| Basic Information | |
|---|---|
| Family ID | F040895 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 161 |
| Average Sequence Length | 44 residues |
| Representative Sequence | SIKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR |
| Number of Associated Samples | 141 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.89 % |
| % of genes from short scaffolds (< 2000 bps) | 93.17 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.565 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (36.646 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.677 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.099 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 27.54% Coil/Unstructured: 72.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF01266 | DAO | 50.93 |
| PF04185 | Phosphoesterase | 9.94 |
| PF04237 | YjbR | 3.11 |
| PF00296 | Bac_luciferase | 2.48 |
| PF13412 | HTH_24 | 1.86 |
| PF00202 | Aminotran_3 | 1.24 |
| PF12697 | Abhydrolase_6 | 1.24 |
| PF13404 | HTH_AsnC-type | 1.24 |
| PF01740 | STAS | 1.24 |
| PF01037 | AsnC_trans_reg | 1.24 |
| PF08282 | Hydrolase_3 | 0.62 |
| PF06026 | Rib_5-P_isom_A | 0.62 |
| PF01370 | Epimerase | 0.62 |
| PF10604 | Polyketide_cyc2 | 0.62 |
| PF11716 | MDMPI_N | 0.62 |
| PF13520 | AA_permease_2 | 0.62 |
| PF12900 | Pyridox_ox_2 | 0.62 |
| PF07884 | VKOR | 0.62 |
| PF00248 | Aldo_ket_red | 0.62 |
| PF16656 | Pur_ac_phosph_N | 0.62 |
| PF08029 | HisG_C | 0.62 |
| PF06718 | DUF1203 | 0.62 |
| PF13579 | Glyco_trans_4_4 | 0.62 |
| PF00472 | RF-1 | 0.62 |
| PF00196 | GerE | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 9.94 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 3.11 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.48 |
| COG0040 | ATP phosphoribosyltransferase | Amino acid transport and metabolism [E] | 0.62 |
| COG0120 | Ribose 5-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.62 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.62 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.62 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.62 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.62 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.62 |
| COG4243 | Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formation | General function prediction only [R] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.57 % |
| Unclassified | root | N/A | 30.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559006|FI_contig10453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 993 | Open in IMG/M |
| 2199352025|deepsgr__Contig_175874 | All Organisms → cellular organisms → Bacteria | 2438 | Open in IMG/M |
| 3300001991|JGI24743J22301_10151698 | Not Available | 519 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100615360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 963 | Open in IMG/M |
| 3300004635|Ga0062388_100322260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1302 | Open in IMG/M |
| 3300005187|Ga0066675_11189881 | Not Available | 566 | Open in IMG/M |
| 3300005435|Ga0070714_101614109 | Not Available | 633 | Open in IMG/M |
| 3300005537|Ga0070730_10252797 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300005541|Ga0070733_10274012 | Not Available | 1112 | Open in IMG/M |
| 3300005559|Ga0066700_10835998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 617 | Open in IMG/M |
| 3300005591|Ga0070761_10461268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 780 | Open in IMG/M |
| 3300005598|Ga0066706_10783127 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300005602|Ga0070762_10033998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 2744 | Open in IMG/M |
| 3300005610|Ga0070763_10727915 | Not Available | 583 | Open in IMG/M |
| 3300006028|Ga0070717_11414410 | Not Available | 632 | Open in IMG/M |
| 3300006052|Ga0075029_100376676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 919 | Open in IMG/M |
| 3300006162|Ga0075030_100517361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 948 | Open in IMG/M |
| 3300006163|Ga0070715_10259723 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300006804|Ga0079221_10129725 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300006806|Ga0079220_10484737 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300006914|Ga0075436_101456034 | Not Available | 520 | Open in IMG/M |
| 3300009143|Ga0099792_10852928 | Not Available | 600 | Open in IMG/M |
