| Basic Information | |
|---|---|
| Family ID | F040882 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 161 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MKRIFAVMTFVVLTLSLAAAQRLPEGARPENYKLTFTPDLEKAKFEGDE |
| Number of Associated Samples | 146 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.76 % |
| % of genes near scaffold ends (potentially truncated) | 99.38 % |
| % of genes from short scaffolds (< 2000 bps) | 92.55 % |
| Associated GOLD sequencing projects | 139 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.273 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.360 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.248 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 33.77% β-sheet: 0.00% Coil/Unstructured: 66.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF01979 | Amidohydro_1 | 81.99 |
| PF13147 | Obsolete Pfam Family | 8.70 |
| PF11026 | DUF2721 | 0.62 |
| PF13366 | PDDEXK_3 | 0.62 |
| PF00873 | ACR_tran | 0.62 |
| PF04014 | MazE_antitoxin | 0.62 |
| PF07969 | Amidohydro_3 | 0.62 |
| PF01175 | Urocanase | 0.62 |
| PF07963 | N_methyl | 0.62 |
| PF00963 | Cohesin | 0.62 |
| PF00331 | Glyco_hydro_10 | 0.62 |
| PF08245 | Mur_ligase_M | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG2987 | Urocanate hydratase | Amino acid transport and metabolism [E] | 0.62 |
| COG3693 | Endo-1,4-beta-xylanase, GH35 family | Carbohydrate transport and metabolism [G] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.27 % |
| Unclassified | root | N/A | 3.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_102518354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 513 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100179977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2001 | Open in IMG/M |
| 3300003368|JGI26340J50214_10141586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 604 | Open in IMG/M |
| 3300004080|Ga0062385_10524596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 735 | Open in IMG/M |
| 3300004082|Ga0062384_100784690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 664 | Open in IMG/M |
| 3300004092|Ga0062389_102197918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 725 | Open in IMG/M |
| 3300004101|Ga0058896_1357851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 863 | Open in IMG/M |
| 3300004101|Ga0058896_1443621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 841 | Open in IMG/M |
| 3300004121|Ga0058882_1678229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 839 | Open in IMG/M |
| 3300005332|Ga0066388_104482143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 711 | Open in IMG/M |
| 3300005436|Ga0070713_100976917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 816 | Open in IMG/M |
| 3300005437|Ga0070710_11153110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 571 | Open in IMG/M |
| 3300005451|Ga0066681_10798534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 570 | Open in IMG/M |
| 3300005533|Ga0070734_10101353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1691 | Open in IMG/M |
| 3300005534|Ga0070735_10533791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 698 | Open in IMG/M |
| 3300005537|Ga0070730_10835820 | Not Available | 579 | Open in IMG/M |
| 3300005541|Ga0070733_10039373 | All Organisms → cellular organisms → Bacteria | 2950 | Open in IMG/M |
| 3300005541|Ga0070733_10116898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1712 | Open in IMG/M |
| 3300005542|Ga0070732_10984147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 516 | Open in IMG/M |
| 3300005764|Ga0066903_101022798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1513 | Open in IMG/M |
| 3300005884|Ga0075291_1017548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 839 | Open in IMG/M |
| 3300005921|Ga0070766_10956977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300006086|Ga0075019_11010551 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300006163|Ga0070715_10710084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300009029|Ga0066793_10514072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300009088|Ga0099830_10216981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1503 | Open in IMG/M |
