| Basic Information | |
|---|---|
| Family ID | F040893 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 161 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MPLIEIRNLTKVFPHGESPFGGKARGEVRAVDDVSLDI |
| Number of Associated Samples | 144 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 52.80 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 89.44 % |
| Associated GOLD sequencing projects | 140 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.851 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.180 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.118 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.447 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 31.82% Coil/Unstructured: 68.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF00892 | EamA | 61.49 |
| PF00694 | Aconitase_C | 5.59 |
| PF00834 | Ribul_P_3_epim | 1.86 |
| PF08843 | AbiEii | 1.24 |
| PF02548 | Pantoate_transf | 1.24 |
| PF00440 | TetR_N | 1.24 |
| PF03781 | FGE-sulfatase | 1.24 |
| PF00460 | Flg_bb_rod | 1.24 |
| PF01263 | Aldose_epim | 0.62 |
| PF08240 | ADH_N | 0.62 |
| PF09424 | YqeY | 0.62 |
| PF01715 | IPPT | 0.62 |
| PF00133 | tRNA-synt_1 | 0.62 |
| PF01431 | Peptidase_M13 | 0.62 |
| PF08388 | GIIM | 0.62 |
| PF13620 | CarboxypepD_reg | 0.62 |
| PF16363 | GDP_Man_Dehyd | 0.62 |
| PF13525 | YfiO | 0.62 |
| PF03693 | ParD_antitoxin | 0.62 |
| PF00072 | Response_reg | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG0036 | Pentose-5-phosphate-3-epimerase | Carbohydrate transport and metabolism [G] | 1.86 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 1.24 |
| COG4787 | Flagellar basal body rod protein FlgF | Cell motility [N] | 1.24 |
| COG4786 | Flagellar basal body rod protein FlgG | Cell motility [N] | 1.24 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 1.24 |
| COG1815 | Flagellar basal body rod protein FlgB | Cell motility [N] | 1.24 |
| COG1749 | Flagellar hook protein FlgE | Cell motility [N] | 1.24 |
| COG1558 | Flagellar basal body rod protein FlgC | Cell motility [N] | 1.24 |
| COG1256 | Flagellar hook-associated protein FlgK | Cell motility [N] | 1.24 |
| COG0413 | Ketopantoate hydroxymethyltransferase | Coenzyme transport and metabolism [H] | 1.24 |
| COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 0.62 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 0.62 |
| COG0324 | tRNA A37 N6-isopentenylltransferase MiaA | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG3609 | Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domain | Transcription [K] | 0.62 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.85 % |
| Unclassified | root | N/A | 16.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001166|JGI12694J13545_1010255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1024 | Open in IMG/M |
| 3300001593|JGI12635J15846_10009079 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8442 | Open in IMG/M |
| 3300001593|JGI12635J15846_10692642 | Not Available | 588 | Open in IMG/M |
| 3300001991|JGI24743J22301_10022290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1214 | Open in IMG/M |
| 3300004080|Ga0062385_11013346 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300004152|Ga0062386_101113271 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300005167|Ga0066672_10647802 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005435|Ga0070714_101880722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300005538|Ga0070731_10351580 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300005558|Ga0066698_10766971 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300005576|Ga0066708_10053357 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
| 3300005586|Ga0066691_10143290 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300005602|Ga0070762_10179535 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300005841|Ga0068863_101838620 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005843|Ga0068860_102449595 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005921|Ga0070766_10082461 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
| 3300005921|Ga0070766_10338707 | Not Available | 974 | Open in IMG/M |