| 3300009524|Ga0116225_1543681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
| 3300009525|Ga0116220_10235903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 797 | Open in IMG/M |
| 3300010048|Ga0126373_10674005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1091 | Open in IMG/M |
| 3300010048|Ga0126373_12289559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 601 | Open in IMG/M |
| 3300010359|Ga0126376_10987747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 841 | Open in IMG/M |
| 3300010361|Ga0126378_12096993 | Not Available | 645 | Open in IMG/M |
| 3300010376|Ga0126381_104264439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300010401|Ga0134121_11269169 | Not Available | 740 | Open in IMG/M |
| 3300010880|Ga0126350_10973688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300012208|Ga0137376_11241757 | Not Available | 635 | Open in IMG/M |
| 3300012358|Ga0137368_10519577 | Not Available | 765 | Open in IMG/M |
| 3300012359|Ga0137385_10003719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 13276 | Open in IMG/M |
| 3300012361|Ga0137360_11279047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 634 | Open in IMG/M |
| 3300012495|Ga0157323_1005495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 850 | Open in IMG/M |
| 3300013100|Ga0157373_10618786 | Not Available | 789 | Open in IMG/M |
| 3300014164|Ga0181532_10486899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 677 | Open in IMG/M |
| 3300014838|Ga0182030_11428702 | Not Available | 575 | Open in IMG/M |
| 3300016270|Ga0182036_10266033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1290 | Open in IMG/M |
| 3300016319|Ga0182033_10332811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1264 | Open in IMG/M |
| 3300016319|Ga0182033_10890087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 788 | Open in IMG/M |
| 3300016357|Ga0182032_11487744 | Not Available | 588 | Open in IMG/M |
| 3300016371|Ga0182034_10531060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 985 | Open in IMG/M |
| 3300016387|Ga0182040_10175042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1555 | Open in IMG/M |
| 3300017821|Ga0187812_1110460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 895 | Open in IMG/M |
| 3300017821|Ga0187812_1252527 | Not Available | 562 | Open in IMG/M |
| 3300017822|Ga0187802_10193104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 782 | Open in IMG/M |
| 3300017823|Ga0187818_10283214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
| 3300017926|Ga0187807_1085335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 988 | Open in IMG/M |
| 3300017934|Ga0187803_10198887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
| 3300017942|Ga0187808_10245207 | Not Available | 801 | Open in IMG/M |
| 3300017947|Ga0187785_10362644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 686 | Open in IMG/M |
| 3300017955|Ga0187817_10120854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1657 | Open in IMG/M |
| 3300017973|Ga0187780_10702809 | Not Available | 729 | Open in IMG/M |
| 3300017995|Ga0187816_10449654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 576 | Open in IMG/M |
| 3300018060|Ga0187765_11208560 | Not Available | 531 | Open in IMG/M |
| 3300020199|Ga0179592_10092582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 1388 | Open in IMG/M |
| 3300020580|Ga0210403_10684726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 822 | Open in IMG/M |
| 3300020583|Ga0210401_10839853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 778 | Open in IMG/M |
| 3300021170|Ga0210400_10417076 | Not Available | 1108 | Open in IMG/M |
| 3300021171|Ga0210405_10858552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 692 | Open in IMG/M |
| 3300021388|Ga0213875_10161763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1050 | Open in IMG/M |
| 3300021401|Ga0210393_10958235 | Not Available | 693 | Open in IMG/M |
| 3300021403|Ga0210397_10345582 | Not Available | 1102 | Open in IMG/M |
| 3300021403|Ga0210397_10456697 | Not Available | 962 | Open in IMG/M |
| 3300021404|Ga0210389_10698064 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300021406|Ga0210386_11456209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
| 3300021406|Ga0210386_11786616 | Not Available | 506 | Open in IMG/M |
| 3300021407|Ga0210383_10581417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 966 | Open in IMG/M |
| 3300021420|Ga0210394_10884287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 778 | Open in IMG/M |