| 3300009089|Ga0099828_10961465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300009522|Ga0116218_1419662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300009624|Ga0116105_1037445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1076 | Open in IMG/M |
| 3300009683|Ga0116224_10604416 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010358|Ga0126370_11015344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300010379|Ga0136449_102349992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300010396|Ga0134126_11819490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300010397|Ga0134124_12280589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300011120|Ga0150983_10224911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300011120|Ga0150983_12381008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300011120|Ga0150983_13148641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 988 | Open in IMG/M |
| 3300011271|Ga0137393_11352947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300012096|Ga0137389_10773657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300012210|Ga0137378_11696379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300012211|Ga0137377_10527740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1118 | Open in IMG/M |
| 3300012356|Ga0137371_11133874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300012469|Ga0150984_102823068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 844 | Open in IMG/M |
| 3300012683|Ga0137398_10871192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300012927|Ga0137416_11387431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300012927|Ga0137416_12020021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300012929|Ga0137404_10536000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1047 | Open in IMG/M |
| 3300012961|Ga0164302_11394259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300012971|Ga0126369_10132168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2318 | Open in IMG/M |
| 3300013105|Ga0157369_10994490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300014489|Ga0182018_10621530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300014501|Ga0182024_10314992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2060 | Open in IMG/M |
| 3300014501|Ga0182024_11245872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300015264|Ga0137403_10502393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1084 | Open in IMG/M |
| 3300015357|Ga0134072_10216427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300015371|Ga0132258_11429735 | All Organisms → cellular organisms → Bacteria | 1747 | Open in IMG/M |
| 3300016404|Ga0182037_10731780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 849 | Open in IMG/M |
| 3300016422|Ga0182039_11807913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300017823|Ga0187818_10556938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300017943|Ga0187819_10661173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300017948|Ga0187847_10351791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300017955|Ga0187817_10996641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 537 | Open in IMG/M |
| 3300017972|Ga0187781_11399826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300017973|Ga0187780_10271215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1191 | Open in IMG/M |
| 3300017973|Ga0187780_11384030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300017974|Ga0187777_10968853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300017975|Ga0187782_10954482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300017993|Ga0187823_10209437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300018009|Ga0187884_10383468 | Not Available | 565 | Open in IMG/M |
| 3300018024|Ga0187881_10212085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300018037|Ga0187883_10573150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300018043|Ga0187887_10944297 | Not Available | 511 | Open in IMG/M |
| 3300018085|Ga0187772_11192942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300018086|Ga0187769_10714854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
| 3300018086|Ga0187769_10840176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 694 | Open in IMG/M |
| 3300018431|Ga0066655_10728800 | Not Available | 672 | Open in IMG/M |
