| Basic Information | |
|---|---|
| Family ID | F040850 |
| Family Type | Metagenome |
| Number of Sequences | 161 |
| Average Sequence Length | 41 residues |
| Representative Sequence | FSFDFISFFIEKTQICLNLKLTKVIWNLIKIQVQAKLM |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.14 % |
| % of genes from short scaffolds (< 2000 bps) | 79.50 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (38.509 % of family members) |
| Environment Ontology (ENVO) | Unclassified (70.807 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.925 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF01327 | Pep_deformylase | 10.56 |
| PF00856 | SET | 2.48 |
| PF01416 | PseudoU_synth_1 | 1.86 |
| PF13685 | Fe-ADH_2 | 0.62 |
| PF01523 | PmbA_TldD | 0.62 |
| PF01761 | DHQ_synthase | 0.62 |
| PF12556 | CobS_N | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 10.56 |
| COG0101 | tRNA U38,U39,U40 pseudouridine synthase TruA | Translation, ribosomal structure and biogenesis [J] | 1.86 |
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10080500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1270 | Open in IMG/M |
| 3300000152|LPjun08P12500mDRAFT_c1034626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 739 | Open in IMG/M |
| 3300000158|SI54feb11_100mDRAFT_c1002749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 5043 | Open in IMG/M |
| 3300000159|LPaug08P2610mDRAFT_c1001784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3876 | Open in IMG/M |
| 3300000225|SI34jun09_120mDRAFT_1021105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1779 | Open in IMG/M |
| 3300000226|SI34jun09_135mDRAFT_1005457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 5029 | Open in IMG/M |
| 3300001346|JGI20151J14362_10065157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1460 | Open in IMG/M |
| 3300001347|JGI20156J14371_10109928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 859 | Open in IMG/M |
| 3300001349|JGI20160J14292_10125309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 853 | Open in IMG/M |
| 3300001354|JGI20155J14468_10085769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1156 | Open in IMG/M |
| 3300001354|JGI20155J14468_10098891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1033 | Open in IMG/M |
| 3300001354|JGI20155J14468_10225867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 552 | Open in IMG/M |
| 3300001354|JGI20155J14468_10229154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 546 | Open in IMG/M |
| 3300001355|JGI20158J14315_10040951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2056 | Open in IMG/M |
| 3300001355|JGI20158J14315_10109536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 925 | Open in IMG/M |
| 3300001945|GOS2241_1001598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2403 | Open in IMG/M |
| 3300001945|GOS2241_1034034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1669 | Open in IMG/M |
| 3300001962|GOS2239_1016823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1697 | Open in IMG/M |
| 3300001969|GOS2233_1001678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1739 | Open in IMG/M |
| 3300001971|GOS2215_10125563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1604 | Open in IMG/M |
| 3300003477|nap3_10057698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 884 | Open in IMG/M |
| 3300003478|JGI26238J51125_1009472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2700 | Open in IMG/M |
| 3300004097|Ga0055584_101544230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 688 | Open in IMG/M |
| 3300004278|Ga0066609_10270365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 530 | Open in IMG/M |
| 3300005404|Ga0066856_10494409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 521 | Open in IMG/M |
| 3300005510|Ga0066825_10315901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 575 | Open in IMG/M |
| 3300005523|Ga0066865_10070733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1237 | Open in IMG/M |
| 3300005523|Ga0066865_10157841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 841 | Open in IMG/M |
| 3300005934|Ga0066377_10292884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300005960|Ga0066364_10009254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2893 | Open in IMG/M |
| 3300005960|Ga0066364_10075263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1114 | Open in IMG/M |
| 3300005960|Ga0066364_10341388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 527 | Open in IMG/M |
| 3300005971|Ga0066370_10025717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1728 | Open in IMG/M |
| 3300005971|Ga0066370_10150912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 797 | Open in IMG/M |
| 3300006027|Ga0075462_10099566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 903 | Open in IMG/M |
| 3300006166|Ga0066836_10143564 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1402 | Open in IMG/M |
| 3300006166|Ga0066836_10549075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