| 3300021479|Ga0210410_10102137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2532 | Open in IMG/M |
| 3300022557|Ga0212123_10735460 | Not Available | 602 | Open in IMG/M |
| 3300022718|Ga0242675_1078746 | Not Available | 602 | Open in IMG/M |
| 3300024187|Ga0247672_1086571 | Not Available | 542 | Open in IMG/M |
| 3300024251|Ga0247679_1046151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 732 | Open in IMG/M |
| 3300025634|Ga0208589_1082101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 773 | Open in IMG/M |
| 3300025634|Ga0208589_1124772 | Not Available | 596 | Open in IMG/M |
| 3300025915|Ga0207693_10108811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2174 | Open in IMG/M |
| 3300025928|Ga0207700_10876626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 803 | Open in IMG/M |
| 3300025928|Ga0207700_10937773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 775 | Open in IMG/M |
| 3300025928|Ga0207700_11100810 | Not Available | 710 | Open in IMG/M |
| 3300025928|Ga0207700_11738351 | Not Available | 549 | Open in IMG/M |
| 3300025929|Ga0207664_10199773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1725 | Open in IMG/M |
| 3300025939|Ga0207665_11104540 | Not Available | 632 | Open in IMG/M |
| 3300025945|Ga0207679_10981070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 774 | Open in IMG/M |
| 3300026034|Ga0208773_1005986 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1609 | Open in IMG/M |
| 3300026446|Ga0257178_1012909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 944 | Open in IMG/M |
| 3300026467|Ga0257154_1046503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
| 3300026498|Ga0257156_1050846 | Not Available | 852 | Open in IMG/M |
| 3300027080|Ga0208237_1001900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2630 | Open in IMG/M |
| 3300027158|Ga0208725_1052877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 609 | Open in IMG/M |
| 3300027174|Ga0207948_1016288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 868 | Open in IMG/M |
| 3300027371|Ga0209418_1053313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 719 | Open in IMG/M |
| 3300027857|Ga0209166_10184612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1127 | Open in IMG/M |
| 3300027884|Ga0209275_10714193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
| 3300028768|Ga0307280_10087761 | Not Available | 1020 | Open in IMG/M |
| 3300029882|Ga0311368_10157261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1850 | Open in IMG/M |
| 3300029882|Ga0311368_10180847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1690 | Open in IMG/M |
| 3300030007|Ga0311338_10136563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2952 | Open in IMG/M |
| 3300030043|Ga0302306_10193571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 783 | Open in IMG/M |
| 3300030054|Ga0302182_10104248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1246 | Open in IMG/M |
| 3300030509|Ga0302183_10064551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1448 | Open in IMG/M |
| 3300030707|Ga0310038_10475738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
| 3300030739|Ga0302311_10455769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 888 | Open in IMG/M |
| 3300030940|Ga0265740_1038118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300031544|Ga0318534_10646100 | Not Available | 599 | Open in IMG/M |
| 3300031545|Ga0318541_10140173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1322 | Open in IMG/M |
| 3300031546|Ga0318538_10236808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 979 | Open in IMG/M |
| 3300031561|Ga0318528_10084195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1653 | Open in IMG/M |
| 3300031561|Ga0318528_10398558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
| 3300031668|Ga0318542_10214310 | Not Available | 973 | Open in IMG/M |
| 3300031682|Ga0318560_10323563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 832 | Open in IMG/M |
| 3300031708|Ga0310686_117744635 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300031723|Ga0318493_10342997 | Not Available | 811 | Open in IMG/M |
| 3300031747|Ga0318502_10702288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 611 | Open in IMG/M |
| 3300031747|Ga0318502_11006126 | Not Available | 508 | Open in IMG/M |
| 3300031751|Ga0318494_10590777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