| 3300020579|Ga0210407_11015620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300020581|Ga0210399_10081706 | All Organisms → cellular organisms → Bacteria | 2627 | Open in IMG/M |
| 3300020582|Ga0210395_10346747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
| 3300020583|Ga0210401_10216805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1772 | Open in IMG/M |
| 3300020583|Ga0210401_11210806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300021170|Ga0210400_10714938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300021401|Ga0210393_11518029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300021402|Ga0210385_10682893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 785 | Open in IMG/M |
| 3300021406|Ga0210386_11166044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300021420|Ga0210394_11431535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300021432|Ga0210384_10638023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
| 3300021433|Ga0210391_10213756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1516 | Open in IMG/M |
| 3300021433|Ga0210391_10578088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300021475|Ga0210392_10652952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300021475|Ga0210392_11489889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300021477|Ga0210398_11538757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300021478|Ga0210402_11457729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300021861|Ga0213853_10913603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300022533|Ga0242662_10178766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300022716|Ga0242673_1015598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1022 | Open in IMG/M |
| 3300023250|Ga0224544_1017801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
| 3300024176|Ga0224565_1007328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1202 | Open in IMG/M |
| 3300025414|Ga0208935_1044554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300025854|Ga0209176_10164324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300025929|Ga0207664_11493855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300025939|Ga0207665_11202207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300025939|Ga0207665_11231271 | Not Available | 597 | Open in IMG/M |
| 3300026078|Ga0207702_12160537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300026490|Ga0257153_1077775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300026527|Ga0209059_1003640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6961 | Open in IMG/M |
| 3300026551|Ga0209648_10241167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1346 | Open in IMG/M |
| 3300026551|Ga0209648_10664022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300026557|Ga0179587_10933771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300027024|Ga0207819_1026487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300027567|Ga0209115_1159735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300027609|Ga0209221_1053423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
| 3300027660|Ga0209736_1032519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1544 | Open in IMG/M |
| 3300027854|Ga0209517_10116537 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
| 3300027855|Ga0209693_10620390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300027857|Ga0209166_10037260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2915 | Open in IMG/M |
| 3300027867|Ga0209167_10338614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300027879|Ga0209169_10691746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300027895|Ga0209624_10631393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 709 | Open in IMG/M |
| 3300027905|Ga0209415_10349849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1231 | Open in IMG/M |
| 3300027908|Ga0209006_10365035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1221 | Open in IMG/M |
| 3300027911|Ga0209698_10688949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300027911|Ga0209698_10901822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300028036|Ga0265355_1023093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300028047|Ga0209526_10251640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1209 | Open in IMG/M |