| 3300017714|Ga0181412_1026228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1594 | Open in IMG/M |
| 3300017745|Ga0181427_1076412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 821 | Open in IMG/M |
| 3300017758|Ga0181409_1125944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 755 | Open in IMG/M |
| 3300017770|Ga0187217_1021026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2338 | Open in IMG/M |
| 3300017783|Ga0181379_1196554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 707 | Open in IMG/M |
| 3300017818|Ga0181565_10404876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 900 | Open in IMG/M |
| 3300017951|Ga0181577_10220337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1259 | Open in IMG/M |
| 3300017951|Ga0181577_10231954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1221 | Open in IMG/M |
| 3300017967|Ga0181590_10510158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 836 | Open in IMG/M |
| 3300017986|Ga0181569_10248892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1241 | Open in IMG/M |
| 3300018036|Ga0181600_10424019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 642 | Open in IMG/M |
| 3300018041|Ga0181601_10554253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 593 | Open in IMG/M |
| 3300018048|Ga0181606_10185244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1222 | Open in IMG/M |
| 3300018421|Ga0181592_10679688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 689 | Open in IMG/M |
| 3300018426|Ga0181566_10544010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 812 | Open in IMG/M |
| 3300018428|Ga0181568_10991797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 640 | Open in IMG/M |
| 3300018428|Ga0181568_11005326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 634 | Open in IMG/M |
| 3300018876|Ga0181564_10329646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 845 | Open in IMG/M |
| 3300019765|Ga0194024_1088942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 701 | Open in IMG/M |
| 3300020053|Ga0181595_10088819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1542 | Open in IMG/M |
| 3300020056|Ga0181574_10408391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 789 | Open in IMG/M |
| 3300020175|Ga0206124_10147057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 952 | Open in IMG/M |
| 3300020194|Ga0181597_10219200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 906 | Open in IMG/M |
| 3300020247|Ga0211654_1016005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1219 | Open in IMG/M |
| 3300020267|Ga0211648_1002130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 6108 | Open in IMG/M |
| 3300020280|Ga0211591_1058283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 814 | Open in IMG/M |
| 3300020280|Ga0211591_1058435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 812 | Open in IMG/M |
| 3300020282|Ga0211667_1034106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1305 | Open in IMG/M |
| 3300020284|Ga0211649_1002877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2796 | Open in IMG/M |
| 3300020293|Ga0211665_1046779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 763 | Open in IMG/M |
| 3300020293|Ga0211665_1048864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 741 | Open in IMG/M |
| 3300020296|Ga0211474_1017070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1287 | Open in IMG/M |
| 3300020297|Ga0211490_1003250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4381 | Open in IMG/M |
| 3300020346|Ga0211607_1035786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1061 | Open in IMG/M |
| 3300020347|Ga0211504_1063244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 863 | Open in IMG/M |
| 3300020352|Ga0211505_1162216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HIMB1321 | 523 | Open in IMG/M |
| 3300020368|Ga0211674_10033790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1449 | Open in IMG/M |
| 3300020378|Ga0211527_10021970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2190 | Open in IMG/M |
| 3300020385|Ga0211677_10343446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HIMB1321 | 590 | Open in IMG/M |
| 3300020388|Ga0211678_10039234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2290 | Open in IMG/M |
| 3300020388|Ga0211678_10345862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 599 | Open in IMG/M |
| 3300020391|Ga0211675_10062589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1766 | Open in IMG/M |
| 3300020391|Ga0211675_10080006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1522 | Open in IMG/M |
| 3300020391|Ga0211675_10081593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1504 | Open in IMG/M |
| 3300020391|Ga0211675_10109152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1261 | Open in IMG/M |
| 3300020392|Ga0211666_10007970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 5544 | Open in IMG/M |