| 3300031764|Ga0318535_10154590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1023 | Open in IMG/M |
| 3300031779|Ga0318566_10229893 | Not Available | 920 | Open in IMG/M |
| 3300031781|Ga0318547_10253836 | Not Available | 1061 | Open in IMG/M |
| 3300031792|Ga0318529_10056746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1700 | Open in IMG/M |
| 3300031792|Ga0318529_10290327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 761 | Open in IMG/M |
| 3300031797|Ga0318550_10243724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 872 | Open in IMG/M |
| 3300031821|Ga0318567_10545537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 658 | Open in IMG/M |
| 3300031831|Ga0318564_10053838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1753 | Open in IMG/M |
| 3300031833|Ga0310917_11141016 | Not Available | 519 | Open in IMG/M |
| 3300031835|Ga0318517_10198388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 904 | Open in IMG/M |
| 3300031860|Ga0318495_10126954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1149 | Open in IMG/M |
| 3300031879|Ga0306919_10130875 | All Organisms → cellular organisms → Bacteria | 1808 | Open in IMG/M |
| 3300031894|Ga0318522_10128743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 949 | Open in IMG/M |
| 3300031894|Ga0318522_10226940 | Not Available | 708 | Open in IMG/M |
| 3300031896|Ga0318551_10796284 | Not Available | 549 | Open in IMG/M |
| 3300031910|Ga0306923_10943920 | Not Available | 942 | Open in IMG/M |
| 3300031912|Ga0306921_12049967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
| 3300031947|Ga0310909_10436428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1099 | Open in IMG/M |
| 3300032001|Ga0306922_10885730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 928 | Open in IMG/M |
| 3300032001|Ga0306922_12339492 | Not Available | 511 | Open in IMG/M |
| 3300032008|Ga0318562_10231102 | Not Available | 1073 | Open in IMG/M |
| 3300032035|Ga0310911_10051815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2141 | Open in IMG/M |
| 3300032042|Ga0318545_10167593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 783 | Open in IMG/M |
| 3300032060|Ga0318505_10386197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
| 3300032060|Ga0318505_10440868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 616 | Open in IMG/M |
| 3300032063|Ga0318504_10526649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
| 3300032066|Ga0318514_10102047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1456 | Open in IMG/M |
| 3300032068|Ga0318553_10052929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2003 | Open in IMG/M |
| 3300032068|Ga0318553_10414164 | Not Available | 706 | Open in IMG/M |
| 3300032068|Ga0318553_10506588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
| 3300032089|Ga0318525_10055073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1979 | Open in IMG/M |
| 3300032089|Ga0318525_10287809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 844 | Open in IMG/M |
| 3300032160|Ga0311301_11295944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 921 | Open in IMG/M |
| 3300032174|Ga0307470_10978615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 671 | Open in IMG/M |
| 3300032782|Ga0335082_10379019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1280 | Open in IMG/M |
| 3300032828|Ga0335080_11628144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
| 3300032895|Ga0335074_10006605 | All Organisms → cellular organisms → Bacteria | 16096 | Open in IMG/M |
| 3300032895|Ga0335074_11233676 | Not Available | 626 | Open in IMG/M |
| 3300032897|Ga0335071_11224205 | Not Available | 696 | Open in IMG/M |
| 3300032898|Ga0335072_11475571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 582 | Open in IMG/M |
| 3300033289|Ga0310914_11358307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 613 | Open in IMG/M |
| 3300033290|Ga0318519_10086681 | Not Available | 1659 | Open in IMG/M |