| 3300005994|Ga0066789_10058133 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300006052|Ga0075029_100032575 | All Organisms → cellular organisms → Bacteria | 2966 | Open in IMG/M |
| 3300006102|Ga0075015_100304889 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300006102|Ga0075015_100812864 | Not Available | 562 | Open in IMG/M |
| 3300006162|Ga0075030_101214737 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300006163|Ga0070715_10338163 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300006172|Ga0075018_10743363 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300006174|Ga0075014_100190747 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300006175|Ga0070712_101232063 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300006854|Ga0075425_100548810 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300006854|Ga0075425_102465370 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300006893|Ga0073928_10995266 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300006903|Ga0075426_10924610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300006914|Ga0075436_100226353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1328 | Open in IMG/M |
| 3300009038|Ga0099829_10489451 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1021 | Open in IMG/M |
| 3300009088|Ga0099830_10307450 | Not Available | 1267 | Open in IMG/M |
| 3300009090|Ga0099827_11324993 | Not Available | 626 | Open in IMG/M |
| 3300009090|Ga0099827_11974164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300009521|Ga0116222_1018798 | All Organisms → cellular organisms → Bacteria | 3144 | Open in IMG/M |
| 3300009551|Ga0105238_10377472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Meiothermus | 1409 | Open in IMG/M |
| 3300009616|Ga0116111_1063816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
| 3300009665|Ga0116135_1124897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 947 | Open in IMG/M |
| 3300009672|Ga0116215_1153088 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300010043|Ga0126380_11962615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300010304|Ga0134088_10161427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1068 | Open in IMG/M |
| 3300010304|Ga0134088_10240907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 869 | Open in IMG/M |
| 3300010343|Ga0074044_10831242 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300010358|Ga0126370_10730426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 874 | Open in IMG/M |
| 3300010360|Ga0126372_10080042 | Not Available | 2370 | Open in IMG/M |
| 3300010360|Ga0126372_10732385 | Not Available | 970 | Open in IMG/M |
| 3300010376|Ga0126381_100268249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2323 | Open in IMG/M |
| 3300010379|Ga0136449_100635230 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
| 3300010379|Ga0136449_101380406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1090 | Open in IMG/M |
| 3300010397|Ga0134124_11339637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 740 | Open in IMG/M |
| 3300012189|Ga0137388_10157919 | All Organisms → cellular organisms → Bacteria | 2015 | Open in IMG/M |
| 3300012201|Ga0137365_10908776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300012203|Ga0137399_10865142 | Not Available | 761 | Open in IMG/M |
| 3300012349|Ga0137387_10595591 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300012349|Ga0137387_11281098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300012685|Ga0137397_10326617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1144 | Open in IMG/M |
| 3300012685|Ga0137397_10447516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300012917|Ga0137395_10949736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300012922|Ga0137394_10935202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300012925|Ga0137419_11527269 | Not Available | 566 | Open in IMG/M |
| 3300012927|Ga0137416_11727160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300012930|Ga0137407_11332115 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364 | 682 | Open in IMG/M |
| 3300012960|Ga0164301_10172605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1348 | Open in IMG/M |
| 3300012971|Ga0126369_11820867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300014151|Ga0181539_1050711 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