| 3300020392|Ga0211666_10009453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 4999 | Open in IMG/M |
| 3300020392|Ga0211666_10043325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1958 | Open in IMG/M |
| 3300020400|Ga0211636_10374832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 535 | Open in IMG/M |
| 3300020413|Ga0211516_10202356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 912 | Open in IMG/M |
| 3300020414|Ga0211523_10246244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 737 | Open in IMG/M |
| 3300020420|Ga0211580_10034245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2194 | Open in IMG/M |
| 3300020424|Ga0211620_10063237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1598 | Open in IMG/M |
| 3300020429|Ga0211581_10272288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 689 | Open in IMG/M |
| 3300020429|Ga0211581_10280694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 678 | Open in IMG/M |
| 3300020431|Ga0211554_10019026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4138 | Open in IMG/M |
| 3300020436|Ga0211708_10029403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2092 | Open in IMG/M |
| 3300020437|Ga0211539_10125052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1042 | Open in IMG/M |
| 3300020438|Ga0211576_10019668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 4103 | Open in IMG/M |
| 3300020440|Ga0211518_10180725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1049 | Open in IMG/M |
| 3300020441|Ga0211695_10180838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 738 | Open in IMG/M |
| 3300020442|Ga0211559_10082617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1557 | Open in IMG/M |
| 3300020448|Ga0211638_10010830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3846 | Open in IMG/M |
| 3300020448|Ga0211638_10152070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1050 | Open in IMG/M |
| 3300020448|Ga0211638_10257525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 807 | Open in IMG/M |
| 3300020452|Ga0211545_10187290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 958 | Open in IMG/M |
| 3300020453|Ga0211550_10249053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 833 | Open in IMG/M |
| 3300020454|Ga0211548_10052032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HIMB1321 | 1918 | Open in IMG/M |
| 3300020457|Ga0211643_10077557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1642 | Open in IMG/M |
| 3300020457|Ga0211643_10180051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1040 | Open in IMG/M |
| 3300020463|Ga0211676_10074636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2307 | Open in IMG/M |
| 3300020463|Ga0211676_10168161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1359 | Open in IMG/M |
| 3300020463|Ga0211676_10220278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1132 | Open in IMG/M |
| 3300020463|Ga0211676_10395309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 758 | Open in IMG/M |
| 3300020464|Ga0211694_10222919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 778 | Open in IMG/M |
| 3300020464|Ga0211694_10230631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 765 | Open in IMG/M |
| 3300020465|Ga0211640_10118802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1514 | Open in IMG/M |
| 3300020468|Ga0211475_10154408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1170 | Open in IMG/M |
| 3300020469|Ga0211577_10022887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4857 | Open in IMG/M |
| 3300020473|Ga0211625_10050099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2578 | Open in IMG/M |
| 3300020473|Ga0211625_10109839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HIMB1321 | 1557 | Open in IMG/M |
| 3300020475|Ga0211541_10077916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1645 | Open in IMG/M |
| 3300020475|Ga0211541_10195437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 994 | Open in IMG/M |
| 3300020475|Ga0211541_10408946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 663 | Open in IMG/M |
| 3300021084|Ga0206678_10058463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2058 | Open in IMG/M |
| (restricted) 3300022920|Ga0233426_10218184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 774 | Open in IMG/M |
| 3300022927|Ga0255769_10024465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 4195 | Open in IMG/M |
| (restricted) 3300022931|Ga0233433_10104320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1379 | Open in IMG/M |
| (restricted) 3300022933|Ga0233427_10135727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1139 | Open in IMG/M |
| (restricted) 3300022933|Ga0233427_10309000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 660 | Open in IMG/M |
| 3300023084|Ga0255778_10206368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 974 | Open in IMG/M |
| 3300023119|Ga0255762_10096613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1775 | Open in IMG/M |
