Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERF |
| Ga0066903_1020380591 | 3300005764 | Tropical Forest Soil | MFAGVRAIAAAMAMVSVSCAAVAQIVPPSDLPGRERYRFEQPLRPLAQPGGPIITQPGVEAPPGA |
| Ga0066903_1059491752 | 3300005764 | Tropical Forest Soil | MLAGARAIAAAMAMVSVSFAAVAQVVPSGAQLVPPSDQPGRERERFEPPAVPLAQ |
| Ga0066903_1061391721 | 3300005764 | Tropical Forest Soil | MPAGVRTIAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPGRERERF |
| Ga0068870_100648615 | 3300005840 | Miscanthus Rhizosphere | MFAGVRAIATALAMVSVSFAAVAQGVPPGAQIVPPSDQPGRERERFERPAVPLAQPGGPA |
| Ga0068858_1016266771 | 3300005842 | Switchgrass Rhizosphere | MFAGVRAIATALAMVSVSCAAVAQGVPPGAQIVPPSDQPGRERERF |
| Ga0075365_113171211 | 3300006038 | Populus Endosphere | MFAGVRAIATALAMVSVSFAAVAQGVPPGAQIVPPSDQPGRERER |
| Ga0070715_100983091 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MVACVRSVAAALAMVSVSFAAVAQVVPPGAQVVPPSDQPGRERERFERPPV |
| Ga0075367_105589601 | 3300006178 | Populus Endosphere | MFASVRAIATALAMVSVSCAAVAQGVPPGAQIVPPSDQPGRERERF |
| Ga0097621_1010523123 | 3300006237 | Miscanthus Rhizosphere | MFAGVRAIATALAMVSVSCAAVAQGVPPGAQIVPPSDQPGRERERFERPAVPLA |
| Ga0074062_126366551 | 3300006606 | Soil | MFAGVRAIATALAMVSVSFAAVAQGVPPGAQIVPPSDQPGRERERFERPAVPLAQPGG |
| Ga0075430_1015011321 | 3300006846 | Populus Rhizosphere | MLAGVRVIAAALAMVSVSFAAVAQAIPPGAQIVPPSDQPGRER |
| Ga0075433_108585871 | 3300006852 | Populus Rhizosphere | MFAGARAIATALAMVSVSFAAVAQGVPPGAQIVPPSDQPGRERERFERPPVPL |
| Ga0075424_1017902402 | 3300006904 | Populus Rhizosphere | MVACVRPIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFER |
| Ga0111538_111275563 | 3300009156 | Populus Rhizosphere | MLAGVRVIAAALAMVSVSFAAVAQAIPPGAQIVPPSD |
| Ga0126374_108278662 | 3300009792 | Tropical Forest Soil | MLACVRAIAAASAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFERP |
| Ga0126312_114375071 | 3300010041 | Serpentine Soil | MLAGTRAIAAALAMVCVSFAAVAQTVPSGAQLVPPSDQPGRE |
| Ga0126380_108398091 | 3300010043 | Tropical Forest Soil | MLAGVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPG |
| Ga0126384_124716731 | 3300010046 | Tropical Forest Soil | MPAGVRAIAAALAMVSLSFAAVAQVVPPGAQIVPPSGQP |
| Ga0126382_108416552 | 3300010047 | Tropical Forest Soil | MLAGVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFERP |
| Ga0126376_105537033 | 3300010359 | Tropical Forest Soil | MLAGVRVIAAALAMVSVSFAAVAQAIPPGAQIVPPSDQPGRERERFE |
| Ga0126378_107850721 | 3300010361 | Tropical Forest Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGVQIVPPSDQPGRERERFERPP |
| Ga0126378_109944561 | 3300010361 | Tropical Forest Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPS |
| Ga0126378_131766022 | 3300010361 | Tropical Forest Soil | MLVGVRAVAAALGMVSVSFAAVAQVVPPGAQIVPPSEQPGRER |
| Ga0126379_113649781 | 3300010366 | Tropical Forest Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPGRERER |
| Ga0126379_116172582 | 3300010366 | Tropical Forest Soil | MPAGVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPGRERERFE |
| Ga0134128_103555305 | 3300010373 | Terrestrial Soil | MFAGVRAIATALAMGSVSFAAVAQGVPPGAQIVPPSDQPGRERERFERPAVPLAQPGG |
| Ga0105239_106094841 | 3300010375 | Corn Rhizosphere | MFAGVRAIATALAMVSVSCAAVAQGVPPGAQIVPPSDQPGRERERFERPAV |
| Ga0126381_1013299791 | 3300010376 | Tropical Forest Soil | MLSCVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFERPPVPL |
| Ga0126383_104126953 | 3300010398 | Tropical Forest Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPGRERERFERP |
| Ga0126383_122096751 | 3300010398 | Tropical Forest Soil | MLSCVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSD |
| Ga0126383_126972141 | 3300010398 | Tropical Forest Soil | MLAGVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERE |
| Ga0134127_106723371 | 3300010399 | Terrestrial Soil | MVACVRSVAAALAMVSVSFAAVAQGVPPGAQIVPPSDQP |
| Ga0137363_104414823 | 3300012202 | Vadose Zone Soil | MPAGVRAIAAALAMVSVSFAAAAQVVPPGAQIVPPSAQPGRERERFERPPVPLAQ |
| Ga0137362_106890972 | 3300012205 | Vadose Zone Soil | MVACVRAVAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFERPPVPLA |
| Ga0137369_109187751 | 3300012355 | Vadose Zone Soil | MLAGARAIAAALAMVCVSFAAVAQTVPSGAQLVPPSDQPGRERERFARPPV |
| Ga0137385_115659991 | 3300012359 | Vadose Zone Soil | MLAGVRAIAAALAMVSVSFAAVAQVIPPGAQIVPPSDQPGRERERFERPA |
| Ga0137375_111842701 | 3300012360 | Vadose Zone Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFE |
| Ga0137360_104513894 | 3300012361 | Vadose Zone Soil | MVACVHAVAAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERF |
| Ga0137407_122546741 | 3300012930 | Vadose Zone Soil | MVACVRAVAAALAMVSGSFAAVAQVVPPGAQIVPPSDQPGRE |
| Ga0126375_112604651 | 3300012948 | Tropical Forest Soil | MLAGVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFERPPV |
| Ga0164300_104003603 | 3300012951 | Soil | MVACVRPIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRER |
| Ga0126369_112185492 | 3300012971 | Tropical Forest Soil | MLACVRAIAAASAMVSISFAAVAQVVPPGAQIVPPSDQ |
| Ga0157362_12165391 | 3300012998 | Fungus Garden | MFAGVRAVAMAMALASFSFAAAAQIVPPSDQPGRERQRFEVPVVPLAQP |
| Ga0163163_130784561 | 3300014325 | Switchgrass Rhizosphere | MFAGVRAIATALAMVSVSCADVAQGVPPGAQIVPPSDQPGRERERFERPAVPLA |
| Ga0157379_113764751 | 3300014968 | Switchgrass Rhizosphere | MFAGVRAIATALAMVSVSCAAVAQGVPPGAQIVPPSDQPGRERERFER |
| Ga0157376_124617851 | 3300014969 | Miscanthus Rhizosphere | MFAGVRAIATALAMVSVSCAAVAQGVPPGAQIVPPSDQPGRERERF* |
| Ga0157376_130999411 | 3300014969 | Miscanthus Rhizosphere | MFAGVRAIATALAMVSVSFAAVAQGVPPAAQIVPPSDQPGRERERFERPAVP |
| Ga0132257_1003913231 | 3300015373 | Arabidopsis Rhizosphere | MFAGVRAIATALAMVSVSCAAVAQGVPPAAQIVPPSDQPGRERERFERPAVPLAQPGGPAIAV |
| Ga0132257_1006841513 | 3300015373 | Arabidopsis Rhizosphere | MLAGAGAIGAAVAMVCVSFAAVAQVVPSGAQLVPPSDQPGRE |
| Ga0132257_1012096463 | 3300015373 | Arabidopsis Rhizosphere | MLAGARAIAAVAMVCVSFAAVAQGVPSGAQLVPPSDQPGRERERFEPPAV |
| Ga0182041_106182471 | 3300016294 | Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSAQP |
| Ga0182035_105431551 | 3300016341 | Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFERPPVPLAQP |
| Ga0182035_112698281 | 3300016341 | Soil | MLACVRAVAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPGRERERF |
| Ga0182035_116319921 | 3300016341 | Soil | MLVGVRTVAAALAMISVSFAAGAQVVPPGAQIVPPSDQPGRERERFERP |
| Ga0182034_108154802 | 3300016371 | Soil | MLVGIRTVAAALGMVSVSFAAVAQVVPPGAQIVPPSAQPGRERERF |
| Ga0182034_108701751 | 3300016371 | Soil | MLSCVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPGR |
| Ga0182037_107793201 | 3300016404 | Soil | MLSCVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSAQP |
| Ga0182038_118517601 | 3300016445 | Soil | MLVGIRTVAAALGMVSVSFAAVAQVVPPGAQIVPPSAQPGRERER |
| Ga0184605_101049741 | 3300018027 | Groundwater Sediment | MFAGVRAIAAALAMVSVSFAAVAQGVPPAAQIVPPSDQPGRERERFERPPVPLAQP |
| Ga0066662_124340331 | 3300018468 | Grasslands Soil | MPAGVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPG |
| Ga0190270_104622771 | 3300018469 | Soil | MFAGVRAIATALAMVSVSFAAVAQGVPPGAQIVPPSDQPGRERERFERPAVPL |
| Ga0190271_119107062 | 3300018481 | Soil | MFAGVRAIATALAMVSVSFAAVAQGVPPGAQIVPPSDQPGRERERF |
| Ga0193697_11232681 | 3300020005 | Soil | MFAGVRAIAAALAMVSVSFAAVAQGVPPGAQIVPPSDQPGRERERFERPPVPLAQP |
| Ga0210410_111788171 | 3300021479 | Soil | MVACVRAVAAALAMVSVPFAAVAQVVPPGAQIVPPSDQPGRERERFERPPVPLA |
| Ga0222622_108420533 | 3300022756 | Groundwater Sediment | MFAGVRAIATALAMVSVSFAAVAQGVPPGAQIVPPSDQPG |
| Ga0207642_110016071 | 3300025899 | Miscanthus Rhizosphere | MFAGVRAIATALAMVSVSCAAVAQGVPPGAQIVPPSDQPGRERERFERPAVPLAQPGGP |
| Ga0207680_104354121 | 3300025903 | Switchgrass Rhizosphere | MFAGVRAIATALAMVSVSCAAVAQGVPPGAQIVPPSDQPGREREQ |
| Ga0207684_104326391 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAGVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPS |
| Ga0207663_102285943 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MVACVRSVAAALAMVSVSFAAVAQVVPPGAQVVPP |
| Ga0207664_103309482 | 3300025929 | Agricultural Soil | MVACVRSVAAALAMVSVSFAAVAQVVPPGAQVVPPSDQPG |
| Ga0207644_118514211 | 3300025931 | Switchgrass Rhizosphere | MFAGVRAIATALAMVSVSFAAVAQGVPPGAQIVPPSDQPGRERERFER |
| Ga0207711_113726072 | 3300025941 | Switchgrass Rhizosphere | MFAGVRAIATALAMVSVSCAAVAQGVPPGAQIVPPSDQPGRERERFERPAVPL |
| Ga0207676_109322431 | 3300026095 | Switchgrass Rhizosphere | MFAGARAIATALAMVSVSFAAVAQGVPPGAQIVPPSDQPGRERERFERPPVPLAQ |
| Ga0207674_104406271 | 3300026116 | Corn Rhizosphere | MFAGVRAIATALAMVSVSFAAVAQGVPPGAQIVPPSDQPGRERERFERPAVPLAQPG |
| Ga0209647_10714195 | 3300026319 | Grasslands Soil | MVACVRAVAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPG |
| Ga0209266_10684553 | 3300026327 | Soil | MVACVRPIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFERPPV |
| Ga0209266_12390481 | 3300026327 | Soil | MPAGVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFERPPV |
| Ga0209813_101176551 | 3300027866 | Populus Endosphere | MFAGVRAIATALAMVSVSFAAVAQGVPPGAQIVPPSDQPGRERERFERPAVPLAQ |
| Ga0209465_105957701 | 3300027874 | Tropical Forest Soil | MPAGVRAIAAALAMVSVSFAAAAQVVPPGAQIVPPSA |
| Ga0268264_119168682 | 3300028381 | Switchgrass Rhizosphere | MFAGARAIATALAMVSVSFAAVAQGVPPGAQIVPPSDQPGR |
| Ga0307309_102207801 | 3300028714 | Soil | MVACVRAVAAALAMVSVSFAAVAQGVPPGAQIVPP |
| Ga0307302_106280152 | 3300028814 | Soil | MFAGVRAIAVAAAMVSASCAAVAQVVPPSDQPGRERERFETPAVPL |
| Ga0307312_106016653 | 3300028828 | Soil | MFAGVRAIATALAMVSVSFAAVAQGVPPAAQIVPPSDQPGRERERFERPAVPLAQPGGPT |
| Ga0307286_104096581 | 3300028876 | Soil | MVACVRAVAAALAMVSVPFAAVAQVVPPGAQIVPPSD |
| Ga0307300_103069961 | 3300028880 | Soil | MFAGVRAIATALAMVSVSFAAVAQGVPPGAQIVPP |
| Ga0308202_10670102 | 3300030902 | Soil | MFAGVRAIAMALAMVSVSFAAVAQGVPPGAQIVPPS |
| Ga0308206_10500993 | 3300030903 | Soil | MFAGVRAIAMALAMVSVSFAAVAQGVPPGAQIVPPSDQPGRERERFERPAVPLAQPGG |
| Ga0308201_100610611 | 3300031091 | Soil | MFAGVRAIATALAMVSVSFAAVAQGVPPGAQIVPPSDQPGRERE |
| Ga0308204_101649221 | 3300031092 | Soil | MFAGVRAIAAALAMVSVSFAAVAQGVPPGAQIVPPSDQPGRERERFERPAVPLAQPG |
| Ga0307497_102232491 | 3300031226 | Soil | MVACVRAVAAALAMVSVSFAAVAQGVPPGAQIVPPSDQPGRERERFER |
| Ga0318538_103553131 | 3300031546 | Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSA |
| Ga0318528_100725183 | 3300031561 | Soil | MPAGVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERE |
| Ga0318573_102543621 | 3300031564 | Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSAQ |
| Ga0310915_101065941 | 3300031573 | Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPP |
| Ga0310915_106280402 | 3300031573 | Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPG |
| Ga0318560_102648202 | 3300031682 | Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFERPAVPLAQPGGPA |
| Ga0306917_101055091 | 3300031719 | Soil | MPAGVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFERPPVPLA |
| Ga0318501_105111621 | 3300031736 | Soil | MLSCVRAIAAALAMVSVSFAAVAQVVPPGAQIVPARLG |
| Ga0306918_103373652 | 3300031744 | Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFERPP |
| Ga0318546_102199202 | 3300031771 | Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPGRE |
| Ga0318543_103941901 | 3300031777 | Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPGRERERFERPPVPLAQP |
| Ga0318576_101762871 | 3300031796 | Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQFVPPS |
| Ga0318568_109781771 | 3300031819 | Soil | MPAGVRAIAAALAMVSVPFTAVAQVVPPGAQIVPPSVQPGRE |
| Ga0310917_100914581 | 3300031833 | Soil | MLACVRASAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPGRERERFERPP |
| Ga0310904_110008042 | 3300031854 | Soil | MFAGVRAIATALAMVSVSCAAVAQGAPPGAQIVPPSDQPG |
| Ga0306919_110120791 | 3300031879 | Soil | MVACVRPIAAALAMVSVSYAAVAQVVPPGAQIVPPSDQPGRERERFERPPVPLA |
| Ga0306925_115845041 | 3300031890 | Soil | MLSCVRAIAAALAMVSVSFAAVAQVVPPGAQIVPP |
| Ga0306923_107535022 | 3300031910 | Soil | MPAGVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRE |
| Ga0306926_120468952 | 3300031954 | Soil | MLSCVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQ |
| Ga0310903_105892811 | 3300032000 | Soil | MFAGARAIATALAMVSVSFAAVAQGVPPGAQIVPPSDQPG |
| Ga0318563_106358491 | 3300032009 | Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPG |
| Ga0310906_103762751 | 3300032013 | Soil | MFAGVRAIATALAMVSVSFAAVAQGVPPAAQIVPPS |
| Ga0310911_100480155 | 3300032035 | Soil | MLACVRAVAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPGRERE |
| Ga0310911_108869871 | 3300032035 | Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPGRERERFERPPVPL |
| Ga0318532_100723932 | 3300032051 | Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRER |
| Ga0318505_102888681 | 3300032060 | Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPGRERERFERPLVPLAQPGGPA |
| Ga0318505_104673251 | 3300032060 | Soil | MPAGVRAIAAALAMVSVSFAAVAQVVPPGAQIVPP |
| Ga0318513_102388722 | 3300032065 | Soil | MPAGVRAIAAALAMVSVPFTAAAQVVPPGAQIVPPSVQ |
| Ga0318514_101518162 | 3300032066 | Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERFERPAVP |
| Ga0318514_105069473 | 3300032066 | Soil | MVACVRPIAAALAMVSVSFAAVAQVVPPGAQIVPPSDQPGRERERF |
| Ga0318518_100171065 | 3300032090 | Soil | MLACVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPGR |
| Ga0318540_101148642 | 3300032094 | Soil | MLACVRASAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPG |
| Ga0307472_1020039621 | 3300032205 | Hardwood Forest Soil | MVACVRPIAAALAMVSVSFAAVAQVVPPGAQNVPPS |
| Ga0306920_1001439146 | 3300032261 | Soil | MLSCVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPS |
| Ga0310914_105973381 | 3300033289 | Soil | MLVGIRTVAAALGMVSVSFAAVAQVVPPGAQIVPPSAQPGRERERFERPPVPL |
| Ga0310914_111479611 | 3300033289 | Soil | MPAGVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSD |
| Ga0318519_102419943 | 3300033290 | Soil | MLSCVRAIAAALAMVSVSFAAVAQVVPPGAQIVPPSAQPGRERERFERPAVP |
| ⦗Top⦘ |