| Basic Information | |
|---|---|
| Family ID | F040830 |
| Family Type | Metagenome |
| Number of Sequences | 161 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VHFGIFVEEMRQGASQAGAFRDIFELADRAEAWGVDCVWLGE |
| Number of Associated Samples | 137 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 59.01 % |
| % of genes near scaffold ends (potentially truncated) | 98.14 % |
| % of genes from short scaffolds (< 2000 bps) | 93.17 % |
| Associated GOLD sequencing projects | 133 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.366 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.907 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.540 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.720 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.57% β-sheet: 0.00% Coil/Unstructured: 61.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF00676 | E1_dh | 18.63 |
| PF00496 | SBP_bac_5 | 10.56 |
| PF13533 | Biotin_lipoyl_2 | 8.07 |
| PF01522 | Polysacc_deac_1 | 6.21 |
| PF00296 | Bac_luciferase | 6.21 |
| PF08352 | oligo_HPY | 3.11 |
| PF04226 | Transgly_assoc | 2.48 |
| PF03328 | HpcH_HpaI | 2.48 |
| PF09347 | DUF1989 | 2.48 |
| PF00106 | adh_short | 1.86 |
| PF00248 | Aldo_ket_red | 1.24 |
| PF01266 | DAO | 1.24 |
| PF00529 | CusB_dom_1 | 1.24 |
| PF07687 | M20_dimer | 1.24 |
| PF02780 | Transketolase_C | 1.24 |
| PF02515 | CoA_transf_3 | 0.62 |
| PF12867 | DinB_2 | 0.62 |
| PF04366 | Ysc84 | 0.62 |
| PF07690 | MFS_1 | 0.62 |
| PF03171 | 2OG-FeII_Oxy | 0.62 |
| PF00753 | Lactamase_B | 0.62 |
| PF01547 | SBP_bac_1 | 0.62 |
| PF01894 | UPF0047 | 0.62 |
| PF01594 | AI-2E_transport | 0.62 |
| PF03992 | ABM | 0.62 |
| PF13360 | PQQ_2 | 0.62 |
| PF05721 | PhyH | 0.62 |
| PF08028 | Acyl-CoA_dh_2 | 0.62 |
| PF13561 | adh_short_C2 | 0.62 |
| PF13458 | Peripla_BP_6 | 0.62 |
| PF13408 | Zn_ribbon_recom | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 18.63 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 18.63 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 6.21 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 6.21 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 2.48 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 2.48 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 2.48 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 2.48 |
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.62 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.62 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.62 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.62 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.62 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.37 % |
| Unclassified | root | N/A | 18.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c1040882 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 2228664022|INPgaii200_c1150781 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300000550|F24TB_10476470 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300000559|F14TC_100204429 | All Organisms → cellular organisms → Bacteria | 2510 | Open in IMG/M |
| 3300001431|F14TB_100870221 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300001431|F14TB_103066917 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300001661|JGI12053J15887_10254814 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300004009|Ga0055437_10093754 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300004479|Ga0062595_101026622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 712 | Open in IMG/M |
| 3300005289|Ga0065704_10217983 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300005294|Ga0065705_11024223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. YR681 | 541 | Open in IMG/M |
| 3300005332|Ga0066388_100352638 | All Organisms → cellular organisms → Bacteria | 2118 | Open in IMG/M |
| 3300005332|Ga0066388_107780931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300005347|Ga0070668_100941387 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300005440|Ga0070705_100023620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3305 | Open in IMG/M |
| 3300005446|Ga0066686_10850515 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005450|Ga0066682_10155217 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300005459|Ga0068867_101759138 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005467|Ga0070706_101534084 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005468|Ga0070707_100398450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1336 | Open in IMG/M |