| 3300023176|Ga0255772_10386202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 710 | Open in IMG/M |
| 3300023178|Ga0255759_10491906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 721 | Open in IMG/M |
| 3300024236|Ga0228655_1070106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 776 | Open in IMG/M |
| 3300024291|Ga0228660_1038320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 911 | Open in IMG/M |
| 3300025596|Ga0209662_1052480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1065 | Open in IMG/M |
| 3300025665|Ga0209360_1007503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4999 | Open in IMG/M |
| 3300025690|Ga0209505_1086801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 917 | Open in IMG/M |
| 3300025821|Ga0209600_1036951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1762 | Open in IMG/M |
| 3300025830|Ga0209832_1114466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 833 | Open in IMG/M |
| 3300025870|Ga0209666_1197681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 866 | Open in IMG/M |
| 3300025876|Ga0209223_10062826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2193 | Open in IMG/M |
| 3300025890|Ga0209631_10073411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2075 | Open in IMG/M |
| 3300025890|Ga0209631_10421111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 614 | Open in IMG/M |
| 3300025890|Ga0209631_10480026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HIMB1321 | 557 | Open in IMG/M |
| 3300025892|Ga0209630_10063241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2140 | Open in IMG/M |
| 3300025894|Ga0209335_10066231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2051 | Open in IMG/M |
| 3300025897|Ga0209425_10079735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2017 | Open in IMG/M |
| 3300025897|Ga0209425_10176981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HIMB1321 | 1162 | Open in IMG/M |
| 3300026511|Ga0233395_1038161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1491 | Open in IMG/M |
| 3300027553|Ga0208947_1071695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 810 | Open in IMG/M |
| 3300027830|Ga0209359_10483083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 572 | Open in IMG/M |
| 3300028197|Ga0257110_1298945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 581 | Open in IMG/M |
| 3300028414|Ga0228627_1067530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 906 | Open in IMG/M |
| 3300028706|Ga0257115_1019136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2516 | Open in IMG/M |
| 3300031766|Ga0315322_10274035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1160 | Open in IMG/M |
| 3300031851|Ga0315320_10392674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 963 | Open in IMG/M |
| 3300031861|Ga0315319_10039210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2162 | Open in IMG/M |
| 3300032032|Ga0315327_10287560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1032 | Open in IMG/M |
| 3300032073|Ga0315315_10807736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 853 | Open in IMG/M |
| 3300032073|Ga0315315_11383092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 615 | Open in IMG/M |
| 3300032073|Ga0315315_11611385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 558 | Open in IMG/M |
| 3300032360|Ga0315334_10209760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1583 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 38.51% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 13.04% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.18% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 11.18% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 5.59% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 4.97% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.11% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.48% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.48% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.86% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.62% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.62% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.62% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.62% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.62% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.62% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.62% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.62% |
| Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000152 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P12 500m | Environmental | Open in IMG/M |
| 3300000158 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 54 02/08/11 100m | Environmental | Open in IMG/M |
| 3300000159 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 10m | Environmental | Open in IMG/M |
| 3300000225 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 120m | Environmental | Open in IMG/M |