| 3300028536|Ga0137415_11055668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300028906|Ga0308309_11144490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300029636|Ga0222749_10107499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1317 | Open in IMG/M |
| 3300029701|Ga0222748_1026097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300029913|Ga0311362_10085547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4317 | Open in IMG/M |
| 3300029916|Ga0302148_1244936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300029943|Ga0311340_10016681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9269 | Open in IMG/M |
| 3300029944|Ga0311352_10368070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1183 | Open in IMG/M |
| 3300030011|Ga0302270_10344503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
| 3300030043|Ga0302306_10232298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300030054|Ga0302182_10410294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300030524|Ga0311357_10564599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1051 | Open in IMG/M |
| 3300030706|Ga0310039_10265287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300030707|Ga0310038_10070614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1901 | Open in IMG/M |
| 3300030916|Ga0075386_11330738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300031028|Ga0302180_10657912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300031057|Ga0170834_101260038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300031090|Ga0265760_10167522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300031122|Ga0170822_14072525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300031233|Ga0302307_10487341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300031708|Ga0310686_103511381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7038 | Open in IMG/M |
| 3300031708|Ga0310686_113261240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 901 | Open in IMG/M |
| 3300031718|Ga0307474_11607611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300031754|Ga0307475_10014756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5323 | Open in IMG/M |
| 3300031788|Ga0302319_10239148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2222 | Open in IMG/M |
| 3300031823|Ga0307478_10251209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1437 | Open in IMG/M |
| 3300031890|Ga0306925_11127295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300031938|Ga0308175_100595546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1189 | Open in IMG/M |
| 3300031939|Ga0308174_10564879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 938 | Open in IMG/M |
| 3300031962|Ga0307479_11881294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300032770|Ga0335085_12281969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300032896|Ga0335075_10437008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1371 | Open in IMG/M |
| 3300033545|Ga0316214_1050585 | Not Available | 602 | Open in IMG/M |
| 3300033829|Ga0334854_038026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1155 | Open in IMG/M |
| 3300034065|Ga0334827_138853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300034282|Ga0370492_0378885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.07% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.97% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.97% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.35% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.35% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.11% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.48% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.48% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.48% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.86% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.86% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.24% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.24% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.24% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.24% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.24% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.62% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.62% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.62% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.62% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.62% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.62% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.62% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.62% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.62% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004101 