| 3300005518|Ga0070699_100352389 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1326 | Open in IMG/M |
| 3300005518|Ga0070699_101527871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 612 | Open in IMG/M |
| 3300005546|Ga0070696_100578754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 903 | Open in IMG/M |
| 3300005549|Ga0070704_101948849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
| 3300005569|Ga0066705_10647747 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 642 | Open in IMG/M |
| 3300005575|Ga0066702_10917473 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 523 | Open in IMG/M |
| 3300005615|Ga0070702_101432450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
| 3300005719|Ga0068861_100328305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1334 | Open in IMG/M |
| 3300005764|Ga0066903_106035579 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005842|Ga0068858_102477710 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| 3300005843|Ga0068860_101707618 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300006031|Ga0066651_10505713 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300006031|Ga0066651_10784579 | Not Available | 516 | Open in IMG/M |
| 3300006172|Ga0075018_10455220 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300006797|Ga0066659_10726767 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300006804|Ga0079221_11075844 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 612 | Open in IMG/M |
| 3300006845|Ga0075421_102078358 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300006845|Ga0075421_102096137 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300006852|Ga0075433_10590198 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300006854|Ga0075425_101124940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 894 | Open in IMG/M |
| 3300006854|Ga0075425_101277844 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300006854|Ga0075425_102404252 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300006871|Ga0075434_101776904 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300006871|Ga0075434_101970932 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300006880|Ga0075429_100939411 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300006903|Ga0075426_10115749 | All Organisms → cellular organisms → Bacteria | 1925 | Open in IMG/M |
| 3300006904|Ga0075424_101998712 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300007004|Ga0079218_13705420 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300007076|Ga0075435_101455895 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300009012|Ga0066710_104402082 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300009088|Ga0099830_10400161 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1110 | Open in IMG/M |
| 3300009089|Ga0099828_10143056 | All Organisms → cellular organisms → Bacteria | 2107 | Open in IMG/M |
| 3300009089|Ga0099828_11752655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 546 | Open in IMG/M |
| 3300009100|Ga0075418_12524272 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300009147|Ga0114129_10045174 | All Organisms → cellular organisms → Bacteria | 6193 | Open in IMG/M |
| 3300009147|Ga0114129_11102390 | Not Available | 994 | Open in IMG/M |
| 3300009148|Ga0105243_12428156 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 563 | Open in IMG/M |
| 3300009156|Ga0111538_12373471 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300009792|Ga0126374_11593802 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
| 3300010047|Ga0126382_10658716 | Not Available | 871 | Open in IMG/M |
| 3300010047|Ga0126382_11501750 | Not Available | 620 | Open in IMG/M |
| 3300010047|Ga0126382_12523471 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
| 3300010321|Ga0134067_10150102 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300010335|Ga0134063_10506272 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 605 | Open in IMG/M |
| 3300010337|Ga0134062_10055551 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1622 | Open in IMG/M |
| 3300010358|Ga0126370_11728220 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300010362|Ga0126377_10305991 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300010362|Ga0126377_12229892 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300010362|Ga0126377_12466388 | Not Available | 596 | Open in IMG/M |