| 3300000226 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 135m | Environmental | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001945 | Marine microbial communities from Galapagos, Equador - GS026 | Environmental | Open in IMG/M |
| 3300001962 | Marine microbial communities from Cocos Island, Costa Rica - GS023 | Environmental | Open in IMG/M |
| 3300001969 | Marine microbial communities from Yucatan Channel, Mexico - GS017 | Environmental | Open in IMG/M |
| 3300001971 | Marine microbial communities from the Sargasso Sea - GS000c | Environmental | Open in IMG/M |
| 3300003477 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 3 | Environmental | Open in IMG/M |
| 3300003478 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004278 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_150m | Environmental | Open in IMG/M |
| 3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
| 3300005510 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300005960 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_A | Environmental | Open in IMG/M |
| 3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020056 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101410AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020247 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962) | Environmental | Open in IMG/M |
| 3300020267 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556026-ERR599108) | Environmental | Open in IMG/M |
| 3300020280 | Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX556044-ERR599114) | Environmental | Open in IMG/M |
| 3300020282 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556074-ERR599169) | Environmental | Open in IMG/M |
| 3300020284 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556128-ERR598952) | Environmental | Open in IMG/M |
| 3300020293 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556092-ERR599063) | Environmental | Open in IMG/M |
| 3300020296 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX556002-ERR599140) | Environmental | Open in IMG/M |
| 3300020297 | Marine microbial communities from Tara Oceans - TARA_B000000437 (ERX555970-ERR598979) | Environmental | Open in IMG/M |
| 3300020346 | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX556057-ERR599069) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
| 3300020368 | Marine microbial communities from Tara Oceans - TARA_B100001027 (ERX556049-ERR599093) | Environmental | Open in IMG/M |
| 3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020391 | Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967) | Environmental | Open in IMG/M |
| 3300020392 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163) | Environmental | Open in IMG/M |
| 3300020400 | Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020424 | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138) | Environmental | Open in IMG/M |
| 3300020429 | Marine microbial communities from Tara Oceans - TARA_B100000614 (ERX556134-ERR599032) | Environmental | Open in IMG/M |
| 3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020441 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020453 | Marine microbial communities from Tara Oceans - TARA_B100001758 (ERX556003-ERR598963) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020464 | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020473 | Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948) | Environmental | Open in IMG/M |
| 3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300022931 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MG | Environmental | Open in IMG/M |
| 3300022933 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MG | Environmental | Open in IMG/M |
| 3300023084 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG | Environmental | Open in IMG/M |
| 3300023119 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
| 3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
| 3300024291 | Seawater microbial communities from Monterey Bay, California, United States - 74D | Environmental | Open in IMG/M |
| 3300025596 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025665 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025690 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes) | Environmental | Open in IMG/M |
| 3300025821 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 (SPAdes) | Environmental | Open in IMG/M |
| 3300025830 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300026511 | Seawater microbial communities from Monterey Bay, California, United States - 27D | Environmental | Open in IMG/M |
| 3300027553 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300028414 | Seawater microbial communities from Monterey Bay, California, United States - 33D | Environmental | Open in IMG/M |
| 3300028706 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_100m | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300031861 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 3416 | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_100805001 | 3300000117 | Marine | FISFFIEKTQICLNLKLINDICNLLKTQVQAKVI* |