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF228 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005884 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025854 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029916 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1025183542 | 3300000955 | Soil | MKKIFTLVTFIVLALSAAVAQRLPEIARPENYKLTFTPDLENARFEGDEAIAIRVLK |
| JGIcombinedJ26739_1001799773 | 3300002245 | Forest Soil | MKRILTAITFCLLTISLASAQRLPEGSRPENYKLTFTPDLGKATFEGDEV |
| JGI26340J50214_101415862 | 3300003368 | Bog Forest Soil | MKRIVTFIVFVSAAFSLASAQRLPEVATPENYKLTFKPDLEKA |
| Ga0062385_105245961 | 3300004080 | Bog Forest Soil | MKRIFAVVTFLVLTFSLATAQRLPEVARPENYKLTFTPNLETAKFEGDETITIRVLKQTS |
| Ga0062384_1007846901 | 3300004082 | Bog Forest Soil | MKRILTSVLFALTTLSLAAAQRLPEIARPENYKLTFTPDLEKATFQGDETI |
| Ga0062389_1021979182 | 3300004092 | Bog Forest Soil | MKRTLAIISFLTLTLSLATAQRLPEVARPDNYKLTFTPDLDKA |
| Ga0058896_13578511 | 3300004101 | Forest Soil | MKRIFAVMTFFVLTISLAVAQRLPEVARPENYKLTFTPNLDKANFE |
| Ga0058896_14436212 | 3300004101 | Forest Soil | MKKTLVFVIFVLLTLSAATAQRLPEAARPENYKLTFTPDLENAKFEGDETI |
| Ga0058882_16782291 | 3300004121 | Forest Soil | MKRVFAVVVFVCSTLSLCLAQRLPHQASPENYKLTFTPNLEKATFEGDETISIRV |
| Ga0066388_1044821432 | 3300005332 | Tropical Forest Soil | MKRIFALLSFLVLTLSLAVAQRLPEIARPDNYKLTFTPDLDKASFEGDETITLHLM |
| Ga0070713_1009769172 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTTFAAVSILLLTLMPAVAQRLPETARPENYKLTFTPDLENAK |
| Ga0070710_111531102 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRILSVTTFLVFAISMAAAQRLPEVARPENYKLTFTPDLENAKFE |
| Ga0066681_107985342 | 3300005451 | Soil | MKRVFALCAFALVVASLALAQRLPAVARPENYKLTFTPDLDKATFAGDEIIAIR |
| Ga0070734_101013533 | 3300005533 | Surface Soil | MKKNLAVLTFIVLALSLANAQRLPETARPENYKLTF |
| Ga0070735_105337912 | 3300005534 | Surface Soil | MKRTFAVLTFLVLTISMATAQRLPEIARPDNYKLTFTPDLDNAKFDGDETISV |
| Ga0070730_108358202 | 3300005537 | Surface Soil | MKRFLPLSVFVLLLTSLAWAQRLPEGAVPDNYKLTF |
| Ga0070733_100393734 | 3300005541 | Surface Soil | MKRILAVMTFFVLTLSLASAQRLPENVARPENYKLTFMPDL |
| Ga0070733_101168982 | 3300005541 | Surface Soil | MKRIFAVLSFLALTISLAAAQRLPEVARPENYKLTFTPDLENARFEGDETIA |
| Ga0070732_109841472 | 3300005542 | Surface Soil | MKRIFAVATFLVLGLSLASAQRLPETARPENYKLTFTPNLDEANFEG |
| Ga0066903_1010227982 | 3300005764 | Tropical Forest Soil | MKRIFTVVTFLALAISLAAAQRLPENARPENYRLTFTPDLNKAK |
| Ga0075291_10175481 | 3300005884 | Rice Paddy Soil | MKRFFAILTFTALTLSWASAQRLPETARPENYTLTFTPD |
| Ga0070766_109569772 | 3300005921 | Soil | MKRILAVLTFALTAFSLVAAQRLPEVAVPENYKLSFMPDL |
| Ga0075019_110105511 | 3300006086 | Watersheds | MKKIFAALTFVVLTFSTAIAQRLPETARPENYKLTFTLDLENAKFEGDETTAIQVLKPTS |
| Ga0070715_107100841 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRILAILAFMALTFSWAIAQRLPEGIARPQNYNLTFTPDLENAKFEGDETI |
| Ga0066793_105140722 | 3300009029 | Prmafrost Soil | MKRIFAVMTFVVLTLSLAAAQRLPEGARPENYKLTFTPDLEKAKFEGDE |
| Ga0099830_102169811 | 3300009088 | Vadose Zone Soil | MKRILFLLAFVAATLSPAAAQRLPQVAEPENYKLSFTPD |
| Ga0099828_109614651 | 3300009089 | Vadose Zone Soil | MKRTFAVMTFLVLAVSFATAQRLPEVARPENYKLTFTPDLDK |
| Ga0116218_14196621 | 3300009522 | Peatlands Soil | MKRIFAVISFVTLTLSLAGAQRLPEVARPENYKLTFTPDLEKATFEGDETIAIRVLK |
| Ga0116105_10374451 | 3300009624 | Peatland | MKRTLAVLSFFALTISLASAQRLPEIARPENYKLTLTPDL |
| Ga0116224_106044161 | 3300009683 | Peatlands Soil | MRRILAVMTFAALALSLAAAQRLPEVARPENYKLTFTPNLEKATFEGDETIALRVLKPTSEIT |
| Ga0126370_110153441 | 3300010358 | Tropical Forest Soil | MTILVLTLTAAVAQRLPETARPENYKLTFTPDLENAKFEGEETIT |
| Ga0136449_1023499922 | 3300010379 | Peatlands Soil | MKRIFAVMTFLGLTLSLAAAQRLPEVALPENYKLTF |
| Ga0134126_118194902 | 3300010396 | Terrestrial Soil | MKRFFAILTFVVLTLSWASAQRLPESARPENYKLTFTPDLENAKFEGD |