| 3300010366|Ga0126379_11430693 | Not Available | 797 | Open in IMG/M |
| 3300010376|Ga0126381_102008934 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300010398|Ga0126383_10187771 | Not Available | 1971 | Open in IMG/M |
| 3300010398|Ga0126383_10351184 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300010398|Ga0126383_12553650 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300010399|Ga0134127_11030822 | Not Available | 884 | Open in IMG/M |
| 3300010400|Ga0134122_10583883 | Not Available | 1029 | Open in IMG/M |
| 3300010401|Ga0134121_10338320 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_68_15 | 1343 | Open in IMG/M |
| 3300011269|Ga0137392_11331128 | Not Available | 577 | Open in IMG/M |
| 3300011271|Ga0137393_10245871 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
| 3300012202|Ga0137363_10202014 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1595 | Open in IMG/M |
| 3300012202|Ga0137363_10280837 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1362 | Open in IMG/M |
| 3300012203|Ga0137399_10506056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1013 | Open in IMG/M |
| 3300012205|Ga0137362_10226653 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1612 | Open in IMG/M |
| 3300012207|Ga0137381_10365919 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1257 | Open in IMG/M |
| 3300012211|Ga0137377_11258566 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300012353|Ga0137367_10580034 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300012358|Ga0137368_10860504 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300012360|Ga0137375_11284912 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300012363|Ga0137390_10516041 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300012363|Ga0137390_10599654 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1069 | Open in IMG/M |
| 3300012363|Ga0137390_10922566 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 827 | Open in IMG/M |
| 3300012485|Ga0157325_1042072 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012685|Ga0137397_10548567 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300012896|Ga0157303_10072159 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 769 | Open in IMG/M |
| 3300012922|Ga0137394_10359226 | Not Available | 1243 | Open in IMG/M |
| 3300012923|Ga0137359_10905624 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300012929|Ga0137404_11565213 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300012930|Ga0137407_10102337 | Not Available | 2458 | Open in IMG/M |
| 3300012931|Ga0153915_13135326 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012971|Ga0126369_13231791 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
| 3300013297|Ga0157378_10917506 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300014321|Ga0075353_1190825 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300015373|Ga0132257_101484350 | Not Available | 865 | Open in IMG/M |
| 3300015374|Ga0132255_104028746 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300016404|Ga0182037_11413257 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300017973|Ga0187780_10792463 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 685 | Open in IMG/M |
| 3300018027|Ga0184605_10017657 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2824 | Open in IMG/M |
| 3300018028|Ga0184608_10107947 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1169 | Open in IMG/M |
| 3300018060|Ga0187765_10756788 | Not Available | 644 | Open in IMG/M |
| 3300018064|Ga0187773_10464414 | Not Available | 747 | Open in IMG/M |
| 3300018429|Ga0190272_10625942 | Not Available | 950 | Open in IMG/M |
| 3300018431|Ga0066655_10701458 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300018482|Ga0066669_11405825 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 632 | Open in IMG/M |
| 3300019886|Ga0193727_1151844 | Not Available | 628 | Open in IMG/M |
| 3300019888|Ga0193751_1238860 | Not Available | 571 | Open in IMG/M |
| 3300020015|Ga0193734_1061970 | Not Available | 672 | Open in IMG/M |
| 3300020583|Ga0210401_11192420 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 620 | Open in IMG/M |
| 3300021086|Ga0179596_10007811 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3360 | Open in IMG/M |