| LPjun08P12500mDRAFT_10346261 | 3300000152 | Marine | PIIPTKTKFLFNFISFYIEKTQICLILKLIKSICNLQKKQAQENLLL* |
| SI54feb11_100mDRAFT_10027491 | 3300000158 | Marine | KNTRFSFDFISFFIEKTQICLNLKLTKVICNLIKTQVQAKPISLV* |
| LPaug08P2610mDRAFT_10017847 | 3300000159 | Marine | FISFFIEKTQICLNLKLTKVIWNLIKIQVQVKLM* |
| SI34jun09_120mDRAFT_10211053 | 3300000225 | Marine | PEPIIPKNTRFSFDFISFFIEKTQICLNLKLTKVICNLIKTQVQAKPISLV* |
| SI34jun09_135mDRAFT_10054571 | 3300000226 | Marine | FSFDFISFFIEKTQICLNLKLTKVICNLIKTQVQAKPISLV* |
| JGI20151J14362_100651571 | 3300001346 | Pelagic Marine | SFDFISFFIEKTQICLNLKLTKVICNLIKTQVXGEPIXLX* |
| JGI20156J14371_101099283 | 3300001347 | Pelagic Marine | DFISFFIEKTQICLNLKLTKVIWNLIKIQVQAKLM* |
| JGI20160J14292_101253091 | 3300001349 | Pelagic Marine | DFISFFIEKTQICLNLKLTKVIWNLIKIQVQXXLX* |
| JGI20155J14468_100857693 | 3300001354 | Pelagic Marine | PEPIMPKKTKFSFDFISFCIEKTQICLNLILSKVICKLLKIQVSEKKF* |
| JGI20155J14468_100988915 | 3300001354 | Pelagic Marine | DFITFFIEKTQICLILKLSKFICNLLKKQVQAEVLLE* |
| JGI20155J14468_102258671 | 3300001354 | Pelagic Marine | IIPKNTRFSFDFISFFIEKSQICLNLKLTKAICNLIKTQVWVNQIL* |
| JGI20155J14468_102291543 | 3300001354 | Pelagic Marine | LLDFITFFIEKTQICLILKLSKFICNLLKKQVQPEVLLE* |
| JGI20158J14315_100409511 | 3300001355 | Pelagic Marine | KTRFSFDFISFFIEKTQICLNLKLTKVICNLLKTQVQAKKISLV* |
| JGI20158J14315_101095363 | 3300001355 | Pelagic Marine | FDFISFFIEKTQICLNLKLTKVIWNLIKIQVQXXLX* |
| GOS2241_10015985 | 3300001945 | Marine | PKKTRFFFDFISLNIEKTQICLNLKLTKVICNSTKIQVRAKKV* |
| GOS2241_10340343 | 3300001945 | Marine | FSFDFISLFIEKTQICLNLKLIKSICNLLEKQVIAKV* |
| GOS2239_10168235 | 3300001962 | Marine | PIIPIKTKFFFDFISFFIEKTQICLNLKLIKPICNLQEKQVIAKV* |
| GOS2233_10016782 | 3300001969 | Marine | KTKFFFDFISFFIEKTQICLNLKLIKPICNLQEKQVIAKV* |
| GOS2215_101255633 | 3300001971 | Marine | FISLNIEKTQICLNLKLTKVICNSTKIQVRVKKV* |
| nap3_100576981 | 3300003477 | Estuarine | EPIIPIKTKFFLDFISFFIEKTQICLNLKLIKLICNLQEKQVIAKV* |
| JGI26238J51125_10094721 | 3300003478 | Marine | IPKNTRFSFDFISFFIEKTQICLNLKLTKVICNLIKTQVQAKPISLV* |
| Ga0055584_1015442301 | 3300004097 | Pelagic Marine | SFDFISFFIEKTQICLNLKLSKVIWKLIKIQVQVKLILLE* |
| Ga0066609_102703651 | 3300004278 | Marine | PIIPKNTRFSFDFISFFIEKTQICLNLKLTKVICNLIKTQVQAKPISLV* |
| Ga0066856_104944093 | 3300005404 | Marine | RFSFDFISFFIEKTQICLNLKLTKVIWNLVKIQVQAKLM* |
| Ga0066825_103159011 | 3300005510 | Marine | RFSFDFISFFIEKTQICLNLKLSKVIWNLVKIQVQAKLM* |
| Ga0066865_100707331 | 3300005523 | Marine | EPIIPKKTRFSFDFISFCIEKSQICLNLILTNVICNLQEKQVPAKMLLV* |
| Ga0066865_101578411 | 3300005523 | Marine | PIMPKKTIFPFDFISFFIEKTQICLNLKLTKTICNLLKKQVREPAF* |
| Ga0066377_102928841 | 3300005934 | Marine | PKKTKFSFDFISFCVEKTQICLNLILTNVICNLQEKQVLAKA* |
| Ga0066364_100092545 | 3300005960 | Marine | FDSISFFIEKTQICLNLKILKVICNFIKKQVQEKV* |
| Ga0066364_100752631 | 3300005960 | Marine | VLPDPIIPKKTIFSFDSISFFIEKTQICLNLKILKVICKFIKKQVRDKV* |
| Ga0066364_103413883 | 3300005960 | Marine | FDFISFFIEKTQICLNLKLIKSICNLLEKQVIAKV* |
| Ga0066370_100257171 | 3300005971 | Marine | FPDPIIPKNTIFSFDFISFFIEKTQICLNLKLSKFICNLLKKQVREQAL* |
| Ga0066370_101509121 | 3300005971 | Marine | KTKFSFDFISFFIEKTQICLNLKLIKSICNLQEKQVIAKV* |
| Ga0075462_100995661 | 3300006027 | Aqueous | EPIMPIKTRFFFDFISFFIEKTQICLNLKLINDICNLLKTQVQAKAI* |
| Ga0066836_101435643 | 3300006166 | Marine | FFKFISFFIEKTQICLNLKLINDICNLEKKQVAEVIIFLSRF* |
| Ga0066836_105490753 | 3300006166 | Marine | FFKFISFFIEKTQICLNLKLINDICNLEKKQVAEVIIFL* |
| Ga0181412_10262284 | 3300017714 | Seawater | FFDFISFFIEKTQICLNLKLTKVIWNLIKIQVQAKLM |
| Ga0181427_10764123 | 3300017745 | Seawater | IPKNTIFLLDFIIFFIEKSQICLNLKLTKVICNLIKTQVWVVLIL |
| Ga0181409_11259443 | 3300017758 | Seawater | DFISFFIEKTQICLNLKLTKVICNLLKTQVQAKLVLQEF |
| Ga0187217_10210261 | 3300017770 | Seawater | IIPKNTRFSFDFISFFIEKTQICLNLKLTKVICNLIKTQVQAKSISLL |
| Ga0181379_11965543 | 3300017783 | Seawater | FDFISFSIEKTQICLNLKLTKVICNLIKIQVQAKLISLV |
| Ga0181565_104048763 | 3300017818 | Salt Marsh | RFFFDFISFFIEKTQICLNLKLINDICNLLKTQVQAKAI |
| Ga0181577_102203373 | 3300017951 | Salt Marsh | FFDFISFFIEKTQICLNLKLINDICNLLKTQVQAKAI |
| Ga0181577_102319541 | 3300017951 | Salt Marsh | RFFFDFISLNIEKTQICLNLKLTKVICNSTKIQDQVKKA |
| Ga0181590_105101581 | 3300017967 | Salt Marsh | IMPIKTRFFFDFISFFIEKTQICLNLKLINDICNSLKTQVQAKAI |
| Ga0181569_102488921 | 3300017986 | Salt Marsh | RFFFDFISLNIEKTQICLNLKLTKVICNSTKIQVQVKKV |
| Ga0181600_104240193 | 3300018036 | Salt Marsh | FDFISFFIEKTQICLNLKLTKTICNLLKKQVQEPIL |
| Ga0181601_105542531 | 3300018041 | Salt Marsh | IPKKIRFSFDFISFFIEKTQICLNLKLSKVIWNLVKIQVQAKLM |
| Ga0181606_101852441 | 3300018048 | Salt Marsh | RFSFDFISFFIEKTQICLNLKLSKVIWNLVKIQVQAKLM |
| Ga0181592_106796883 | 3300018421 | Salt Marsh | RFFFDFISLNIEKTQICLNLKLSKVICNSTKIQVQVKKV |
| Ga0181566_105440103 | 3300018426 | Salt Marsh | FISLNIEKTQICLNLKLTKVICNSTKIQVQVKQLKMD |
| Ga0181568_109917971 | 3300018428 | Salt Marsh | RFFFDFISFFIEKTQICLNLKLINDICNLLKIQVQAKAI |