| 3300033818|Ga0334804_008531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4243 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 36.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.97% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.35% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.73% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.11% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.11% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.86% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.86% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.24% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.24% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.24% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.24% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.62% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.62% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.62% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.62% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.62% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.62% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.62% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.62% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.62% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.62% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026034 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 (SPAdes) | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FI_00548570 | 2166559006 | Grass Soil | TQYHAVGADPVNPATGAKGDPTPDYTEFETFTLVRPR |
| deepsgr_02985160 | 2199352025 | Soil | SIKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR |
| JGI24743J22301_101516981 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | PGHGSDGQPSIKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR* |
| JGIcombinedJ26739_1006153601 | 3300002245 | Forest Soil | VDPDPEDFAGHTGITVTQYHAAGADPVNPATGAKGAPTPECTEFETFTLIRRRS* |
| Ga0062388_1003222602 | 3300004635 | Bog Forest Soil | GPEGGGQTSITVTQYHAVGADPVNPGTGAKGTPTPDYTEFETFRLVRSRADGR* |
| Ga0066675_111898811 | 3300005187 | Soil | PSIKVTHYHAVGADPVNPGTGAKGGAAPDYTEFETFTLVRPR* |
| Ga0070714_1016141091 | 3300005435 | Agricultural Soil | DPGSGSDGEPSIKVTHYHAVGADPVNPGTGDKGAPNPDYTEFETFTLVRPR* |
| Ga0070730_102527972 | 3300005537 | Surface Soil | FDVHPDPEDFGGRTAITVTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLIRPRRA* |
| Ga0070733_102740122 | 3300005541 | Surface Soil | VGADPVNPATGAVGGPTPDYTEFETFTLVRPRADRT* |
| Ga0066700_108359982 | 3300005559 | Soil | VGADPVNPGTGVKGAPTPDYTEFETFRLVRPRSS* |
| Ga0070761_104612682 | 3300005591 | Soil | GADPVNPATGARGAPTADYTEFETFTLIRPRSDGHRRRGSR* |
| Ga0066706_107831273 | 3300005598 | Soil | YHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR* |
| Ga0070762_100339981 | 3300005602 | Soil | HTSITVTHYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPRSS* |
| Ga0070763_107279152 | 3300005610 | Soil | VGADPVNPATGAKGAPTPDYTEFETFTLIRPRRG* |
| Ga0070717_114144102 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VTHYHAVGADPVNPGTGDKGTPTADYTEFETFTLVRPR* |
| Ga0075029_1003766761 | 3300006052 | Watersheds | AGGQPSIKVTHYHAVGADPVNPGTGVKGAPTPDYTEFETFRLVRPRL* |
| Ga0075030_1005173612 | 3300006162 | Watersheds | VGADPVNPGTGAKGAPTPDYTEFETFRLVRPRSS* |
| Ga0070715_102597233 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | PSIKVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR* |
| Ga0079221_101297251 | 3300006804 | Agricultural Soil | PGSGSDGQPSIRVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR* |
| Ga0079220_104847373 | 3300006806 | Agricultural Soil | GHTSIKVTHYHAVGADPVNPTTGDKGAPTPDYTEFETFRLVRPR* |
| Ga0075436_1014560342 | 3300006914 | Populus Rhizosphere | DGQASIRVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR* |
| Ga0099792_108529282 | 3300009143 | Vadose Zone Soil | VDPGSGSGSDGEPSIKVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR* |
| Ga0116225_15436811 | 3300009524 | Peatlands Soil | HAVGADPVNPATGAKGAPTPDYTEFETFTLVSPRRA* |
| Ga0116220_102359032 | 3300009525 | Peatlands Soil | YHAVGADPVNPGTGVKGAPTPDYTEFETFRLVRPRL* |
| Ga0126373_106740053 | 3300010048 | Tropical Forest Soil | PDDHTSITIRYFHAVGADPVNPATGQPGAPTSHYTEFETFTLIRPRSDRGRQD* |
| Ga0126373_122895591 | 3300010048 | Tropical Forest Soil | TVTQYHAPGADPVNPATGEAGAPTPDYTEFETFTLVRPRCDRGHR* |
| Ga0126376_109877471 | 3300010359 | Tropical Forest Soil | PSIKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR* |
| Ga0126378_120969933 | 3300010361 | Tropical Forest Soil | DGQPSIKVTHYHAVGADPVNPATGTKGAPTPDYTEFETFTVVRPVPGGSGALRP* |
| Ga0126381_1042644392 | 3300010376 | Tropical Forest Soil | SVTGTLYHAPGADPVIPATGEAGAPTPDYTEFETFTLVHPRSGR* |
| Ga0134121_112691693 | 3300010401 | Terrestrial Soil | GSDGEPSIKVTHYHAVGADPVNPGTGDKGAPNPDYTEFETFTLVRPR* |
| Ga0126350_109736882 | 3300010880 | Boreal Forest Soil | GGQTSITVTQYHALGADPVNPTTGEAGTPTPDYTEFETFTLVRPRNRA* |