| Ga0134124_122805891 | 3300010397 | Terrestrial Soil | MKRFFAILTFVVLTLSWASAQRLPETVRPENYKLTFTPDL |
| Ga0150983_102249111 | 3300011120 | Forest Soil | MKRILAVLAFALTTLSLAAAQRLPEVAAPENYKLTFTPDLDKATFE |
| Ga0150983_123810081 | 3300011120 | Forest Soil | MKRVFALCAFALVVASLALAQRLPSVARPESYKLTFTPDLDKATFA |
| Ga0150983_131486412 | 3300011120 | Forest Soil | MLFALTALSLAGAQRLPEVARPENYKLTFHPDLEKATFQGDETI |
| Ga0137393_113529471 | 3300011271 | Vadose Zone Soil | MKRTFAVMTFLVLAVSFATAQRLPEVARPENYKLTFTPDLDKAKFEGDETIAIRV |
| Ga0137389_107736571 | 3300012096 | Vadose Zone Soil | MLFVLTFVAFTLSLASAQRLPDVARPENYKLTFTPDL |
| Ga0137378_116963792 | 3300012210 | Vadose Zone Soil | MKKTLAGVIFVLLTLSVAIAQRLPETARPENYKLTFTPDLENAKFEG |
| Ga0137377_105277401 | 3300012211 | Vadose Zone Soil | MKQILALMTFVVLTLPLAAAQRLPEIARPENYKLTFTPD |
| Ga0137371_111338742 | 3300012356 | Vadose Zone Soil | MKRIFAVMSFLALTLSVATAQRLPETARPENYKLNFTPDLESAKFEGEE |
| Ga0150984_1028230681 | 3300012469 | Avena Fatua Rhizosphere | MKKILFVMTFVVLTLSMAAAQRLPETARPENYKLTFPPDLENAKFEGDETIAIQVAK |
| Ga0137398_108711922 | 3300012683 | Vadose Zone Soil | MKQILAILSFTLATFSVAVAQRLPEVASPENYKLTFTPD |
| Ga0137416_113874311 | 3300012927 | Vadose Zone Soil | MKRILAVVAFALTALSLGTAQRLPEVAAPENYKLT |
| Ga0137416_120200211 | 3300012927 | Vadose Zone Soil | MKRILAVLSFALTTLSLAAGQRLPEVAAPENYKLSFTPDLDKAK |
| Ga0137404_105360001 | 3300012929 | Vadose Zone Soil | MKRILAVLTFLVLTISMATAQRLPEGIARPDNYKLKFI |
| Ga0164302_113942591 | 3300012961 | Soil | MKRVLAILAFVALTFSWAIAQRLPAGIARPQNYNLTFTPDLENAKFEGDETITI |
| Ga0126369_101321684 | 3300012971 | Tropical Forest Soil | MKRIFLLVSFIVLSLPAALAQRLPETARPENYNLTFTPDLDSAKFEGDE |
| Ga0157369_109944901 | 3300013105 | Corn Rhizosphere | MKRILAILEFVALTFSWAMAQRLPEGIARPQNYNVTFTPDLQNAKFEGDETI |
| Ga0182018_106215301 | 3300014489 | Palsa | MKRILAVISFAMATFSLAAAQRLPEGAAPENYKLSFTPDLDKAT |
| Ga0182024_103149921 | 3300014501 | Permafrost | MTFFVLSLSLATAQRLPEGARPENYKLMFTPDLDQAKFEGNETIAIRLLK |
| Ga0182024_112458721 | 3300014501 | Permafrost | MKRKFAVMTFFVLSLSLATAQRLPEGARPENYKLMFTPDLDQAKFEGNETIAIRLLK |
| Ga0137403_105023932 | 3300015264 | Vadose Zone Soil | MKRILAVLTFLVLTISMATAQRLPEGIARPDNYKLKFIPDLDKATFE |
| Ga0134072_102164272 | 3300015357 | Grasslands Soil | MKRILAILAFVALAFSWAMAQRLPEGIARPQNYNLTFTPDLENAKFEGDETITIQVL |
| Ga0132258_114297353 | 3300015371 | Arabidopsis Rhizosphere | MKRLLAQLTFLALAISMAAAQRLPEIARPENYKLAFTPDLDAAKFEGDETITVRVRLSS |
| Ga0182037_107317801 | 3300016404 | Soil | MKKIYAVVTFLVLTLSAAMAQRLPETARPENYKLTFTPDLDSAKFSGDETIAV |
| Ga0182039_118079131 | 3300016422 | Soil | MKKMFAVVTLIVLTLPAVAQRLPQTARPENYKLTFTPDL |
| Ga0187818_105569382 | 3300017823 | Freshwater Sediment | MKRVLPVLSFLVLTMTLASAQRLPETARPENYKLTFTP |
| Ga0187819_106611731 | 3300017943 | Freshwater Sediment | MKRIFALLTFLVLTISMAAAQWLPETARPENYKLT |
| Ga0187847_103517912 | 3300017948 | Peatland | MKRILAVLICVLAAFSVAGAQRLPEVARPENYKLTFTPNL |
| Ga0187817_109966412 | 3300017955 | Freshwater Sediment | MKRIFAIMTFFVLTLSLAAAQRLPELARPENYNLAFTPDLDKATFEGDETIA |
| Ga0187781_113998262 | 3300017972 | Tropical Peatland | MSRYFALISFIALTFPAWAQRLPEVAKPDNYKLSFTPDLHTAKFEG |
| Ga0187780_102712152 | 3300017973 | Tropical Peatland | MKQVSAAVTFLVLTLSLAAAQRLPEVARPENYKLTFTPDLEKATFDGDE |
| Ga0187780_113840301 | 3300017973 | Tropical Peatland | MKRIFAALTFLVLTISMAAAQRLPELARPENYKLTFTPDLENAKFEGDETIS |
| Ga0187777_109688532 | 3300017974 | Tropical Peatland | MKQILGATALFTLALSLAVAQRLPEVARPENYKLSFIPHLESATFDGDETIAVQVLKPTS |
| Ga0187782_109544821 | 3300017975 | Tropical Peatland | MKRIFAVVTFLVLAISLAAAQRLPEIARPENYKLTFTPDLENAKFEGD |
| Ga0187823_102094371 | 3300017993 | Freshwater Sediment | MNKVRLTMAFCALTLSGAMAQRLPEIAQPENYKLTFTPDLEKASFDGDETILIR |
| Ga0187884_103834682 | 3300018009 | Peatland | MKRILALLILAPVAFSFVAAQRLPETAAPENYKLTFTPHLE |
| Ga0187881_102120852 | 3300018024 | Peatland | MKRIFALLVFVSAALSLASAQRLPESATPENYKVTF |
| Ga0187883_105731501 | 3300018037 | Peatland | MKRILAVLAFALTTLSLAAAQRLPEVAVPENYKLS |
| Ga0187887_109442972 | 3300018043 | Peatland | MKRILAVLTFALTTLSLAAAQRLPEVAVPENYKLCFTPDLDKATFEGDETVSLRILSPTA |
| Ga0187772_111929421 | 3300018085 | Tropical Peatland | MKRTFALLSFLALTLSLAAAQRLPEVARPDNYKLTFTPDLQRAT |
| Ga0187769_107148542 | 3300018086 | Tropical Peatland | MKRIFAVMTFVVLSHSLTVAQRLPEVARPENYKLTFTPDLEKATFEGDE |