| Ga0181568_110053263 | 3300018428 | Salt Marsh | FFDFISFFIEKTQICLNLKLIKDICNSLKIQVQEKAI |
| Ga0181564_103296461 | 3300018876 | Salt Marsh | KTIFFLDFITFFIEKTQICLILKLSKFICNLLKKQVQAKVSLDWLQK |
| Ga0194024_10889421 | 3300019765 | Freshwater | PIKTRFFFDFISFFIEKTQICLNLKLINDICNLLKTQVQAKAI |
| Ga0181595_100888193 | 3300020053 | Salt Marsh | TRFFFDFISFFIEKTQICLNLKLINDICNLLKTQVQAKAI |
| Ga0181574_104083911 | 3300020056 | Salt Marsh | IPRKTRFFFDFISLNIEKTQICLNLKLSKVICNSTKIQVQVKKV |
| Ga0206124_101470573 | 3300020175 | Seawater | IPKKTIFFPDFITFFIEKTQICLILKLSKFICNLLKKQVQAEVLLE |
| Ga0181597_102192003 | 3300020194 | Salt Marsh | ISFFIEKTQICLNLKLTKVICNLIKIQVQAEPISLQ |
| Ga0211654_10160051 | 3300020247 | Marine | DFISFFIEKTQICLNLKLSKVIWNLIKIQVQAKLT |
| Ga0211648_10021309 | 3300020267 | Marine | DFISFFIEKTQICLNLKLSKVIWNLVKTQVQVKLI |
| Ga0211591_10582831 | 3300020280 | Marine | TKFFFDFISFFIEKTQICLNLKLIKSICNLLEKQVIAKV |
| Ga0211591_10584351 | 3300020280 | Marine | KKTRFSFDFIILFIEKTQICLILKLTKTIWNLLKKQV |
| Ga0211667_10341061 | 3300020282 | Marine | TIFSFDSISFFIEKTQICLNLKILKVICNFIKKQVQEKV |
| Ga0211649_10028775 | 3300020284 | Marine | DFISFFIEKTQICLNLKLSKVIWNLVKIQVQAKLM |
| Ga0211665_10467793 | 3300020293 | Marine | PIIPKKTIFSFDSISFFIEKTQICLNLKILKVICNFIKKQVQEKV |
| Ga0211665_10488641 | 3300020293 | Marine | FDFISFFIEKTQICLNLKLIKPICNLQEKQVIAKV |
| Ga0211474_10170703 | 3300020296 | Marine | DFISFFIEKTQICLNLKLSKVICNLLKTQVQAKLVLQEL |
| Ga0211490_10032501 | 3300020297 | Marine | PEPIIPKKIRFFFDFISLNIEKTQICLNLKLTKVICNSTKIQVRAKKV |
| Ga0211607_10357863 | 3300020346 | Marine | FDFISFFIEKTQICLNLKLIKSICNLQEKQVIAKV |
| Ga0211504_10632441 | 3300020347 | Marine | IPKNTRFSFDFISFFIEKSQICLNLKLTKVICNLIKTQVWVVLIL |
| Ga0211505_11622163 | 3300020352 | Marine | FITFFIEKTQICLNLKLFKFICNLLKKQVQAEVLLE |
| Ga0211674_100337901 | 3300020368 | Marine | FDSISFFIEKTQICLNLKILKVICNFIKKQVQEKV |
| Ga0211527_100219701 | 3300020378 | Marine | SFDFISFYIEKTQICLNLILTKVICNLSEKQVLAKELSV |
| Ga0211677_103434463 | 3300020385 | Marine | ITFFIEKTQICLILKLSKFICNLLKKQVQAEVLLE |
| Ga0211678_100392344 | 3300020388 | Marine | FDFISFFIEKTQICLNLKLTKVIWNSVKIQVQVKLILLD |
| Ga0211678_103458621 | 3300020388 | Marine | FDFISFFIEKTQICLNLKLTKVICNLIKTQVQAKSISLL |
| Ga0211675_100625893 | 3300020391 | Marine | PEPIIPIKTKFSFDFISFFIEKTQICLNLKLLKLICNLQEKQVIAKV |
| Ga0211675_100800061 | 3300020391 | Marine | TIFSFDFISFYIEKTQICLNLKLIKFICNLQEKQVLAKAY |
| Ga0211675_100815931 | 3300020391 | Marine | FDFISFFIEKTQICLNLKLIKSICNLLEKQVIAKV |
| Ga0211675_101091523 | 3300020391 | Marine | KNTRFSFDFISFFIEKTQICLNLKLTKVICNLLKTQVQVELV |
| Ga0211666_100079701 | 3300020392 | Marine | PKKTIFSFDSISFFIEKTQICLNLKILKVICNFIKKQVQEKV |
| Ga0211666_100094531 | 3300020392 | Marine | IPIKTKFSFDFISFFIEKTQICLILKLFKSICNLREKQVIAKV |
| Ga0211666_100433251 | 3300020392 | Marine | PIIPIKTKFSFDFISFFIEKTQICLNLKLIKSICNLLEKQVIAKV |
| Ga0211636_103748323 | 3300020400 | Marine | FDSISFFIEKTQICLNLKLLKVICNYIKKQVQEKV |
| Ga0211516_102023562 | 3300020413 | Marine | SFDFISFYIEKTQICLNLKLFKFICNLQEKQVLAKVY |
| Ga0211523_102462443 | 3300020414 | Marine | TKFFLDFISFFIEKTQICLNLKLIKPICNLQEKQVIAKV |
| Ga0211580_100342454 | 3300020420 | Marine | PKKTIFSFDSICFFIEKTQICLNLKILKVICKFIKKQVQDKV |
| Ga0211620_100632373 | 3300020424 | Marine | LVLPDPIMPKKTIFPFDSISFFIEKTQICLNLKIFKFICNFIKKQVQEKVYLL |
| Ga0211581_102722881 | 3300020429 | Marine | PKNTKFSFDFISFFIEKTQICLILKLSKSICNLREKQVLAKA |
| Ga0211581_102806941 | 3300020429 | Marine | TIFPFDSISFFIEKTQICLNLKLTKTICNLLKKQVQQEIL |
| Ga0211554_100190266 | 3300020431 | Marine | FDFISFFIEKTQICLNLKLTKVIWNLIKIQVQAKLM |
| Ga0211708_100294033 | 3300020436 | Marine | KKTKLSFDFISFCIEKTQICLNLKLSKIICNLLKKQVSEKVY |
| Ga0211539_101250523 | 3300020437 | Marine | KNTIFSFDFISFFIEKTQICLNLKLSKFICNLLKKQVREQAL |
| Ga0211576_100196686 | 3300020438 | Marine | RFSFDFIIFFIEKTQICLNLKLTKTICNLLKKQVQEAKL |
| Ga0211518_101807251 | 3300020440 | Marine | TKFFFDFISFFIEKTQICLNLKLIKSICNLREKQVIAKV |
| Ga0211695_101808381 | 3300020441 | Marine | FDFISLNIEKTQICLNLKLSKVICNSTKIQVQAKKV |
| Ga0211559_100826171 | 3300020442 | Marine | DSISFFIEKTQICLNLKLSKFICNLLKKQVREQAL |
| Ga0211638_100108301 | 3300020448 | Marine | PEPIIPIKTKFSFDFISFFIEKTQICLNLKLIKSICNLQEKQVIAKV |
| Ga0211638_101520701 | 3300020448 | Marine | TKFFFDFISFFIEKTQICLNLKLIKSICNLQEKQVIAKV |
| Ga0211638_102575253 | 3300020448 | Marine | RFSFDFISFFIEKTQICLNLKLSKVICNLLKTQVQAKLVLQES |
| Ga0211545_101872903 | 3300020452 | Marine | KNTRFSFDFISFFIEKTQICLNLKLFKVICNLLKTQVQAKLVLQES |
| Ga0211550_102490533 | 3300020453 | Marine | RFSFDFISFFIEKTQICLNLKLSKVICNLLKTQVQAKLVLQEL |
| Ga0211548_100520323 | 3300020454 | Marine | PIMPKKTRFSFDFISFYIEKTQICLNLKLFKSICNLQEKQVIAKVF |
| Ga0211643_100775573 | 3300020457 | Marine | DFISFFIEKTQICLNLKLTKVICNLTKIQVWVDLILWA |
| Ga0211643_101800511 | 3300020457 | Marine | PIKTKFFFDFISFCIEKTQICLNLNLFKVICNLLEKQVQER |
| Ga0211676_100746361 | 3300020463 | Marine | DPIIPKKTRFSFDFISFFIEKTQICLNLKLTKVIWNSVKIQVQVKLILLD |