| Ga0137376_112417571 | 3300012208 | Vadose Zone Soil | YHAVGADPVNPGTGDKGAPTPDYTKFETFTLVRPR* |
| Ga0137368_105195771 | 3300012358 | Vadose Zone Soil | VRRRPRGGHPSIKVTHYHAVGADPVNPGTGVKGAPTPDYTEFETFTLVRPR* |
| Ga0137385_100037191 | 3300012359 | Vadose Zone Soil | ASIKVTHYHAVGADPVNPATGAKGAPTPDYTEFETFRLVRPRSS* |
| Ga0137360_112790471 | 3300012361 | Vadose Zone Soil | SIKVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR* |
| Ga0157323_10054951 | 3300012495 | Arabidopsis Rhizosphere | QPSIKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR* |
| Ga0157373_106187861 | 3300013100 | Corn Rhizosphere | GSDGKPSIKVAHYHAVGADPVNPGSGDKRAPTTDYTEFETITPVRPR* |
| Ga0181532_104868992 | 3300014164 | Bog | APEGSEAGGQPSIKVTHYHAVGADPVNPGTGVKGAPAPDYTEFETFRLVRPGL* |
| Ga0182030_114287021 | 3300014838 | Bog | QYHALGADPVNPATGAKGAPTPDYTEFETFRLVRPRSR* |
| Ga0182036_102660331 | 3300016270 | Soil | QPSIKVTHYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPR |
| Ga0182033_103328111 | 3300016319 | Soil | HAVGADPVNPGTGVKGAPTPDYTEFETFTLVRPRQG |
| Ga0182033_108900872 | 3300016319 | Soil | SDGQPSIKVTHYHAVGADPVNPATGAKGEPTPDYTEFETFTLVRPR |
| Ga0182032_114877442 | 3300016357 | Soil | IKVTHYHAVGADPVNPATGAKGEPTPDYTEFETFTLVRPR |
| Ga0182034_105310602 | 3300016371 | Soil | GQTSITVTQYHALGADPVNPATGDKGAPTPDYTEFEAFKLVRPRSR |
| Ga0182040_101750422 | 3300016387 | Soil | DPEGAAHDGQTSITVTHYHALGADPVYPATGDKGAPTRDYTEFETFKLVRPRSR |
| Ga0187812_11104601 | 3300017821 | Freshwater Sediment | PDPEDFGGQTSITVTQYHAVGADPVNPATGEKGAPTPDYTEFETFTLVRPRRA |
| Ga0187812_12525272 | 3300017821 | Freshwater Sediment | SGGQTSITVTHYHALGADPVNPTTGAKGAPNDNYTVFETFTLIRPRSDGGTSED |
| Ga0187802_101931042 | 3300017822 | Freshwater Sediment | EDFSGQTRITVTHYHAVGADPVNPATGAKGAPTPDYTEFETFSLVRPRGG |
| Ga0187818_102832142 | 3300017823 | Freshwater Sediment | AAFDVHPDREDFGGYTSIAVTHYHAVGADPVNPATDVKGAPTPDYTEFETFTLVRPRTT |
| Ga0187807_10853353 | 3300017926 | Freshwater Sediment | VQPDPEDFGGQTSITVTQYHAVGADPVNPATGEKGAPTPDYTEFETFTLVRPRRA |
| Ga0187803_101988871 | 3300017934 | Freshwater Sediment | TVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPRRG |
| Ga0187808_102452071 | 3300017942 | Freshwater Sediment | DGQTSITVTQYHALGADPVNPNTGAKGAPTDDYTVFETFTLVRPRSDGHFG |
| Ga0187785_103626441 | 3300017947 | Tropical Peatland | THYHAIGADPVNPASGVKGAPTPDYTEFETFTLVRPR |
| Ga0187817_101208541 | 3300017955 | Freshwater Sediment | QTSITVTQYHAVGADPVIPATGEKGSPTQDYTEFETFTLVRPRRA |
| Ga0187780_107028091 | 3300017973 | Tropical Peatland | AAGQPSIKVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPR |
| Ga0187816_104496541 | 3300017995 | Freshwater Sediment | PEDSGGQTSITVTQYHAVGADPVNPATGEKGAPTPDYTEFETFTLVRPRRA |
| Ga0187765_112085602 | 3300018060 | Tropical Peatland | SITVTHYHAVGADPVNPGTGVKGAPTPDYTEFETFKLIRPR |
| Ga0179592_100925823 | 3300020199 | Vadose Zone Soil | SIKVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR |
| Ga0210403_106847261 | 3300020580 | Soil | VDPDPGSDGQPSIKVTHYHAVGADPVNPATGAKGDPTPDYTEFETFTLVRPR |
| Ga0210401_108398533 | 3300020583 | Soil | DGEPSIKVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR |
| Ga0210400_104170761 | 3300021170 | Soil | HYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR |
| Ga0210405_108585522 | 3300021171 | Soil | QPSIKVTHYHAVGADPVNPATGAKGDPTPDYTEFETFTLVRPR |
| Ga0213875_101617631 | 3300021388 | Plant Roots | PSITVTHYHAVGADPVNPGTGVKGAPTPDYTEFETFKLIRPR |
| Ga0210393_109582351 | 3300021401 | Soil | QYHALDADPVNPTTGAKGAPTPDYTEFETFTLIRPRRG |
| Ga0210397_103455822 | 3300021403 | Soil | AVFDVHPGEVRGGMTSITVRYFHAVGADPVNPATGQPGAPTANYTEFESFTLVRRRCDG |
| Ga0210397_104566971 | 3300021403 | Soil | KVTHYHAVGADPVNPATGAKGAPTPDYTEFETFRLVRSRSS |
| Ga0210389_106980641 | 3300021404 | Soil | GADPVNPNSGATGAPTDDYTVFETFTLARPRSDWRPFDKD |
| Ga0210386_114562093 | 3300021406 | Soil | SITVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLIRPRSG |
| Ga0210386_117866162 | 3300021406 | Soil | QYHALGADPVNPNTGAKDAPTPDYTLFETFTLVRPRSDRRFD |
| Ga0210383_105814171 | 3300021407 | Soil | QTRITVTHYHAVGADPVNPATGAKGAPTPDYTEFETFSLVRPRGG |
| Ga0210394_108842872 | 3300021420 | Soil | DVHPDPEDFVGHTSITVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLLRPRSLR |
| Ga0210410_101021371 | 3300021479 | Soil | EPSIKVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR |
| Ga0212123_107354602 | 3300022557 | Iron-Sulfur Acid Spring | DKTSITVSHYHALGADPVNPNTGAKGAPTSNYTLFETFKLVRPRSDRH |
| Ga0242675_10787461 | 3300022718 | Soil | GDQTSIKVTHYHAVGADPVNPGSGAKGAPTPDYTEFETFTLIRPRRG |