| 3300021090|Ga0210377_10073103 | All Organisms → cellular organisms → Bacteria | 2331 | Open in IMG/M |
| 3300021344|Ga0193719_10163449 | Not Available | 958 | Open in IMG/M |
| 3300021344|Ga0193719_10297089 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300025885|Ga0207653_10029083 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
| 3300025899|Ga0207642_10365526 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300025917|Ga0207660_10387815 | Not Available | 1123 | Open in IMG/M |
| 3300025923|Ga0207681_10530369 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300025923|Ga0207681_11381542 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_68_15 | 591 | Open in IMG/M |
| 3300025926|Ga0207659_11304412 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 623 | Open in IMG/M |
| 3300026089|Ga0207648_11707153 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 591 | Open in IMG/M |
| 3300026313|Ga0209761_1269811 | Not Available | 624 | Open in IMG/M |
| 3300026315|Ga0209686_1112970 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300026327|Ga0209266_1089755 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1372 | Open in IMG/M |
| 3300027364|Ga0209967_1077849 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300027577|Ga0209874_1044640 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1167 | Open in IMG/M |
| 3300027577|Ga0209874_1149823 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300027787|Ga0209074_10430605 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 559 | Open in IMG/M |
| 3300027862|Ga0209701_10314707 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 895 | Open in IMG/M |
| 3300027907|Ga0207428_11034053 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 576 | Open in IMG/M |
| 3300027909|Ga0209382_10946302 | Not Available | 903 | Open in IMG/M |
| 3300027957|Ga0209857_1070900 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 597 | Open in IMG/M |
| 3300028047|Ga0209526_10137415 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300028381|Ga0268264_11597588 | Not Available | 663 | Open in IMG/M |
| 3300028597|Ga0247820_11291285 | Not Available | 529 | Open in IMG/M |
| 3300028809|Ga0247824_10171121 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300028889|Ga0247827_10497321 | Not Available | 762 | Open in IMG/M |
| 3300031198|Ga0307500_10127317 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300031226|Ga0307497_10425131 | Not Available | 640 | Open in IMG/M |
| 3300031720|Ga0307469_10671572 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 936 | Open in IMG/M |
| 3300031724|Ga0318500_10738951 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300031740|Ga0307468_101558632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 615 | Open in IMG/M |
| 3300031908|Ga0310900_10882703 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300032013|Ga0310906_10034337 | All Organisms → cellular organisms → Bacteria | 2349 | Open in IMG/M |
| 3300032174|Ga0307470_10256952 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300032174|Ga0307470_11047278 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300032180|Ga0307471_100736701 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300032205|Ga0307472_102582340 | Not Available | 517 | Open in IMG/M |
| 3300033158|Ga0335077_11529439 | Not Available | 638 | Open in IMG/M |
| 3300033233|Ga0334722_10347576 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1076 | Open in IMG/M |
| 3300033412|Ga0310810_10165219 | All Organisms → cellular organisms → Bacteria | 2552 | Open in IMG/M |
| 3300033813|Ga0364928_0170316 | Not Available | 540 | Open in IMG/M |
| 3300034178|Ga0364934_0168543 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300034818|Ga0373950_0165388 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 513 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.21% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.11% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.11% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.48% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.86% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.86% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.24% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.24% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.24% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.24% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.62% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.62% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.62% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.62% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.62% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.62% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.62% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_10408822 | 2228664022 | Soil | MHFGIFVEEMRYGASQVSAFRDAFDLAQRAEDWGLDCVWLGEIH |