| 3300014322|Ga0075355_1008358 | All Organisms → cellular organisms → Bacteria | 2004 | Open in IMG/M |
| 3300014489|Ga0182018_10006598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9020 | Open in IMG/M |
| 3300014493|Ga0182016_10257174 | Not Available | 1090 | Open in IMG/M |
| 3300014502|Ga0182021_13799289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300014838|Ga0182030_10978765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300014885|Ga0180063_1271653 | Not Available | 540 | Open in IMG/M |
| 3300015052|Ga0137411_1220455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1076 | Open in IMG/M |
| 3300015264|Ga0137403_10990403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300015374|Ga0132255_100608913 | Not Available | 1616 | Open in IMG/M |
| 3300017823|Ga0187818_10080260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1408 | Open in IMG/M |
| 3300017925|Ga0187856_1018987 | All Organisms → cellular organisms → Bacteria | 3575 | Open in IMG/M |
| 3300017933|Ga0187801_10293916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300017937|Ga0187809_10254137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300017943|Ga0187819_10577928 | Not Available | 638 | Open in IMG/M |
| 3300017946|Ga0187879_10373927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300017946|Ga0187879_10409003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300017970|Ga0187783_10503156 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300017972|Ga0187781_11302430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300017975|Ga0187782_10417288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1021 | Open in IMG/M |
| 3300018009|Ga0187884_10119993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1128 | Open in IMG/M |
| 3300018013|Ga0187873_1173063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| 3300018014|Ga0187860_1320713 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300018030|Ga0187869_10091422 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300018033|Ga0187867_10691999 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300018037|Ga0187883_10180909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1082 | Open in IMG/M |
| 3300018038|Ga0187855_10735997 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300018040|Ga0187862_10472490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300018042|Ga0187871_10482934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300018046|Ga0187851_10457604 | Not Available | 726 | Open in IMG/M |
| 3300018062|Ga0187784_10868895 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300018062|Ga0187784_11175655 | Not Available | 609 | Open in IMG/M |
| 3300018088|Ga0187771_11356681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300018090|Ga0187770_10196790 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300018090|Ga0187770_11370390 | Not Available | 574 | Open in IMG/M |
| 3300020579|Ga0210407_10712326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300020580|Ga0210403_10384495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1147 | Open in IMG/M |
| 3300020580|Ga0210403_11265384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300020583|Ga0210401_10417704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1204 | Open in IMG/M |
| 3300021088|Ga0210404_10583107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300021180|Ga0210396_10018274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6500 | Open in IMG/M |
| 3300021404|Ga0210389_10233952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1436 | Open in IMG/M |
| 3300021404|Ga0210389_11511894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300021407|Ga0210383_10897394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300021433|Ga0210391_10110120 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
| 3300021479|Ga0210410_11265145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300023250|Ga0224544_1031849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
| 3300025414|Ga0208935_1028585 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300025501|Ga0208563_1103210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300025916|Ga0207663_10003211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7960 | Open in IMG/M |