| Ga0211676_101681611 | 3300020463 | Marine | KNTRFSFNFISFFIEKTQICLNLKLTKVICNLLKIQVQAKLVLWD |
| Ga0211676_102202781 | 3300020463 | Marine | FDFISFFIEKTQICLNLKLSKVIWNLVKIQVQAKLM |
| Ga0211676_103953091 | 3300020463 | Marine | IKTKFFFDFISFFIEKTQICLNLKLFKSICNLQEKQVIAKV |
| Ga0211694_102229193 | 3300020464 | Marine | DFISFSIEKTQICLNLKLTNVICNLLKKQVQAKVLLD |
| Ga0211694_102306311 | 3300020464 | Marine | KKTRFFFDFISLNIEKTQICLNLKLSKVICNSTKIQVQAKKV |
| Ga0211640_101188021 | 3300020465 | Marine | TRFFFDFISLNIEKTQICLNLKLTKVICNSTKIQVQVKKV |
| Ga0211475_101544083 | 3300020468 | Marine | KKTIFSFDFISFYIEKTQICLNLKLFKFICNLQEKQVLAKVY |
| Ga0211577_100228878 | 3300020469 | Marine | TKFSFDFISFFIEKTQICLNLKLTKLICNLQEKQV |
| Ga0211625_100500991 | 3300020473 | Marine | EPIIPINTKLLSDFISFYLEKTQICLNLKLSKVICNFTKKQGLALYLA |
| Ga0211625_101098391 | 3300020473 | Marine | DFISFFIEKTQICLNLKLTKTICNLLKKQVREQIFLN |
| Ga0211541_100779161 | 3300020475 | Marine | EPIIPKKTRFFFDFISLNIEKTQICLNLKLTKVICNSTKIQVRAKKI |
| Ga0211541_101954371 | 3300020475 | Marine | PKKTSFSFNFISFFIEKTQICLNLKLTKTICNLLKKQVREQIFSL |
| Ga0211541_104089461 | 3300020475 | Marine | FFDFISFFIEKSQICLNLKLSKVICNLQKKQVQEKLISLV |
| Ga0206678_100584631 | 3300021084 | Seawater | FSFDFISFFIEKTQICLNLKLTKVIWNLIKIQVQAKLM |
| (restricted) Ga0233426_102181843 | 3300022920 | Seawater | FPDPIIPKNTRFSFDFISFSIEKTQICLNLKLTKVICNLIKIQV |
| Ga0255769_100244651 | 3300022927 | Salt Marsh | FFFDFISFFIEKTQICLNLKLINDICNLLKTQVQAKAI |
| (restricted) Ga0233433_101043201 | 3300022931 | Seawater | FDFISFFIEKTQICLNLKLTKVICNLIKIQVQAKQILLK |
| (restricted) Ga0233427_101357271 | 3300022933 | Seawater | IPKKTRFSFDFISFFIEKTQICLNLKLTKVICNLIKIQVQAKQILLK |
| (restricted) Ga0233427_103090003 | 3300022933 | Seawater | SFFIEKTQICLNLKLTKVICNLLKKQVQEPALLDWQ |
| Ga0255778_102063681 | 3300023084 | Salt Marsh | TSFFFDFISFFIEKTQICLNLKLINDICNLLKTQVQAKAI |
| Ga0255762_100966131 | 3300023119 | Salt Marsh | FDFISFFIEKTQICLNLKLINDICNLLKTQVQAKAI |
| Ga0255772_103862021 | 3300023176 | Salt Marsh | IIPKKTRFFFDFISLNIEKTQICLNLKLTKVICNSTKIQVQVKKV |
| Ga0255759_104919061 | 3300023178 | Salt Marsh | TRFFFDFISFFIEKTQICLNLKLINDICNLLKIQVQAKAI |
| Ga0228655_10701063 | 3300024236 | Seawater | TRFFFDFISFFIEKTQICLNLKLTKVIWNLIKIQVQAKLM |
| Ga0228660_10383201 | 3300024291 | Seawater | IPKNTRFFFDFISFFIEKSQICLNLKLTKVICNLIKTQVWVVLIL |
| Ga0209662_10524803 | 3300025596 | Marine | RFSFDFISFFIEKTQICLNLKLTKVICNLIKTQVQAKPISLV |
| Ga0209360_10075031 | 3300025665 | Marine | FDFISFFIEKTQICLNLKLTKVICNLIKTQVQAKPISLV |
| Ga0209505_10868011 | 3300025690 | Pelagic Marine | KKTIFFPDFITFFIEKTQICLILKLSKFICNLLKKQVQAEVLLE |
| Ga0209600_10369511 | 3300025821 | Pelagic Marine | DFISFFIEKTQICLNLKLSKVIWKLIKIQVQVKLILLE |
| Ga0209832_11144663 | 3300025830 | Pelagic Marine | IFLLDFITFFIEKTQICLILKLSKFICNLLKKQVQAEVLLE |
| Ga0209666_11976813 | 3300025870 | Marine | KKTRFSFDFISFFIEKTQICLNLKLSKVIWKLIKIQVQVKLILLE |
| Ga0209223_100628261 | 3300025876 | Pelagic Marine | IIPKNIRFSFDFISFFIEKTQICLNLKLTKVICNLLKIQVQAKLISLL |
| Ga0209631_100734113 | 3300025890 | Pelagic Marine | PTKTRFSFDFISFFIEKTQICLNLKLTKVICNLLKTQVQAKKISLV |
| Ga0209631_104211111 | 3300025890 | Pelagic Marine | SFDFISFFIEKTQICLNLKLTKVICNLIKTQVWVNLIL |
| Ga0209631_104800263 | 3300025890 | Pelagic Marine | LLDFITFFIEKTQICLILKLSKFICNLLKKQVQPEVLLE |
| Ga0209630_100632414 | 3300025892 | Pelagic Marine | IIPKNTRFSFDFISFFIEKSQICLNLKLTKVICNLIKIQVWGALIL |
| Ga0209335_100662311 | 3300025894 | Pelagic Marine | SFDFISFFIEKTQICLNLKLTKVICNSIKIQVQAEPIS |
| Ga0209425_100797351 | 3300025897 | Pelagic Marine | FDFISFFIEKTQICLNLKLTKVICNLIKTQVQAKSIL |
| Ga0209425_101769811 | 3300025897 | Pelagic Marine | DLPEPIMPKKTKFSFDFISFCIEKTQICLNLILSKVICKLLKIQVSEKKF |
| Ga0233395_10381611 | 3300026511 | Seawater | PKNTRFSFDFISFFIEKSQICLNLKLTKVICNLIKTQVWVVLIL |
| Ga0208947_10716953 | 3300027553 | Marine | PKNTRFSFDFISFFIEKTQICLNLKLTKVICNLIKTQVQAKPISLV |
| Ga0209359_104830833 | 3300027830 | Marine | SFSIEKTQICLNLKLTKVICNLIKIQVQAKPISLV |
| Ga0257110_12989453 | 3300028197 | Marine | SFDSISFSIEKTQICLNLKLTKVICNLIKIQVQAKPISLV |
| Ga0228627_10675301 | 3300028414 | Seawater | DPIIPKNTRFSFDFISFSIEKTQICLNLKLTKVICNLIKIQVQAKPISLV |
| Ga0257115_10191364 | 3300028706 | Marine | ISFFIEKSQICLNLKLTKVICNLIKTQVQVKLISWD |
| Ga0315322_102740351 | 3300031766 | Seawater | RFSFDFISFSIEKTQICLNLKLTKVICNLIKIQVQAKLISLV |
| Ga0315320_103926743 | 3300031851 | Seawater | IPKNTRFSFDFISFSIEKTQICLNLKLTKVICNLIKIQVQAKLISLV |
| Ga0315319_100392104 | 3300031861 | Seawater | IPIKIRFFFDFISFFIEKTQICLNLKLLNDICNFKKIQVLANLMFL |
| Ga0315327_102875603 | 3300032032 | Seawater | TRFSFDFISFFIEKTQICLNLKLTKVICNLIKTQVQAKPISLV |
| Ga0315315_108077363 | 3300032073 | Seawater | DPIIPKKTRFSFDFISFGIEKTQICLNLKLSKIICNLLKKQVSGKVY |
| Ga0315315_113830921 | 3300032073 | Seawater | LPDPIIPKKTRFLFNFISFFIEKTQICLNLKILNDICNLLKKQEQADLIY |
| Ga0315315_116113853 | 3300032073 | Seawater | FDFISFFIEKTQICLNLKLTKVICNSIKIQVQAEAISLA |
| Ga0315334_102097603 | 3300032360 | Seawater | IPIKIRFFFDFISFFIEKTQICLNLKLLNDICNFKEIQVLANLMFL |
| ⦗Top⦘ |