| INPgaii200_11507811 | 2228664022 | Soil | MHFGLFVEEMRRGASPISAFDDAFELADMADTWGMDCVWLG |
| F24TB_104764702 | 3300000550 | Soil | MHFGIFVEEMRYGASQVSAFRDAFELAHRAEDWGLDCVWLGEPRRWW* |
| F14TC_1002044291 | 3300000559 | Soil | VHVGLFVEELRQGATQTSAFRDIFETVERAEAWGIDCVWLGEIHFT |
| F14TB_1008702211 | 3300001431 | Soil | VHVGLFVEELRQGATQTSAFRDIFETVERAEAWGIDCVWLGEIHFTPSRSIISA |
| F14TB_1030669171 | 3300001431 | Soil | MHFGLFVEEMRRGASPISAFDDAFELADMADTWGMDCVWLGEIHFT |
| JGI12053J15887_102548141 | 3300001661 | Forest Soil | MHFGLFVEEMRRGASPISAFDDAFELADMADAWGMDCVWLGEIHFTPARSVISASLLVAS |
| Ga0055437_100937541 | 3300004009 | Natural And Restored Wetlands | VHFGIFIEELRQGASQATAFRDAFELADRAEAWGADCVWLG |
| Ga0062595_1010266221 | 3300004479 | Soil | VHFGIFVEEMRQGASQPSAFRDVFELADRAEAWGVDCLWLGEIHFTPVRSVIS |
| Ga0065704_102179832 | 3300005289 | Switchgrass Rhizosphere | MHFGLFVEEMRRGASPISAFDDAFELADMADTWGMDCVWLGEIHFTPARSVISASL |
| Ga0065705_110242231 | 3300005294 | Switchgrass Rhizosphere | VHFGIFVEELRHGATQAAAFRDIFETADHAEAWGIDCAWLGEIHFTPSRSIIS |
| Ga0066388_1003526382 | 3300005332 | Tropical Forest Soil | MHFGVFAEEMRHGASPASAFRDVFELAERAEASGIDCVWL |
| Ga0066388_1077809311 | 3300005332 | Tropical Forest Soil | VHIGLFIEEMRQGASQDQTACFRDIFEVADRAEAWGIDCVWLGEIHFTP |
| Ga0070668_1009413872 | 3300005347 | Switchgrass Rhizosphere | MHFGIFVEEMRYGASQVSAFRDAFDLAQRAEDWGLDCVWLG |
| Ga0070705_1000236204 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VHFGIFVEEMRQGSGQSQTSAFRDIFEVADHADAWGADCVWLGEIHF |
| Ga0066686_108505151 | 3300005446 | Soil | MHCGLFIEEMRQGADQATAFRDVFELADRAEAWGADCVWLGEIHF |
| Ga0066682_101552173 | 3300005450 | Soil | MHFGLFVEEMRRGATAVSAFDDAFGLADLAEAWGMDCVWLGEI |
| Ga0068867_1017591382 | 3300005459 | Miscanthus Rhizosphere | VHFGIFVEEMRQGASQPSAFRDVFELADRAEAWGVDCLWLGEIHFTPVRSVISASLQVAS |
| Ga0070706_1015340841 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MHFGLFVEEMRRGASPVSAFDDAFELADMAEAWGMDCVWLGEIHF |
| Ga0070707_1003984502 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MHFGIFVEELRYGASQAEAFRDIFETADRAEAGGVDCVWLGEIHFT |
| Ga0070699_1003523891 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VHFGVFVEELRHGATQAGAFRDIFETAAQAEAGGIDCVWLGEIHF |
| Ga0070699_1015278711 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VHFGIFVEEMRQGASQPSAFRDVFELADRAEAWGVDCLWLG |
| Ga0070696_1005787541 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VHFGIFVEEMRQGTSQPGAFRDVFELADRAEAWGIDCVWLGEIHF |
| Ga0070704_1019488492 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VHFGIFVEEKRHGVTQHDAFRDIFELADRAEAWGVDCVWLGEIHFTP |
| Ga0066705_106477472 | 3300005569 | Soil | VHFGLFVEEMRQGASQTSAFRDVFELAERADALGIDCVW |
| Ga0066702_109174731 | 3300005575 | Soil | MQAVHVGLFVEEMRQGATQTSAFRDIFDTAERADALGIDC |
| Ga0070702_1014324501 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MHFGLFVEEMRRGATPISAFDDAFELADIAETWGMDCVWLGEIHFTPSRSVISASLLV |
| Ga0068861_1003283051 | 3300005719 | Switchgrass Rhizosphere | VHFGIFVEEMRQGSSQSQTSAFRDIFEVADHADAWGADCVWLGEIHFTPT |
| Ga0066903_1060355791 | 3300005764 | Tropical Forest Soil | VPGPGKAPAWYNLPMHFGLFVEEMRRGATAVSAFDDAFDLADIAEAWGMDCVWLGEIHFTPARSVISASLLVASSI |
| Ga0068858_1024777102 | 3300005842 | Switchgrass Rhizosphere | VHFGIFVEEMRQGASQPSAFRDVFELADRAEAWGVDCLWLGEIHFTPV |
| Ga0068860_1017076181 | 3300005843 | Switchgrass Rhizosphere | VHFGIFVEEMRQGATQPSAFRDVFELADRAEAWGVDCLWLGEIHFTPVRSVISA |
| Ga0066651_105057132 | 3300006031 | Soil | VHFGIFVEEMRQGASQAGAFRDVFELADRAEAWGAGCVWLGEIHFTPVRSVISASLQVAS |
| Ga0066651_107845792 | 3300006031 | Soil | VHFGIFVEEKRHGVTQAEAFRDIFELADRADAWGV |
| Ga0075018_104552202 | 3300006172 | Watersheds | MGAVHFGVFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHFTPSRSVISA |
| Ga0066659_107267671 | 3300006797 | Soil | MHFGLFVEEMRRGASPVSAFDDAFELADMAEAWGMDCVWLGEIHFTPARSVISA |
| Ga0079221_110758441 | 3300006804 | Agricultural Soil | LHFGIFVEELRHGATQAGAFRDIIETAAQAETGGVDCVWL |
| Ga0075421_1020783581 | 3300006845 | Populus Rhizosphere | VHFGIFVEEMRQGANQATAFRDVFELADRAEAWGADCVWLGEIHFTP |