| 3300026020|Ga0208531_1013179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
| 3300026035|Ga0207703_11169558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300026294|Ga0209839_10202680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 636 | Open in IMG/M |
| 3300026316|Ga0209155_1295245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300026329|Ga0209375_1191819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 790 | Open in IMG/M |
| 3300026330|Ga0209473_1198725 | Not Available | 761 | Open in IMG/M |
| 3300026489|Ga0257160_1067670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300026523|Ga0209808_1062045 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
| 3300027376|Ga0209004_1065606 | Not Available | 613 | Open in IMG/M |
| 3300027439|Ga0209332_1087205 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300027535|Ga0209734_1006509 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300027567|Ga0209115_1139660 | Not Available | 544 | Open in IMG/M |
| 3300027570|Ga0208043_1057576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
| 3300027591|Ga0209733_1061387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 985 | Open in IMG/M |
| 3300027629|Ga0209422_1031464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1304 | Open in IMG/M |
| 3300027662|Ga0208565_1151994 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300027676|Ga0209333_1182271 | Not Available | 558 | Open in IMG/M |
| 3300027867|Ga0209167_10080314 | Not Available | 1643 | Open in IMG/M |
| 3300027889|Ga0209380_10792343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300027908|Ga0209006_10980938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300027986|Ga0209168_10093873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1552 | Open in IMG/M |
| 3300028047|Ga0209526_10259669 | Not Available | 1186 | Open in IMG/M |
| 3300028798|Ga0302222_10173407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 847 | Open in IMG/M |
| 3300028906|Ga0308309_10096796 | All Organisms → cellular organisms → Bacteria | 2273 | Open in IMG/M |
| 3300029889|Ga0246001_1033434 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1283 | Open in IMG/M |
| 3300030013|Ga0302178_10198132 | Not Available | 968 | Open in IMG/M |
| 3300030057|Ga0302176_10376062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300030506|Ga0302194_10324714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300030659|Ga0316363_10077561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1515 | Open in IMG/M |
| 3300031090|Ga0265760_10078593 | Not Available | 1019 | Open in IMG/M |
| 3300031234|Ga0302325_10897985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1230 | Open in IMG/M |
| 3300031573|Ga0310915_10293336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1148 | Open in IMG/M |
| 3300031715|Ga0307476_10760605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300031715|Ga0307476_11035545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300031718|Ga0307474_10800387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300031740|Ga0307468_102142744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300031770|Ga0318521_10617845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300031823|Ga0307478_10488575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1025 | Open in IMG/M |
| 3300032076|Ga0306924_11680609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300032515|Ga0348332_12533207 | Not Available | 918 | Open in IMG/M |
| 3300032783|Ga0335079_10166304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2466 | Open in IMG/M |
| 3300032783|Ga0335079_10442005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1395 | Open in IMG/M |
| 3300032892|Ga0335081_10063627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5695 | Open in IMG/M |
| 3300032955|Ga0335076_11681083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300033547|Ga0316212_1014075 | Not Available | 1135 | Open in IMG/M |