| Ga0187769_108401761 | 3300018086 | Tropical Peatland | MKRIFVLISFTALSLSLAAAQRLPEVARPENYKLIFTPDLEKATFEGDETITI |
| Ga0066655_107288002 | 3300018431 | Grasslands Soil | MKRILVVITFLALALSGASAQRLPEVARPDNYKLTFTPDLEKATFE |
| Ga0210407_110156201 | 3300020579 | Soil | MKRTFAVLTFLVLTISMATAQRLPEIARPDNYKLTFTPDLESAKFEGDETIAIRVLK |
| Ga0210399_100817061 | 3300020581 | Soil | MNRILAVIAFVVLTLSMATAQRLPETARPDNYKLTFTPNLEIA |
| Ga0210395_103467472 | 3300020582 | Soil | MKRILAVLIFASAAFSLAAAQRLPEVATPENYKLVFTPNLEKAT |
| Ga0210401_102168053 | 3300020583 | Soil | MKRILAVLTFALATFSLAAAQRLPEVAAPDAYKLTFTPDLEKATF |
| Ga0210401_112108062 | 3300020583 | Soil | MKRIPVLLTFVLATFTLASAQRLPEVATPENYKLTF |
| Ga0210400_107149381 | 3300021170 | Soil | MKRILALLTFVLATFSGAMAQRLPEVAAPENYKLTFTPDLEKATFEGDETIAIRVLKST |
| Ga0210393_115180292 | 3300021401 | Soil | MKRILRVPTFVLLALSLAAAQRLPEVARPDNYKLTFSPDLDRATFE |
| Ga0210385_106828932 | 3300021402 | Soil | MNRILAVIAFVVLTLSMATAQRLPETARPDNYKLTFTPNLEKANFEGEE |
| Ga0210386_111660442 | 3300021406 | Soil | MKRPLAVIGFVVLTLSLAAAQRLPEIARPDNYKLTFTPDLDKA |
| Ga0210394_114315352 | 3300021420 | Soil | MKRIFAVMTFLVLTLSLAAAQRLPEVARPENYKLTFKPDLEKAKFEGDE |
| Ga0210384_106380232 | 3300021432 | Soil | MNRILAVIAFVVLTLSIATAQRLPETARPDNYKLTFTPNLEK |
| Ga0210391_102137561 | 3300021433 | Soil | MNRILAVIAFVVLTLSMATAQRLPETARPDNYKLTFTPNLEKANFEGEETI |
| Ga0210391_105780882 | 3300021433 | Soil | MKRIFAVMTFFVLTISLAAAQRLPEVARPENYKLTFTPDLDNAQ |
| Ga0210392_106529521 | 3300021475 | Soil | MKRILAVLIFASAAFSLAAAQRLPEVATPENYKLVFTPNLEKATFEGDETISVRIL |
| Ga0210392_114898892 | 3300021475 | Soil | MKRILAISIVAFGAVSMAAAQRLPQVAAPDNYKLTFTPNLEKATFDG |
| Ga0210398_115387571 | 3300021477 | Soil | MKRIFAVMTFLVLALSLAAAQRLPEVARPENYKLTFKPDLEKTKFEGDETISIRV |
| Ga0210402_114577293 | 3300021478 | Soil | MKRILVLLAFVASTLSLAAAQRLPQVATPDNYKLSF |
| Ga0213853_109136032 | 3300021861 | Watersheds | MKRILAALTFLVLTVSPTFAQRLPEVARPDNYKLTF |
| Ga0242662_101787662 | 3300022533 | Soil | MKRIPVLLTFVLATFTLASAQRLPEVATPENYKLTFTPDVEKATFEGDETI |
| Ga0242673_10155981 | 3300022716 | Soil | MKRILTSVLFALTTLSLAGAQRVPEIARPENYKLTFTPD |
| Ga0224544_10178011 | 3300023250 | Soil | MKRSLAVIIFALATFSLAGAQRLSEVARPENYKLSFTPN |
| Ga0224565_10073282 | 3300024176 | Plant Litter | MKRILAVLIFALATFSVAGAQRLPEVSRPENYKLTFSPDLEKAAFEGE |
| Ga0208935_10445541 | 3300025414 | Peatland | MKRILAVLICVLAAFSVAGAQRLPEVARPENYKLTFTPNLETA |
| Ga0209176_101643241 | 3300025854 | Arctic Peat Soil | MKRIFAVTTFLVLTISLAAAQRLPEVARPENYKLAFTPD |
| Ga0207664_114938551 | 3300025929 | Agricultural Soil | MKRILAILAFVALTFSWAMAQRLPEGIARPQNYNVT |
| Ga0207665_112022071 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRILSVTTFLVFAISMAAAQRLPEVARPENYKLTFTPDLENAKFEGD |
| Ga0207665_112312712 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRILAILAFVALTFSWAVAQRLPEGITRPQNYNLTFTPDL |
| Ga0207702_121605372 | 3300026078 | Corn Rhizosphere | MKRFFAILTFSALTLSWASAQRLPETARPENYTLTFTPDLENAKFEGDETI |
| Ga0257153_10777751 | 3300026490 | Soil | MKRTFAVMIFLVLALSFVAAQRLPELARPENYKLTFTPDLDKARFE |
| Ga0209059_10036401 | 3300026527 | Soil | MKRILAILAFVALAFSWAMAQRLPEGIARPQNYNVTFTPDLQNAKFEGDETITIQVLK |
| Ga0209648_102411672 | 3300026551 | Grasslands Soil | MKRIPVLCMFMLAALSWAVAQRLPEIARPENYKLTFTPD |
| Ga0209648_106640222 | 3300026551 | Grasslands Soil | MKRTFAVVTFLVVTLSLAAAQRLPEVARPENYKLTFTPDLDKAKFEG |
| Ga0179587_109337711 | 3300026557 | Vadose Zone Soil | MKRILTVISFFAMTISLASAQRLPEVARPDNYKLKFSPDLD |
| Ga0207819_10264871 | 3300027024 | Tropical Forest Soil | MKRLLAVSTFLVLTFSVANAQRLPETARPENYKLTFAPDL |
| Ga0209115_11597351 | 3300027567 | Forest Soil | MKRILAVLIFALGAFSLAAGQRVPEVAIPENYKLTFTPNLES |
| Ga0209221_10534232 | 3300027609 | Forest Soil | MKKILAVLSFVVTAFSLVAAQRLPEIAVPENYKLTFTPDLEAATFQGD |
| Ga0209736_10325191 | 3300027660 | Forest Soil | MKRILACLTFALITISMAVAQRLPGVAAPENYKLTFTPNLEKATFEG |
| Ga0209517_101165371 | 3300027854 | Peatlands Soil | MKRILAVLFFASTAFFLAAAQRLPEVATPENYKLTFTPNLEKATFA |
| Ga0209693_106203902 | 3300027855 | Soil | MQRILAVISLVLATVSLAAAQRLPEGAAPENYKLSFAPDLD |
| Ga0209166_100372601 | 3300027857 | Surface Soil | MKRMLAVLPFLVLTVSLAAAQRLPETARPENYKLTFTPDLEKAN |
| Ga0209167_103386141 | 3300027867 | Surface Soil | MKRIFAVLTFALIAFSLAAGQRLPEVAAPENYKLSFTP |