| Ga0075421_1020961371 | 3300006845 | Populus Rhizosphere | VHIGLFVEEMRQGATQPEAFRDIFALADRAEAWGIDCLWLGEIHFTPVRS |
| Ga0075433_105901982 | 3300006852 | Populus Rhizosphere | MHFGLFVEEMRRGATAVSAFDDAFELADIAEAWGMDCVWLGEIH |
| Ga0075425_1011249402 | 3300006854 | Populus Rhizosphere | VHFGIFVEEMRQGSSQDQAAAFRDIFETAEHADAWGADCVWLGEIHFTPTRSVIS |
| Ga0075425_1012778442 | 3300006854 | Populus Rhizosphere | MHFGIFVEEMRYGASQVSAFRDAFDLAQRAEDWGLDCVW |
| Ga0075425_1024042522 | 3300006854 | Populus Rhizosphere | MHFGLFVEEMRRGATPISAFDDAFELADIAETWGMDCVWLGEIHF |
| Ga0075434_1017769041 | 3300006871 | Populus Rhizosphere | VHFGIFVEEMRQGANQATAFRDVFELADRAEAWGADCVWLGEIHFTPT |
| Ga0075434_1019709321 | 3300006871 | Populus Rhizosphere | MHFGLFVEEMRRGATPVSAFDDAFELADIAETWGMDCVWLGEIHFT |
| Ga0075429_1009394112 | 3300006880 | Populus Rhizosphere | MHFGLFVEEMRRGATPISAFDDAFELADMAETWGMDCV |
| Ga0075426_101157491 | 3300006903 | Populus Rhizosphere | MHFGLFVEEMRRGATPVSAFDDAFELADMAETWGMDCVWLGEIHF |
| Ga0075424_1019987121 | 3300006904 | Populus Rhizosphere | MHFGIFVEEMRQGLSQTAAFREAFDVAERAEELGVDC |
| Ga0079218_137054202 | 3300007004 | Agricultural Soil | MHVGIFVEELRQGEDQATSFREAFALAERADALGIECVWLGEI |
| Ga0075435_1014558952 | 3300007076 | Populus Rhizosphere | MHFGLFVEEMRRGATPISAFDDAFELADIAETWGMDCVWLGEIHFTPS |
| Ga0066710_1044020821 | 3300009012 | Grasslands Soil | MHVGIFVEEMRHGVDQVGAFRDAFAIAERADAWGADGVWRGGTHFAPTRSVISAREAGSGFGAPC |
| Ga0099830_104001611 | 3300009088 | Vadose Zone Soil | VHFGIFVEEIRHGANQIASFRDVFEQADRAEAWGIDCVWLGEIH |
| Ga0099828_101430562 | 3300009089 | Vadose Zone Soil | VHFGIFVEELGHGATQAGAFRDIFETADRAEAWGIDCVWLGE |
| Ga0099828_117526551 | 3300009089 | Vadose Zone Soil | MHFGIFVEELRYGASQAAAFRDIFETADRAEAWGID |
| Ga0075418_125242721 | 3300009100 | Populus Rhizosphere | MHFGLFVEEMRRGATPISAFDDAFELADMAETWGMDCVW |
| Ga0114129_100451741 | 3300009147 | Populus Rhizosphere | VHFGIFVEELRHGATQAGAFRDIFETADHAEAWGID |
| Ga0114129_111023901 | 3300009147 | Populus Rhizosphere | VHVGIFIEEMRQGSSQNQAAAFRDIFEVADHADAWGADCVWLGEIHFTP |
| Ga0105243_124281562 | 3300009148 | Miscanthus Rhizosphere | VHFGIFVEEMRQGSSQSQTSAFRDIFEVADHADAWGADCVWLGEI |
| Ga0111538_123734711 | 3300009156 | Populus Rhizosphere | MHFGLFVEEMRRGATPVSAFDDAFELADIAETWGMDCVWLGEIHFTPSRSVISASL |
| Ga0126374_115938021 | 3300009792 | Tropical Forest Soil | VHVGIFIEELRQGASQAEAFRDIFELADRCEAWGVPCVWLGEIHFTPTR |
| Ga0126382_106587161 | 3300010047 | Tropical Forest Soil | MALGEATVHFGLFIEEIRQGASQASSFRDIFELAGRAEALGIDCVWLGEIH |
| Ga0126382_115017502 | 3300010047 | Tropical Forest Soil | MFVEEKRHDATQRSAFRDVFELADRAEAWGIDCVWLG |
| Ga0126382_125234712 | 3300010047 | Tropical Forest Soil | VHVGIFIEELRQGASQAQAFRDIFELADRCEAWGVPCVWLGEIHFTPTRSVISA |
| Ga0134067_101501022 | 3300010321 | Grasslands Soil | MHFGIFVEEMRRGASQGQAFQETFELADTAEACKA* |
| Ga0134063_105062722 | 3300010335 | Grasslands Soil | MRQGATQTSAFRDIFATAERADALGIDCVWLGEIHFTPT |
| Ga0134062_100555511 | 3300010337 | Grasslands Soil | MQAVHVGLFVEEMRQGATQTSAFRDIFDTAERADALGID |
| Ga0126370_117282202 | 3300010358 | Tropical Forest Soil | VHFGIFVEELRQGATQASAFRDIFELTERAEAWGIDCVWLGEI |
| Ga0126377_103059913 | 3300010362 | Tropical Forest Soil | VHVGLFVEELRQGATQTSAFRDIFESAERAEAWGIDCVWLGEIHFTPSRSIISASLQ |
| Ga0126377_122298921 | 3300010362 | Tropical Forest Soil | VHVGLFVEELRQGATQTSAFRDIFETADRAEAWGIDCVWLGEIHFTPSRSIISASLQ |
| Ga0126377_124663881 | 3300010362 | Tropical Forest Soil | VHIGLFIEEMRQGSNQDQPTAFRDIFEVADRAEAWGIDCVWL |
| Ga0126379_114306932 | 3300010366 | Tropical Forest Soil | VPEEAAVHFGIFVEEKRHGVTQHDAFRDIFELADR |
| Ga0126381_1020089341 | 3300010376 | Tropical Forest Soil | MHFGLFVEEMRRGATAISAFDDAFELADNAEAWGMDCVWLGEIHFTPSRSVI |
| Ga0126383_101877711 | 3300010398 | Tropical Forest Soil | VHFGVFIEELRHGATQASAFRDIFEVADRAEAWGLNCAWL |
| Ga0126383_103511842 | 3300010398 | Tropical Forest Soil | VHVGIFIEELRQGASQAEAFRDIFELADRCEAWGVPCV* |
| Ga0126383_125536501 | 3300010398 | Tropical Forest Soil | MHFGIFVEEMRYGASQVSAFRDAFELAERAEDWGLDC |
| Ga0134127_110308221 | 3300010399 | Terrestrial Soil | VHFGIFVEEMRQGASQPSAFRDVFELADRAEAWGVDCLW |
| Ga0134122_105838832 | 3300010400 | Terrestrial Soil | VHFGIFVEEMRQGASQPTAFRDVFELADRAEAWGVDCLWLGEIHFTP |
| Ga0134121_103383201 | 3300010401 | Terrestrial Soil | VHFGIFVEEMRQGSSQSQTSAFRDIFEIADHADAWGADCVWLGEIHFTPTRSV |
| Ga0137392_113311282 | 3300011269 | Vadose Zone Soil | VSIEAVHFGIFVEEIRYGASQVESFRDIFEQADRAEAWGIDCVWLGEIHFTPSRSVIS |