| 3300034163|Ga0370515_0051832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1807 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.70% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.07% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.45% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.97% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.35% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.73% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.11% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.11% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.48% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.48% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.48% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.48% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.86% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.24% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.24% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.24% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.62% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.62% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.62% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.62% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.62% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.62% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.62% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.62% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.62% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.62% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.62% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.62% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.62% |
| Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 0.62% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.62% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026020 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12694J13545_10102551 | 3300001166 | Forest Soil | VPLLEIRNLTKVYAQAESILGGARSRREVRAVDEVSLDIQAG |
| JGI12635J15846_100090791 | 3300001593 | Forest Soil | MPLVEVRSLTKIFDLAGSSFGGHRSGEVRAVDDVSLDIS |
| JGI12635J15846_106926422 | 3300001593 | Forest Soil | MPLLEIRNLTKLFPLGESVFGGGAKGEVRAVDDVS |
| JGI24743J22301_100222904 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | VALIEIRNLVKVFSLGESVFGTPLKGEVRAVDDVSLDIVA |
| Ga0062385_110133461 | 3300004080 | Bog Forest Soil | MPLIEIRNLTKVYPQGDSPFGGRPRGGLAKEVRAVDDVSL |
| Ga0062386_1011132711 | 3300004152 | Bog Forest Soil | LLGGFDLVALVEIRNLSKTFSLAESPFGGRGQGEVRAVDDVSLDI |
| Ga0066672_106478022 | 3300005167 | Soil | VALIEINNLIKVFPVNESILGGGARGEVRAVDDVSLDIEPG |
| Ga0070714_1018807221 | 3300005435 | Agricultural Soil | VPLVEVRNLTKVFSSSASLFGGSKHEVCAVDNISLDIEAGE |
| Ga0070731_103515802 | 3300005538 | Surface Soil | MPFVELRDLTKIFPVGESIFGGGSRGEVRAVDGVSLE |
| Ga0066698_107669712 | 3300005558 | Soil | VPLLEIRNLTKVFPHGESPFGGKSHGEVRAVDEVSLDIHAG |
| Ga0066708_100533571 | 3300005576 | Soil | VTPTLVEIRNLTKIFPLGESILGTRAKAEIRAVDEVSLEIR |
| Ga0066691_101432901 | 3300005586 | Soil | VPLLEIRNLTKVFPHSESPFAGKAGSLSPNNEVRAVDDV |
| Ga0070762_101795351 | 3300005602 | Soil | VALVEVRNLSKVFGLGESPFGSHRSGQVRAVDDISFNIHAGE |
| Ga0068863_1018386202 | 3300005841 | Switchgrass Rhizosphere | VALIEIRNLVKVFSLGESVFGTPLKGEVRAVDDVSLDIVAGET |
| Ga0068860_1024495951 | 3300005843 | Switchgrass Rhizosphere | MPLVEIRNLTKVFSTGTSMFGARPQGEVRAVDDVSLDIH |
| Ga0070766_100824611 | 3300005921 | Soil | MPLVEIRSLTKIYPQGESPLGRSSRGGGEVRAVDDVSLDIHAGETL |
| Ga0070766_103387072 | 3300005921 | Soil | MPLIEIRNLTKIYPQSESVFGGTSGSRSEIRAVDDVSLDI |
| Ga0066789_100581333 | 3300005994 | Soil | VHLVEVRNLTKIFALAESSFGGRRSGEVRAVDDVSLDIRE |
| Ga0075029_1000325754 | 3300006052 | Watersheds | VPLLEVRKLIKTFPLGESIFGGGSKGEVRAVDGVSFDIE |
| Ga0075015_1003048893 | 3300006102 | Watersheds | VALLAVRNLTKIFDLAESSFGGQRAGEVRAVDDVSLDIQ |
| Ga0075015_1008128642 | 3300006102 | Watersheds | LLEVRNLTKIFDLGESSFAGHRGGQVRAVDDVSLDIHEGET |
| Ga0075030_1012147372 | 3300006162 | Watersheds | MPLIEIRNLTKVFPHGESPFGGKARGEVRAVDDVSLDI |
| Ga0070715_103381632 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLVEIRNLTKVFSTGGSMFGARPQGEVRAVDDVSLDI |
| Ga0075018_107433631 | 3300006172 | Watersheds | VALLEIRNLTKVFNLSESAFGTRSRGEVRAVDDVSLDIQQGETL |
| Ga0075014_1001907471 | 3300006174 | Watersheds | VSLVEVRDLTKVFDLAESAFDRRRSGSVRAVDGVSLDIH |
| Ga0070712_1012320632 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLIEARNLTKVYPLGESLFGGRAHGEVRAVDDVSLT |