| Ga0209169_106917461 | 3300027879 | Soil | MKRILVVMTFVVLTLSLASAQRLPENVARPENYKLTFTPDLDKAKFEGDETITLRMLK |
| Ga0209624_106313932 | 3300027895 | Forest Soil | MNRILAVIASVVLTLSMATAQRLPETARPDNYKLTFTPNLEKANFEGEETISIRVL |
| Ga0209415_103498491 | 3300027905 | Peatlands Soil | MKHIFAVLTFVVLTLSLASAQRLPETARPENYKLTFTPDLDKAKFDGDETIAIR |
| Ga0209006_103650352 | 3300027908 | Forest Soil | MKRILAVVTFVAAALSLAPAQRLPEIATPENYKLTFTPDL |
| Ga0209698_106889491 | 3300027911 | Watersheds | MNKIVGVAIFTLLTLSVAAAQRLPETARPKNYKLTFTPDLENAKF |
| Ga0209698_109018221 | 3300027911 | Watersheds | MKRIFAVVTFVVLTLSLAIAQRLPEVARPENYKLT |
| Ga0265355_10230931 | 3300028036 | Rhizosphere | MKRILAVLIFASVAFSVAAGQRLPEVAVPENYKLILTPNLERATFEGDETISIRILKP |
| Ga0209526_102516401 | 3300028047 | Forest Soil | MKRILTAITFCLLTISLASAQRLPEGSRPENYKLTFTP |
| Ga0137415_110556682 | 3300028536 | Vadose Zone Soil | MKRILAVVAFALTALSLGTAQRLPEVAAPENYKLTFTPDLEKAKFEGDETISM |
| Ga0308309_111444901 | 3300028906 | Soil | MKRILTSMLFALTALSLAGAQRLPDVARPENYKLTFTPDL |
| Ga0222749_101074991 | 3300029636 | Soil | MKRILAVLTFLLTTFSLAAAQRLPEVAAPENYKLTFTPD |
| Ga0222748_10260971 | 3300029701 | Soil | MKRILAIMIFVVSTLSLASAQRLPEIARPENYKLTFTPDLDKARFEGEETIAIRV |
| Ga0311362_100855475 | 3300029913 | Bog | MKRIFAVLICVLASFSAAGAQRLPEVARPENYKLTFTPNLETATFEGDETISIRVL |
| Ga0302148_12449361 | 3300029916 | Bog | MKRIFAVLICVLASFSAAGAQRLPEVARPENYKLTFTPNLETATF |
| Ga0311340_100166819 | 3300029943 | Palsa | MKRFLAVMTFLVLTFSLANAQRLPEVARPDNYKLTFTPNLEAATFEGDETITLH |
| Ga0311352_103680701 | 3300029944 | Palsa | MKRSLAVIIFALATFSLAGAQRLSEVARPENYKLSFTPNLEV |
| Ga0302270_103445031 | 3300030011 | Bog | MKRILAVLAFALTTLYLAAAQRLPEVAVPENYKLSF |
| Ga0302306_102322982 | 3300030043 | Palsa | MKRILTVLAFALTTLSLAAAQRLPEVAVPENYRLSFTPDLD |
| Ga0302182_104102942 | 3300030054 | Palsa | MKRSLAVIIFALATFSLAGAQRLSEVARPENYKLSFTPNLEVATFEGDETISIQV |
| Ga0311357_105645991 | 3300030524 | Palsa | MKRSLAVIIFALATFSLAGAQRLSEVARPENYKLSFTPNLEVATFEGDETISIQVL |
| Ga0310039_102652871 | 3300030706 | Peatlands Soil | MKRIFAVISFVTLTLSLAGAQRLPEVARPENYKLT |
| Ga0310038_100706143 | 3300030707 | Peatlands Soil | MKRIFAIVTFVVLTLSLASAQRLPETARPENYKLTFTPDLDKA |
| Ga0075386_113307382 | 3300030916 | Soil | MKRVFAVLTFLALTISVATAQRLPEIARPDNYKLTFTPDLENAKFEGEE |
| Ga0302180_106579121 | 3300031028 | Palsa | MKRILAVISFALATVSLAAAQRLPEGAAPENYKLSFTPD |
| Ga0170834_1012600382 | 3300031057 | Forest Soil | MKRIFAVMTFLVLTISLAAAQRLPEVARPENYKLTFTPDLEKAKFEGDETI |
| Ga0265760_101675221 | 3300031090 | Soil | MTRIFAVMTFFILSLSLATAQRLPEGARPENYKLMFTPDLGQAKFEGNE |
| Ga0170822_140725252 | 3300031122 | Forest Soil | MKRIFVVLIFAMMTISLAAAQRLPEVATPENYKLTFNPDLE |
| Ga0302307_104873411 | 3300031233 | Palsa | MKRILAVISFALATVSLAAAQRLPEGAAPENYKLSFAP |
| Ga0310686_1035113811 | 3300031708 | Soil | MKRIFAVMTFVVLALSLASAQRLPEVARPDNYKLTFTPDIDKAKFEGDETIT |
| Ga0310686_1132612402 | 3300031708 | Soil | MKRILTSVLFALTTLSLAGAQRLPESARPENYKLTFTPDLEKATFQGDET |
| Ga0307474_116076111 | 3300031718 | Hardwood Forest Soil | MKRILAILTFALTAFSVAAAQRLPEVAAPENYKLTFTPHLEKATFDGDE |
| Ga0307475_100147561 | 3300031754 | Hardwood Forest Soil | MKRSLAILIFALTTFSLANAQRLPEVASPENYKLIFAP |
| Ga0302319_102391481 | 3300031788 | Bog | MKRMLAVLMFALTTLSLATAQRLPEVAVPENYKLSFNPDLDKATFEGDETISIR |
| Ga0307478_102512091 | 3300031823 | Hardwood Forest Soil | MNRIFAGITFLMLTISLAAAQRLPEVARPENYKLTFTPDLDKAKFEGDETIAIRLLK |
| Ga0306925_111272951 | 3300031890 | Soil | MKRILAVMTFLALCISAAVAQRLPEIARPDNYKLTFTPDLENAKFAGDETIS |
| Ga0308175_1005955461 | 3300031938 | Soil | MKRILAVLAFVALTFSWAFAQRLPEGIARPENYKLTFTPDLEN |
| Ga0308174_105648791 | 3300031939 | Soil | MKRILAILAFVALTFSWAMAQRLPEGIARPQNYNVTFTPD |
| Ga0307479_118812942 | 3300031962 | Hardwood Forest Soil | MKRILLMLAFALTTLSLATAQRLPEVAAPENYKLTF |
| Ga0335085_122819691 | 3300032770 | Soil | MKRILAVTIFLVLSLSLASAQRLPEVARPENYKLTFAPDLEKATF |
| Ga0335075_104370081 | 3300032896 | Soil | MKRTLAVLTFVVLTIALASAQRLPEIARPENYKLTFTPDLENAKFEGDEVLTINVL |
| Ga0316214_10505852 | 3300033545 | Roots | MQRFFLSLAFLLAGLSLAAAQRLPEVAASENYKLSFTPDLDKARFEGD |
| Ga0334854_038026_1_123 | 3300033829 | Soil | MKRILAVIAFALTTLSLAAAQRLPEAAVPENYKLSFTPDLD |
| Ga0334827_138853_614_763 | 3300034065 | Soil | MKRIFAGMTFIVLALSLASAQRLPEVARPENYKLTFTPDIDKAKFEGDET |
| Ga0370492_0378885_444_572 | 3300034282 | Untreated Peat Soil | MKRISAILIFVSAAFSVAVAHRLPEVATPENYKLTFTPNLEKA |
| ⦗Top⦘ |