| Ga0247672_10865712 | 3300024187 | Soil | PSIKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR |
| Ga0247679_10461511 | 3300024251 | Soil | YHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR |
| Ga0208589_10821012 | 3300025634 | Arctic Peat Soil | SVTVRYFHAVGADPVNPASGRPGEPTPTYTEFETVTLVRHRSDG |
| Ga0208589_11247722 | 3300025634 | Arctic Peat Soil | PGPDDGDQTSITVTQYHAVGADPVNPATGAKGAPTPDYTKFETFALVRRRP |
| Ga0207693_101088111 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | DGQPSIKVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR |
| Ga0207700_108766262 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | DGQPSIKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR |
| Ga0207700_109377731 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | FHALGADPVNPNTGQAGAPNPNYTEFETFKLVRPRSDGRRHHG |
| Ga0207700_111008101 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TSIKVTHYHAVGADPVNPTTGEKGAPTPDYTEFETFRLVRPR |
| Ga0207700_117383512 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GEPSIKVTHYHAVGADPVNPGTGDKGAPNPDYTEFETFTLVRPR |
| Ga0207664_101997731 | 3300025929 | Agricultural Soil | PGSGSGSDGQPSIKVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR |
| Ga0207665_111045401 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | DGQPSIKVTQYHAVGADPVNPGTGDKGTPTADYTEFETFTLVRPR |
| Ga0207679_109810702 | 3300025945 | Corn Rhizosphere | GHGSDGQTSIKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR |
| Ga0208773_10059862 | 3300026034 | Rice Paddy Soil | YHHAAGADPVNPNTGAHGAPSPDYTPFETFTLVRRRSG |
| Ga0257178_10129091 | 3300026446 | Soil | VDPGSGSGSDGHPSIKVTHYHAVGANPVNPGTGAKGAPTPDYTEFETFTLVRPR |
| Ga0257154_10465031 | 3300026467 | Soil | GGHTSITVTQYHAVGADPVNPATGVKGAPTPDYTEFETFTLIRPRSG |
| Ga0257156_10508462 | 3300026498 | Soil | IKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR |
| Ga0208237_10019001 | 3300027080 | Forest Soil | VTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLIRPRRA |
| Ga0208725_10528772 | 3300027158 | Forest Soil | AVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG |
| Ga0207948_10162883 | 3300027174 | Forest Soil | ELAGFESGGQASIRVTQYHAVGADPVNPGTGAKGAPTPDYTEFETFTLIRPRSG |
| Ga0209418_10533131 | 3300027371 | Forest Soil | YHAVGADSVNPVTGVKGAPTPDYTEFETFTLVRPR |
| Ga0209166_101846122 | 3300027857 | Surface Soil | VTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLIRPRRA |
| Ga0209275_107141931 | 3300027884 | Soil | SITVTQYHAVGADPVNPATGANGAPTPDYTEFETFRLVRPRSS |
| Ga0307280_100877611 | 3300028768 | Soil | LTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR |
| Ga0311368_101572614 | 3300029882 | Palsa | YHAVGADPVNPATGAKGAPTPDYTEFETFTVTRRRSDGGL |
| Ga0311368_101808471 | 3300029882 | Palsa | THYHTVGAADPVNPTTGAKGVPTPDYTEFETFTLVRPRSA |
| Ga0311338_101365631 | 3300030007 | Palsa | HAVGADPVNSGTGVKGAPTPDYTEFETFALVHRRP |
| Ga0302306_101935712 | 3300030043 | Palsa | TESGDRTSITVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTVTRRRSDGGL |
| Ga0302182_101042481 | 3300030054 | Palsa | SITVTQYHAVGADPVNPATGDKGAPTPDYTEFETFTVTRPRSDGGP |
| Ga0302183_100645512 | 3300030509 | Palsa | QYHAVGADPVNPATGDKGAPTPDYTEFETFTVTRPRSDGGP |
| Ga0310038_104757382 | 3300030707 | Peatlands Soil | EGSEAGGQPSIKVTHYHAVGADPVNPGTGVKGAPAPDYTEFETFRLVRPRF |
| Ga0302311_104557691 | 3300030739 | Palsa | RTSITVTQYHAVGADPVNPATGVKGAPTPDYTEFETFTVTRPRSDGGR |
| Ga0265740_10381182 | 3300030940 | Soil | QYHAVGADPVNSATGAKGAPTPDYTEFETFTLIRPRRG |
| Ga0318534_106461002 | 3300031544 | Soil | FDVHPAPEDFGGQTSITVTQYQAVGADPVNPGSGAKGEPTPDYTEFETFTLVRPRRG |
| Ga0318541_101401733 | 3300031545 | Soil | ITVTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG |
| Ga0318538_102368083 | 3300031546 | Soil | VHPERADFGGQTSITVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPRQG |
| Ga0318528_100841951 | 3300031561 | Soil | TQYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG |
| Ga0318528_103985582 | 3300031561 | Soil | PNPADFGGQTSITVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPRRG |
| Ga0318542_102143101 | 3300031668 | Soil | GLTGSDGQPSIKVTHYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPR |
| Ga0318560_103235632 | 3300031682 | Soil | HYHAVGADPVNPATGAKGEPTPDYTEFETFTLVRPR |
| Ga0310686_1177446353 | 3300031708 | Soil | ASIKVTHYHAVGADPVNPDTAAKGAPTPDYTEFETFRLVRPRSF |
| Ga0318493_103429972 | 3300031723 | Soil | QYQAVGADPVNPGSGAKGEPTPDYTEFETFTLVRPRRG |
| Ga0318502_107022882 | 3300031747 | Soil | IKVTHYHAVGADPVNPASGAKGAPSPDYTEFETFTLVRPR |