| Ga0075425_1005488103 | 3300006854 | Populus Rhizosphere | MALVEVRNLSKIFALGESAWGGGATGEVLAVNDVSLDIQQGETLG |
| Ga0075425_1024653702 | 3300006854 | Populus Rhizosphere | MALVEVRNLTKVFPLGESIFGGGAKGEVRAVDDVSLDIAQ |
| Ga0073928_109952661 | 3300006893 | Iron-Sulfur Acid Spring | MALVEIRNLTKVYSQGASPFGGKLRAGAEVRAVDDVSLDIRQGETLG |
| Ga0075426_109246102 | 3300006903 | Populus Rhizosphere | MALVEVRNLSKIFALGESAWGGGATGEVLAVNDVSLDIQQGD |
| Ga0075436_1002263531 | 3300006914 | Populus Rhizosphere | MALVEVRNLSKIFALGESAWGGGATGEVLAVNDVSLDIQQG |
| Ga0099829_104894513 | 3300009038 | Vadose Zone Soil | VPLIEVRNLTKIFELAESPFGSRRVGEVRAVDDVSLDIHE |
| Ga0099830_103074502 | 3300009088 | Vadose Zone Soil | MPPALVEIRNLTKVFPLGESMLGARAKGEVRAVDDISLDIHAGE |
| Ga0099827_113249931 | 3300009090 | Vadose Zone Soil | VALLEVRNLTKIFDLAESPFGSRRVGEVRAVDDVSLDIHEGET |
| Ga0099827_119741641 | 3300009090 | Vadose Zone Soil | MALIEIRNLTKIYSQGKSVLGRTSRVSGEVRAVDD |
| Ga0116222_10187983 | 3300009521 | Peatlands Soil | VPLLEVRNLTKIFDFAESPFGSRRSGEVRAVDDVSLDIQE |
| Ga0105238_103774723 | 3300009551 | Corn Rhizosphere | VALIEVRNLTKIFAHAESPFGGKSRADVRAVDDVSL |
| Ga0116111_10638162 | 3300009616 | Peatland | MALVEVRNLNKIYSQGESPLGAKLSGRNEVRAVDDVSLDIHSGE |
| Ga0116135_11248973 | 3300009665 | Peatland | VPLLEVRNLTKIFDLAESPFGSRRRGSTKVRAVDDVS |
| Ga0116215_11530883 | 3300009672 | Peatlands Soil | MALLEVRGLTKVFPLGESAFSGRAQGEVRAVDGVSLDIAAG |
| Ga0126380_119626152 | 3300010043 | Tropical Forest Soil | MPLIEVRNLTKIYPLGESIFGGRVTGEVRAVDDVSL |
| Ga0134088_101614272 | 3300010304 | Grasslands Soil | VSLIEVQKLSKVFPLGESIFGGSAKGEVRAVDDVSLRI |
| Ga0134088_102409071 | 3300010304 | Grasslands Soil | VALVEVRNLSKIFDMSESAFGRRRGGEVRAVDDVSLDIEPGETL |
| Ga0074044_108312422 | 3300010343 | Bog Forest Soil | MALVEIRNLMKIYPGGGSVLGARFRGAGDVCAVDDVSLDIHSGE |
| Ga0126370_107304262 | 3300010358 | Tropical Forest Soil | VPLLEIRNLTKTFPLGETMFGGAHGEVRAVDDVSLDI |
| Ga0126372_100800421 | 3300010360 | Tropical Forest Soil | VALVDVRNLTKIYPLGESIFGGGARGEVRAVDDVSLTIEA |
| Ga0126372_107323852 | 3300010360 | Tropical Forest Soil | MSLVEVRNLTKIYPLGESIFGGGSKGEVRAVDDVSLS |
| Ga0126381_1002682494 | 3300010376 | Tropical Forest Soil | MAPVTSMPLLEVRNLTKIFGHGDSAFGGRAKGELRAVD |
| Ga0136449_1006352303 | 3300010379 | Peatlands Soil | VPLLEVRNLTKIFDLAESPFGSRRAGEIRAVDDVSFEIQEGE |
| Ga0136449_1013804061 | 3300010379 | Peatlands Soil | VALVEVRNLTKVFDLAESPFGSRRSGEVRAVDDVSI |
| Ga0134124_113396371 | 3300010397 | Terrestrial Soil | VPLLEIRNLTKVFPLGESVFGGGSKGEVCAVDDVSFD |
| Ga0137388_101579191 | 3300012189 | Vadose Zone Soil | MPPALVEIRNLTKVFPLGESMLGTRAKGEVRAADD |
| Ga0137365_109087761 | 3300012201 | Vadose Zone Soil | VALVEVRNLSKIVDMSESAFGRRRGGEVRAVDDVSLDIEPGET |
| Ga0137399_108651421 | 3300012203 | Vadose Zone Soil | MAPALIEIRHLTKVFPLGVSMLGARAKGEVRAVDDVSL |
| Ga0137387_105955912 | 3300012349 | Vadose Zone Soil | VGLIEVRNLTKIFDMSESAFGRRRGGEVRAVDDVSLDIEPG |
| Ga0137387_112810981 | 3300012349 | Vadose Zone Soil | VGLLEIRDLTKVFPLGESAFGGGAKGEVRAVDDVS |
| Ga0137397_103266171 | 3300012685 | Vadose Zone Soil | VALVEVRNLTKIFDMSESAFGRRRGGEVRAVDDVSLDIEPRET |
| Ga0137397_104475162 | 3300012685 | Vadose Zone Soil | VALVEVRNLTKVFDMSESAFGGRSTGEVRAVDDVSLDIEQ |
| Ga0137395_109497361 | 3300012917 | Vadose Zone Soil | VALLKVRNLTKIFDLAGSPFGSRRVGEVRAVVDVSLDIH |
| Ga0137394_109352021 | 3300012922 | Vadose Zone Soil | VALVKVRNLTKIFDMSESAFGRRRSGEVRAVDDVSLDIDEG |
| Ga0137419_115272692 | 3300012925 | Vadose Zone Soil | VALLEVRNLTKIFDLAESPFGSRRVGEIRAVDDVSLD |
| Ga0137416_117271601 | 3300012927 | Vadose Zone Soil | VALVEVRNLTKVFDLRDSAFGGRRTGEVRAVDDVSLDVAEG |
| Ga0137407_113321151 | 3300012930 | Vadose Zone Soil | MNQALIEIRNLTKSFPLGESMLGARAKGEVCAVGDVS |
| Ga0164301_101726051 | 3300012960 | Soil | LVPLLEARNLTKIFAENESPFTGGSKGEIRAVDDVSL |
| Ga0126369_118208672 | 3300012971 | Tropical Forest Soil | VALVEIRHLTKIFPTGQAWRGASEAGVRAVDDVSLDIHAGETL |
| Ga0181539_10507114 | 3300014151 | Bog | VPLLEVRNLTKTFDLADSPFGSHRGGEVRAVDDVSLDIHEGET |
| Ga0075355_10083581 | 3300014322 | Natural And Restored Wetlands | MPLLQARNLCKTFQSGESAFGWGGHREVRAVDDVSLSI |
| Ga0182018_100065981 | 3300014489 | Palsa | VAFIEIRKLTKIFPLGESIFGGGAKGEVRAVDDVSFDIHPG |
| Ga0182016_102571742 | 3300014493 | Bog | MPLVEISNLTKIYSQSESALGGTSRSRNEVRAVDDVSLDIH |