| Ga0137393_102458711 | 3300011271 | Vadose Zone Soil | LTPARWAVTIGVVHFGVFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHFTPSRSVISA |
| Ga0137363_102020144 | 3300012202 | Vadose Zone Soil | VHFGIFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHF |
| Ga0137363_102808373 | 3300012202 | Vadose Zone Soil | VHFGVFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHF |
| Ga0137399_105060561 | 3300012203 | Vadose Zone Soil | VHVGIFVEEMRQGASQRAAFRDVFELADRADACGIDCVWLGEIHFTPT |
| Ga0137362_102266531 | 3300012205 | Vadose Zone Soil | VHFGIFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHFTPSRSVISAS |
| Ga0137381_103659194 | 3300012207 | Vadose Zone Soil | VHFGIFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHFTP |
| Ga0137377_112585662 | 3300012211 | Vadose Zone Soil | MHFGLFVEEMRRGATTVSAFDDAFELADIAEAWGMDCVWLGEIHF |
| Ga0137367_105800342 | 3300012353 | Vadose Zone Soil | MHFGIFVEEMRYWANQVSAFRDAFELAQHAEDWGLDCVWL |
| Ga0137368_108605042 | 3300012358 | Vadose Zone Soil | MHFGIFVEEMRYGTNQISAFQNAFELAQHAEDWGLDC |
| Ga0137375_112849121 | 3300012360 | Vadose Zone Soil | MHVGIFVEEMRRGVDQATAFRDVFALAERAEARGIDCVWLGEIHFTP |
| Ga0137390_105160412 | 3300012363 | Vadose Zone Soil | MADAMHFGIFVEEMRQGADQAAAFRDVFETAERAEAWGVDCVWLGE |
| Ga0137390_105996542 | 3300012363 | Vadose Zone Soil | VHFGVFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHFTPSRSVISASL |
| Ga0137390_109225661 | 3300012363 | Vadose Zone Soil | VHFGVFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHFTPSRSVISASLQVA |
| Ga0157325_10420721 | 3300012485 | Arabidopsis Rhizosphere | MHFKIFVKEMRYGASQVSAFRDAFDLAQRTEDWGLDCVW |
| Ga0137397_105485672 | 3300012685 | Vadose Zone Soil | VHFGLFVEEMRQGASQTSAFRDVFELAERADALGIDCVWLGEIHF |
| Ga0157303_100721591 | 3300012896 | Soil | VHFGVFVEELRHGATQAGAFRDIFETAAQAEAGGIDCVWLGEIHFTPS |
| Ga0137394_103592261 | 3300012922 | Vadose Zone Soil | MHFGLFVEEMRRGATAVSAFDDAFGLADLAEAWGMDCVWLGEIHFTPARS |
| Ga0137359_109056242 | 3300012923 | Vadose Zone Soil | MHFGLFVEEMRRGATTVSAFDDAFELADIAEAWGMDCVWLG |
| Ga0137404_115652131 | 3300012929 | Vadose Zone Soil | MHFGLFVEEMRRGATAVSAFDDAFGLAELAEAWGMDCVWLGEIHFTPARSVISASLL |
| Ga0137407_101023371 | 3300012930 | Vadose Zone Soil | MHFGLFVEEMRRGANAVSAFDDAFELADMAEAWGMDCVWLGEIHFTPARSVIS |
| Ga0153915_131353262 | 3300012931 | Freshwater Wetlands | MHVGIFVEELRHGATQVSAFRDIFELSDRAEAWGV |
| Ga0126369_132317911 | 3300012971 | Tropical Forest Soil | VHVGLFVEEMRQGADQVSAFRDIFDTAQRADALGI |
| Ga0157378_109175061 | 3300013297 | Miscanthus Rhizosphere | MHFGLFVEEMRRGATAVSAFDDAFELADIAEAWGM |
| Ga0075353_11908252 | 3300014321 | Natural And Restored Wetlands | VHFGIFVEEMRQGSSQDQASAFRDIFEVADHADAWGADCVWLGEIHFT |
| Ga0132257_1014843501 | 3300015373 | Arabidopsis Rhizosphere | MHIGLFVEEMRQGATQPAAFRDIFELADRAEAWAIDCVWLGEI |
| Ga0132255_1040287462 | 3300015374 | Arabidopsis Rhizosphere | MHFGLFVEEMRRGATPVSAFDDAFELADIAEAWGMDCVWLGEIHFT |
| Ga0182037_114132571 | 3300016404 | Soil | MHFGLFVEEMRRGATAISAFDDAFELADSAEAWGMDCVWLG |
| Ga0187780_107924631 | 3300017973 | Tropical Peatland | VHFGIFVEELRQGANQAEAFRDVFETADRAEAWGVDCV |
| Ga0184605_100176571 | 3300018027 | Groundwater Sediment | VHFGIFVEEMRQGASQASAFRDVFELADRAEAWGIDCVWLGA |
| Ga0184608_101079471 | 3300018028 | Groundwater Sediment | VHFGIFVEELRHGATQAGAFRDIFETADHAEAWGIDCAWLGEIHFT |
| Ga0187765_107567881 | 3300018060 | Tropical Peatland | MALEEATMHFGLFIEEIRQGASQVASFRDIFELAGRAETLGVDCVWLGE |
| Ga0187773_104644141 | 3300018064 | Tropical Peatland | MHFGLFVEEIRQGATQAAAFRDIFELAERAEALGIDCV |
| Ga0190272_106259422 | 3300018429 | Soil | VHFGIFVEELRHGATQAGAFRDIFETADHAEAWGIDCAWLGEIHFTP |
| Ga0066655_107014582 | 3300018431 | Grasslands Soil | MHFGIFVEEMRYGSNQVSAFRDAFELAQRAEDWGLDCVW |
| Ga0066669_114058252 | 3300018482 | Grasslands Soil | VHFGLFVEEMRQGASQTSAFRDVFELAERADTLGI |
| Ga0193727_11518442 | 3300019886 | Soil | VHFGIFVEELRHGATQAAAFRDIFETADHAEAWGIDCAWLGEIHFTPSRSIISASLQVAS |
| Ga0193751_12388602 | 3300019888 | Soil | VHFGVFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHFTPSRSVISASLQ |
| Ga0193734_10619702 | 3300020015 | Soil | VHFGVFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHFTPSRSVI |
| Ga0210401_111924201 | 3300020583 | Soil | VHFGIFVEELRQGATQAAAFRDVFETADRAEAWGIDCVWLGEIYFTPSRSVISA |
| Ga0179596_100078111 | 3300021086 | Vadose Zone Soil | VHFGVFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHFTPSRSVISASLQVAS |
| Ga0210377_100731035 | 3300021090 | Groundwater Sediment | VHFGIFVEEMRQGSSQTSAFRDIFELAERAEAWGVDCVWLGEIHF |