| Ga0318502_110061262 | 3300031747 | Soil | YHAVGADPVNPTSGVKGAPTPDYTEFETFRLVRPRPS |
| Ga0318494_105907771 | 3300031751 | Soil | ITHYHAVGADPVNPVTGVKGAPTPDYTEFETFRLVRPRSSEGLG |
| Ga0318535_101545902 | 3300031764 | Soil | VRYFHALGADPTNPNTGTKGAPNSVYTLFETVKLIRPRSRR |
| Ga0318566_102298932 | 3300031779 | Soil | ITVTQYHAVGADPVNPGSGAKGEPTPDYTEFETFTLVRPRRG |
| Ga0318547_102538361 | 3300031781 | Soil | DFGGQTSITVTQYQAVGADPVNPGSGAKGEPTPDYTEFETFTLVRPRRG |
| Ga0318529_100567463 | 3300031792 | Soil | DRADFGSQTSITVTQYHAVGAGRGNPATGARGAPAPDYTEFETFTLVRPRRG |
| Ga0318529_102903271 | 3300031792 | Soil | VHPDREDFGGHTSITVTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG |
| Ga0318550_102437242 | 3300031797 | Soil | YHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPRRG |
| Ga0318567_105455371 | 3300031821 | Soil | TRITVTHYHAVGADPVNPATGAKGAPTPDYTEFETFSLVRPRGG |
| Ga0318564_100538384 | 3300031831 | Soil | VTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG |
| Ga0310917_111410162 | 3300031833 | Soil | VHPDPADSGGRTSITVTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG |
| Ga0318517_101983881 | 3300031835 | Soil | THYHALGADPVYPATGDKGAPTPDYTEFETFKLVRPRSR |
| Ga0318495_101269542 | 3300031860 | Soil | GHTSITVTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG |
| Ga0306919_101308751 | 3300031879 | Soil | TVTQYHAVGADPVHPATGDKGAPTPDYTEFEAFRLVRPRSR |
| Ga0318522_101287431 | 3300031894 | Soil | TQYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPRRG |
| Ga0318522_102269402 | 3300031894 | Soil | TQYQAVGADPVNPGSGAKGEPTPDYTEFETFTLVRPRRG |
| Ga0318551_107962841 | 3300031896 | Soil | SITVTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG |
| Ga0306923_109439201 | 3300031910 | Soil | ASIKVTHYHAVGADPVNPTSGVKGAPTPDYTEFETFRLVRPRSS |
| Ga0306921_120499672 | 3300031912 | Soil | PAGPETAGQAGIKVTHYHAVGADPVNPGTGVKGAPTPDYTEFETFRLVRPRSS |
| Ga0310909_104364282 | 3300031947 | Soil | HTSITVTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG |
| Ga0306922_108857301 | 3300032001 | Soil | ADFGGQTSITVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPRQG |
| Ga0306922_123394921 | 3300032001 | Soil | SGGRTSITVTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG |
| Ga0318562_102311021 | 3300032008 | Soil | YHAVGADPVNPASGVKGAPTPDYTEFETFTLVRPR |
| Ga0310911_100518151 | 3300032035 | Soil | ITVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPRRG |
| Ga0318545_101675932 | 3300032042 | Soil | YHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG |
| Ga0318505_103861971 | 3300032060 | Soil | PDGQTSITVTQYHAVGADPVHPATGDKGAPTPDYTEFEAFRLVRPRSR |
| Ga0318505_104408682 | 3300032060 | Soil | VTHYHAVGADPVNPATGAKGEPTPDYTEFETFTLVRPR |
| Ga0318504_105266492 | 3300032063 | Soil | GSDGQPSIKVTHYHAVGADPVNPASGAKGAPSPDYTEFETFTLVRPR |
| Ga0318514_101020471 | 3300032066 | Soil | GQTSITVTQYHAVGADPVHPATGDKGAPTPDYTEFEAFRLVRPRSR |
| Ga0318553_100529291 | 3300032068 | Soil | THYHAVGADPVNPTSGVKGAPTPDYTEFETFRLVRPRPS |
| Ga0318553_104141641 | 3300032068 | Soil | QYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPRRG |
| Ga0318553_105065882 | 3300032068 | Soil | ADFGGQTSITVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPRRG |
| Ga0318525_100550733 | 3300032089 | Soil | IKVTHYHAVGADPVNPGTGVKGAPTPDYTEFETFRLVRPRSS |
| Ga0318525_102878092 | 3300032089 | Soil | VHPDRADFGSQTSITVTQYHAVGAGRGNPATGARGAPAPDYTEFETFTLVRPRRG |
| Ga0311301_112959442 | 3300032160 | Peatlands Soil | GGQASIKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFRIVRPHSFAGTGGGG |
| Ga0307470_109786152 | 3300032174 | Hardwood Forest Soil | KVTHYHAVGADPVNPGTGTKGAPTPDYTEFETFTLVRPR |
| Ga0335082_103790191 | 3300032782 | Soil | THYHAVGADPVNPTTGVKGAPTPDYTEFETFRLVRPRSS |
| Ga0335080_116281441 | 3300032828 | Soil | PSIKITQYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRSR |
| Ga0335074_100066052 | 3300032895 | Soil | VTQYHAVGADPVNPATGAKGAPTPDYTEFETFRLIRPRSS |
| Ga0335074_112336762 | 3300032895 | Soil | YHALGADPVNPNTGAKGAPTPDYTLFETFTLVRPRSDRRFD |
| Ga0335071_112242053 | 3300032897 | Soil | HYHAVGADPVNPTTGNKGAPTPDYTEFETFRLVRPR |
| Ga0335072_114755712 | 3300032898 | Soil | VDPHGGGNGRGTITVRYFHAPGADPTNPTSGVKGAPNPTYTEFETFTLF |
| Ga0310914_113583072 | 3300033289 | Soil | SIKVTHYHAVGADPVNPASGAKGAPSPDYTEFETFTLVRPR |
| Ga0318519_100866814 | 3300033290 | Soil | TQYHAVGADPVNPGSGAKGEPTPDYTEFETFTLVRPRRG |
| Ga0334804_008531_4095_4241 | 3300033818 | Soil | AGGQTSITVTQYHALGADPVNPATGAKGAPTPDYTEFETFRLVRPRSR |
| ⦗Top⦘ |