| Ga0182021_137992892 | 3300014502 | Fen | MPLLEIRNLTKVFALGESIFGGGAKGHVRAVDDVSLDI |
| Ga0182030_109787652 | 3300014838 | Bog | VPLLEVRNLTKIFDLAESPFGSRRVGKVRAVDDVSLDI |
| Ga0180063_12716532 | 3300014885 | Soil | MPLVEVRNLTKVFPLGESAWGGGAKGEVRAVDEVSLEI |
| Ga0137411_12204552 | 3300015052 | Vadose Zone Soil | MPLLEIRGLTKVFPQGESIFGGGAKGEVRAVDDVSLDI |
| Ga0137403_109904032 | 3300015264 | Vadose Zone Soil | MPLIEVRNLTKVFPPSESLFERKMRDGEVRAVDDVSLEIHAGE |
| Ga0132255_1006089132 | 3300015374 | Arabidopsis Rhizosphere | MTPALIEIRNLRKGFPPGESMLGSRAPGEVRAVDDVSLDIRA |
| Ga0187818_100802603 | 3300017823 | Freshwater Sediment | VPLVAVRNLTKIFDLAESPFGGRSAGQVRAVDDVFLEI |
| Ga0187856_10189873 | 3300017925 | Peatland | MPLLEVRNLSKIFDLAESPFGSRRAGEVLAVDDVSLDIDEG |
| Ga0187801_102939161 | 3300017933 | Freshwater Sediment | VPLLEIRNLTKVFSHADSALGRKSRGEVRAVDDVSLEIHC |
| Ga0187809_102541371 | 3300017937 | Freshwater Sediment | VPLVEVRNLTKTFAPTESVFGNTSAEVRAVDDVSF |
| Ga0187819_105779281 | 3300017943 | Freshwater Sediment | MALVEVRGLTKIYPLGESAFRGGAHGEVRAVDGVSLDI |
| Ga0187879_103739272 | 3300017946 | Peatland | MPLLEIRNLTKVFPRGESPFGGKSRGEVRAVDEVSLDIQAGE |
| Ga0187879_104090031 | 3300017946 | Peatland | MPLVEIRNLTKVYSRGGSALGGSIKGASQVRAVDDVSL |
| Ga0187783_105031562 | 3300017970 | Tropical Peatland | MALLEIRHLSKTFPWGESVFGGASRGDVRAVDDVSLDI |
| Ga0187781_113024301 | 3300017972 | Tropical Peatland | VALIELRNLTKIFPHAASPLGGEARGREVRAVDDVSLDIHSG |
| Ga0187782_104172882 | 3300017975 | Tropical Peatland | VALIEIRNLTKVFAHGESPFGSRTHGEVRAVDEVSLDIHSG |
| Ga0187884_101199931 | 3300018009 | Peatland | VALVEVRNLTKVFDLAESPFGSRRSGEVRAVDDVSF |
| Ga0187873_11730631 | 3300018013 | Peatland | VPLLEIRSLTKVFPLGESVFGGSAKGEVRAVDNVS |
| Ga0187860_13207131 | 3300018014 | Peatland | VPLLEVRNLTKIFDLAESPFGSRRAGEVHAVDDVSL |
| Ga0187869_100914223 | 3300018030 | Peatland | VPLLEVRNLTRIFDLAESPFGSRRAGEVRAVDDVSLEIQ |
| Ga0187867_106919991 | 3300018033 | Peatland | VPLLEVRNLTKIFDLAESPFGSRRRGSTKVRAVDDVSLD |
| Ga0187883_101809091 | 3300018037 | Peatland | VPLLEVRNLTKIFDLAESPFGSRRPGSTKVRAVDDV |
| Ga0187855_107359971 | 3300018038 | Peatland | MALIEIRNLTKIYPRGESVFGGKLRAGSEVRAVDDVSLDIH |
| Ga0187862_104724901 | 3300018040 | Peatland | VPLLEIRSLTKVFPLGESVFGGSAKGEVRAVDNVSLDI |
| Ga0187871_104829342 | 3300018042 | Peatland | MRGEDGVVALIEVRNLTKVFPLAESSFGGRRAGEVRAVDDVSLDI |
| Ga0187851_104576042 | 3300018046 | Peatland | VPLIQIRNLTKVFDLSESAFGSPSGKGQGQVRAVDDVSLDIEQG |
| Ga0187784_108688952 | 3300018062 | Tropical Peatland | VALVEVRKLTRSFDFAESVFAGRRSGEVRAVDDVSLDIQ |
| Ga0187784_111756551 | 3300018062 | Tropical Peatland | VALIQVRNLTKIFNLSESAFGSGGSGEIRAVDGVSLD |
| Ga0187771_113566811 | 3300018088 | Tropical Peatland | VALIQIRNLTKIFHLSESTFGSRGAADCRREVRAVDDVSLDIQQGETLGLV |
| Ga0187770_101967903 | 3300018090 | Tropical Peatland | MALLEIRNLTKIYPQSESAFAGKPRATNEVRAVDDVSLAIHAGETLG |
| Ga0187770_113703901 | 3300018090 | Tropical Peatland | MRLIEIHNLTKVFPHAESPFGGKPGGEVRAVDDVSFDV |
| Ga0210407_107123261 | 3300020579 | Soil | MMALVEIRNLTKVYSQGASPLGGKPRGRNDVRAVDDVSLDI |
| Ga0210403_103844952 | 3300020580 | Soil | MPLVEVHNLTKVYPLGESIFGGAAHGEVRAVDDVSL |
| Ga0210403_112653842 | 3300020580 | Soil | MALLEIRNLTKIYPQSESAFGGKSGSKNEVRAVDDVSLDIHARE |
| Ga0210401_104177043 | 3300020583 | Soil | MPLVELRNLTKIYPLGESIFGGGAKGEVRAVDNVSLDIAA |
| Ga0210404_105831071 | 3300021088 | Soil | VPLLEVRNLTKVFLLGESIFGGGAKSEVRAVDDVSLDIQS |
| Ga0210396_100182741 | 3300021180 | Soil | MALVEIRNLTKIYSRPESRLTAKLRGAGEVRAVDDVSLDIRAGET |
| Ga0210389_102339521 | 3300021404 | Soil | MALVEVRNLTKIYPQNQSAFGGKSRGSNEIRAVDDVLLDIHAG |
| Ga0210389_115118942 | 3300021404 | Soil | MALIEVRNLTKIFSPTESLFGANARVKANEVRAVDD |
| Ga0210383_108973941 | 3300021407 | Soil | MALVEVRNLTKIYSQGESLLGRKFSDSHEVRAVDDVS |
| Ga0210391_101101203 | 3300021433 | Soil | MALLEVCSLTKVFPLGESVFGGGAKGEVRAVDDISFDIES |
| Ga0210410_112651451 | 3300021479 | Soil | MALLEIRNLTKIYPQSESAFGGKSGSKNEVRAVDDVSLEIH |
| Ga0224544_10318491 | 3300023250 | Soil | MPLVEIRNLTKSFPQSESALGGNSRKSEVRAVDDVSVDIQAGETLG |
| Ga0208935_10285852 | 3300025414 | Peatland | VPLLEVRNLTKIFDLAESPFGSRRRGSTKVRAVDDVSL |
| Ga0208563_11032102 | 3300025501 | Peatland | MALVEIRNLRKIYSPGGSPLGGKPSGRNEVHAVDDVSLDIHAGET |
| Ga0207663_100032111 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLLEVRNLTKIFPHGESPFGGKARGEVRAVDDISL |