| Ga0193719_101634491 | 3300021344 | Soil | VHFGIFVEELRHGATQAAAFRDIFETADHAEAWGID |
| Ga0193719_102970891 | 3300021344 | Soil | MHFGLFVEEMRRGATPVSAFDDAFELADIAEAWGMDCVWLGEIHFTPARSVISASLLM |
| Ga0207653_100290833 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MHFGLFVEEMRRGATAVSAFDDAFELADIAEAWGMDCVWLGEIHFTPARSVISASLLMA |
| Ga0207642_103655262 | 3300025899 | Miscanthus Rhizosphere | MHFGLFVEEMRRGATAVSAFDDAFELADIAEAWGMD |
| Ga0207660_103878153 | 3300025917 | Corn Rhizosphere | VHFGIFVEEMRQGASQPSAFRDVFELADRAEAWGVDCLWLGEIHFTPVRSVISASL |
| Ga0207681_105303691 | 3300025923 | Switchgrass Rhizosphere | MHFGLFVEEMRRGATAVSAFDDAFELADIAEAWGMDCVWLGEIHFTPARSVI |
| Ga0207681_113815422 | 3300025923 | Switchgrass Rhizosphere | VHFGIFVEEMRQGSSQSQTSAFRDIFEVADHADAW |
| Ga0207659_113044122 | 3300025926 | Miscanthus Rhizosphere | VHFGVFVEELRHGATQAGAFRDIFETAAQAEAGGIDCVWLGEIHFTPSRSII |
| Ga0207648_117071531 | 3300026089 | Miscanthus Rhizosphere | VHFGIFVEEMRQGASQPSAFRDVFELADRAEAWGVDCLWLGEIHFTPVRSVISA |
| Ga0209761_12698111 | 3300026313 | Grasslands Soil | MHCGLFIEEMRQGADQATAFRDVFELADRAEAWGADCVWLGEIHFTPVRSVIS |
| Ga0209686_11129701 | 3300026315 | Soil | VHFGLFVEEMRQGASQTSAFRDVFELAERADTLGIDCVWLGE |
| Ga0209266_10897552 | 3300026327 | Soil | MQAVHVGLFVEEMRQGATQTSAFRDVFDTAERADALGIDCVW |
| Ga0209967_10778491 | 3300027364 | Arabidopsis Thaliana Rhizosphere | VHVGLFVEELRQGATQSSAFRDIFETADRAEAWGIDCVWLGE |
| Ga0209874_10446402 | 3300027577 | Groundwater Sand | MHFGIFVEEMRYGANQVSAFRDAFEVAQHAEAWGVDCVWLGEIHFAPTRS |
| Ga0209874_11498232 | 3300027577 | Groundwater Sand | MHFGIFIEEMRHGASQTRAFRDVFETADRAEAWGVDCVW |
| Ga0209074_104306052 | 3300027787 | Agricultural Soil | VHFGIFVEELRHGATQAGAFRDIFETAAQAETGGVDCVWLGEIHFTP |
| Ga0209701_103147071 | 3300027862 | Vadose Zone Soil | VHFGIFVEEIRHGANQIASFRDVFEQADRAEAWGIDCVWLGEI |
| Ga0207428_110340531 | 3300027907 | Populus Rhizosphere | VHVGIFIEELRQGASQAEAFRDIFELADRCEAWGVPC |
| Ga0209382_109463021 | 3300027909 | Populus Rhizosphere | VHIGLFVEEMRQGATQPEAFRDIFALADRAEAWGIDCLWLGEIHFTPVRSVISA |
| Ga0209857_10709001 | 3300027957 | Groundwater Sand | MHFGIFVEEMRYGASQVSAFRDAFELAQQAEAWGLDC |
| Ga0209526_101374151 | 3300028047 | Forest Soil | VHFGVFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIRFTPSRSVISAS |
| Ga0268264_115975881 | 3300028381 | Switchgrass Rhizosphere | VHFGIFVEEKRHGVTQHDAFRDIFELADRAEAWGVDCVW |
| Ga0247820_112912852 | 3300028597 | Soil | VHIGLFVEELRQGATQPEAFRDIFALADRAEAWGIDCLWLGEIHFTPVRSVISASLQVASAI |
| Ga0247824_101711211 | 3300028809 | Soil | VHIGLFVEEMRQGATQPEAFRDIFALADRAEAWGIDCLWLGEIHFTPVR |
| Ga0247827_104973211 | 3300028889 | Soil | MHIGLFVEEMRQGATQPAAFRDIFELADRAEAWGIDCVWLGEI |
| Ga0307500_101273172 | 3300031198 | Soil | MHFGLFVEEMRRGATAVSAFDDAFELADIAEAWGMDCVWLGEIHFTPARSVISA |
| Ga0307497_104251312 | 3300031226 | Soil | MHIGLFVEEMRQGATQPAAFRDIFELADRAEAWGIDCVW |
| Ga0307469_106715723 | 3300031720 | Hardwood Forest Soil | VHFGIFVEEIRYGANQIASFRDVFEQADRAEAWGIDCVWLGEIHFTPSRSVI |
| Ga0318500_107389512 | 3300031724 | Soil | MHFGLFVEEMRRGATPISAFDDAFELADTAEAWGMDCVW |
| Ga0307468_1015586322 | 3300031740 | Hardwood Forest Soil | VHFGIFVEEMRQGASQPSAFRDVFELADRAEAWGV |
| Ga0310900_108827031 | 3300031908 | Soil | MHFGLFVEEMRRGATPVSAFDDAFELADIAEAWGMDCVWLGEIHFTPARSVIS |
| Ga0310906_100343371 | 3300032013 | Soil | MHVGIFVEEMRQGANQPAAFRDVFELADRAEAWGIDCVWLGEI |
| Ga0307470_102569522 | 3300032174 | Hardwood Forest Soil | VHIGLFVEEMRQGATQPEAFRDIFELADRAEAWGIDCLWLGEIHFTP |
| Ga0307470_110472781 | 3300032174 | Hardwood Forest Soil | MHFGLFVEEMRRGATAVSAFDDAFELADIAEAWGMDCVWLGEIHF |
| Ga0307471_1007367011 | 3300032180 | Hardwood Forest Soil | MRPVHIGLFVEEMRQGANQASAFRDIFETAQRADALGLDCVW |
| Ga0307472_1025823402 | 3300032205 | Hardwood Forest Soil | VHFGIFVEELRHGATQAGAFRDIFETADRAEAGGVDC |
| Ga0335077_115294391 | 3300033158 | Soil | VHFGLFIEEIRQGASQASSFRDIFELAGRAEVLGIDCV |
| Ga0334722_103475762 | 3300033233 | Sediment | VHFGIFVEELRHGATQARAFRDIFETADHAEAWGIDCVWLGEIHFTPSRSIISASLQVAS |
| Ga0310810_101652191 | 3300033412 | Soil | MHVGIFCEEMRQGSDQPTAFQDVFELADRAEAWGIECV |
| Ga0364928_0170316_415_540 | 3300033813 | Sediment | VHFGIFVEEMRQGASQAGAFRDIFELADRAEAWGVDCVWLGE |
| Ga0364934_0168543_690_830 | 3300034178 | Sediment | MDAMHFGLFVEEMRHGATQASAFRDVFEVADRAEAWGIDCVWLGEIH |
| Ga0373950_0165388_354_512 | 3300034818 | Rhizosphere Soil | VHFGVFVEELRHGATQAGAFRDIFETAAQAEAGGIDCVWLGEIHFTPSRSIIS |
| ⦗Top⦘ |