| Ga0208531_10131791 | 3300026020 | Rice Paddy Soil | VPLIEIRNLTKVFAHAASAFGGKGGGEVRAVDNVSLDIHAG |
| Ga0207703_111695582 | 3300026035 | Switchgrass Rhizosphere | VALVEIQNLRKVFPLGGSVFAGGANGEVRAVDDVSLDIQAGE |
| Ga0209839_102026801 | 3300026294 | Soil | LALVEIRNLSKNFDLAESPFGSRRSGSVRAVDGVSFDIAANESV |
| Ga0209155_12952451 | 3300026316 | Soil | VSLIEVQKLSKVFPLGESIFGGSAKGEVRAVDDVSLCIE |
| Ga0209375_11918193 | 3300026329 | Soil | MALVEVRKLTKIFPQGESIFGGAAKGEVRAVDDVSLD |
| Ga0209473_11987252 | 3300026330 | Soil | MPLVEVRDLVKVFPAGESIFGRARREVRAVDRVSLDIAGGE |
| Ga0257160_10676702 | 3300026489 | Soil | MPLVEVRNLTKIFHLAESSFGGRRSGEVRAVEDVSLDI |
| Ga0209808_10620454 | 3300026523 | Soil | VSLIEVQKLSKVFPLGESIFGGSAKGEVRAVDDVSLCIES |
| Ga0209004_10656061 | 3300027376 | Forest Soil | VPLLEIRNLTKIFDLSESVFVGTRAGKVRAVDNVSLDIQPG |
| Ga0209332_10872051 | 3300027439 | Forest Soil | MPLVEVRSLTKIFDLAGSSFGGHRSGEVRAVDDVSLDISAGETL |
| Ga0209734_10065093 | 3300027535 | Forest Soil | VPLIEVRNLTKVFVLAESPFGSRVGEIRAVDDVSLDIHE |
| Ga0209115_11396602 | 3300027567 | Forest Soil | MALIEARNLTKVYSQGESVFGAKPRGGNEVRAVDDVSLDI |
| Ga0208043_10575761 | 3300027570 | Peatlands Soil | MPLLEISNLTKVFALGESVFGGGATREVRAVDDVTLDIQSGETL |
| Ga0209733_10613871 | 3300027591 | Forest Soil | VALVEIRDLTKVFPQGESVFSARKGEVRAVDDVSL |
| Ga0209422_10314643 | 3300027629 | Forest Soil | MPLVEVRNLTKIFDLAESSFGGHRSGEVRAADDVSLDISAGE |
| Ga0208565_11519942 | 3300027662 | Peatlands Soil | MALLEVRGLTKVFPLGESAFSGRAQGEVRAVDGVSLDI |
| Ga0209333_11822711 | 3300027676 | Forest Soil | MALALLEVRNLTKIFDIAESPLGGRRPGEVRAVDDVSLEIHA |
| Ga0209167_100803143 | 3300027867 | Surface Soil | MALIEIRNLIKIYPHGESAFGGKSKGRGEVRAVDDVSLDIQ |
| Ga0209380_107923431 | 3300027889 | Soil | MPLIEIRNLTKIYPQSESVFGGTSGSRSEIRAVDDVSLD |
| Ga0209006_109809382 | 3300027908 | Forest Soil | MALLEISQLSKIYPLGESVFGGGAKGEVRAVDDVSFDIQ |
| Ga0209168_100938731 | 3300027986 | Surface Soil | MPLLEIRNLTKVFSGSASPLGGKAKGGVRAVDDVSLD |
| Ga0209526_102596692 | 3300028047 | Forest Soil | LPLVEIRNLTKVFPLGESMLGVRAKGEVCAVDDVSL |
| Ga0302222_101734071 | 3300028798 | Palsa | MPLLEIRNLTKIYPHAESAFGGRAHGEVRAVDAVSFDIH |
| Ga0308309_100967963 | 3300028906 | Soil | MSLVEIRSLTKVFPLGESIFGGGAKGEVRAVDDVSLDIQPG |
| Ga0246001_10334341 | 3300029889 | Peat | LALVQVRNLTKVFAFAESPFSGRRGGEVRAVDDVSLDIHE |
| Ga0302178_101981322 | 3300030013 | Palsa | MALIEARKLTKIYSQGESVFGAKPRGGNEVRAVDDVS |
| Ga0302176_103760622 | 3300030057 | Palsa | VPLVEVSKLTKVFNLAESPFGSHRSGEVRAVDDVSFDI |
| Ga0302194_103247141 | 3300030506 | Bog | MPLVEISNLTKIYSQSESALGGTSRSRNEVRAVDDVSLDIHA |
| Ga0316363_100775611 | 3300030659 | Peatlands Soil | MPLIEIRNLTKTFPHRESLFGTTSEAGVATEVRAVDDVS |
| Ga0265760_100785931 | 3300031090 | Soil | MALVEVRNLTKIYSQGDSLLGRKFSDSHEVRAVDDVSLDIHA |
| Ga0302325_108979853 | 3300031234 | Palsa | MPLVEIRNLTKTFAPGGSLFGAKRAATREVRAVDDVSLDI |
| Ga0310915_102933361 | 3300031573 | Soil | VALVEVRNLTKIYPLGESPFGGQAQGEVRAVDDVSL |
| Ga0307476_107606051 | 3300031715 | Hardwood Forest Soil | VALLEIRNLTKTFPHSESLFGGKSREEVRAVDDVS |
| Ga0307476_110355451 | 3300031715 | Hardwood Forest Soil | VSLLEIRNLTKIFPHAESVFAGKTRGSPYDVRAVDDVSLDIHAGETL |
| Ga0307474_108003872 | 3300031718 | Hardwood Forest Soil | MALLEIRNLTKTYPQSESAFGGKSGSKNEVRAVDDVSLDIHAR |
| Ga0307468_1021427442 | 3300031740 | Hardwood Forest Soil | VALIEIRNLVKVFSLGESVFGTPLKGEVRAVDDVSL |
| Ga0318521_106178451 | 3300031770 | Soil | VALVEVRNLTKIYPLGESPFGGQAQGEVRAVDDVSLTID |
| Ga0307478_104885751 | 3300031823 | Hardwood Forest Soil | MALIEIRNLSKIYPQGDSVLERKLSGQGEVRAVDDVSL |
| Ga0306924_116806092 | 3300032076 | Soil | VSLVEVRDLTKIYPLGESIFAGGASGEVRAVDGVSLDIEA |
| Ga0348332_125332071 | 3300032515 | Plant Litter | MPLVEIRNLTKIYPRAESAFGGKPHSEVRAVDDVSLD |
| Ga0335079_101663044 | 3300032783 | Soil | MALVEVRNLSKSFDFAESAFAGRRGGEVRAVDDVSLDVQQGETL |
| Ga0335079_104420051 | 3300032783 | Soil | MALLEIRNLTKVFPIGESLFGGGAKGEVCAVDNVSL |
| Ga0335081_100636276 | 3300032892 | Soil | VALIEVRNLTKIFPHAASPFGGKTRGGEVRAVDDVSL |
| Ga0335076_116810832 | 3300032955 | Soil | LAVLLEVRNLTKIFPLGESAFGGGSKGEVRAVDDIS |
| Ga0316212_10140751 | 3300033547 | Roots | MSLIEIRNLTKIFPQSDSLFGGGLTNTGVRAVDDVSLDIHAGETL |
| Ga0370515_0051832_3_134 | 3300034163 | Untreated Peat Soil | MALVEVRNLTKVYSRGESALGGKLKGGGEVRAVDDVSLDIFSGE |
| ⦗Top⦘ |