| Basic Information | |
|---|---|
| Family ID | F040825 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 161 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MAMFTANDAVLPFPLRQALDRVDAQLDLLIYDAFPLPKAS |
| Number of Associated Samples | 140 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 13.55 % |
| % of genes near scaffold ends (potentially truncated) | 55.28 % |
| % of genes from short scaffolds (< 2000 bps) | 83.85 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.112 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (8.075 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.814 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.205 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.88% β-sheet: 0.00% Coil/Unstructured: 69.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF12762 | DDE_Tnp_IS1595 | 3.11 |
| PF13561 | adh_short_C2 | 1.86 |
| PF03551 | PadR | 1.86 |
| PF13460 | NAD_binding_10 | 1.86 |
| PF14329 | DUF4386 | 1.24 |
| PF01833 | TIG | 1.24 |
| PF01850 | PIN | 1.24 |
| PF00589 | Phage_integrase | 1.24 |
| PF13701 | DDE_Tnp_1_4 | 1.24 |
| PF13620 | CarboxypepD_reg | 1.24 |
| PF13592 | HTH_33 | 1.24 |
| PF00196 | GerE | 1.24 |
| PF13384 | HTH_23 | 0.62 |
| PF00926 | DHBP_synthase | 0.62 |
| PF06964 | Alpha-L-AF_C | 0.62 |
| PF01053 | Cys_Met_Meta_PP | 0.62 |
| PF13358 | DDE_3 | 0.62 |
| PF13683 | rve_3 | 0.62 |
| PF01610 | DDE_Tnp_ISL3 | 0.62 |
| PF13424 | TPR_12 | 0.62 |
| PF01872 | RibD_C | 0.62 |
| PF00069 | Pkinase | 0.62 |
| PF02082 | Rrf2 | 0.62 |
| PF02687 | FtsX | 0.62 |
| PF02518 | HATPase_c | 0.62 |
| PF09363 | XFP_C | 0.62 |
| PF01548 | DEDD_Tnp_IS110 | 0.62 |
| PF13596 | PAS_10 | 0.62 |
| PF00460 | Flg_bb_rod | 0.62 |
| PF00857 | Isochorismatase | 0.62 |
| PF02781 | G6PD_C | 0.62 |
| PF01527 | HTH_Tnp_1 | 0.62 |
| PF12867 | DinB_2 | 0.62 |
| PF01396 | zf-C4_Topoisom | 0.62 |
| PF01041 | DegT_DnrJ_EryC1 | 0.62 |
| PF13481 | AAA_25 | 0.62 |
| PF03401 | TctC | 0.62 |
| PF00582 | Usp | 0.62 |
| PF05368 | NmrA | 0.62 |
| PF14294 | DUF4372 | 0.62 |
| PF03479 | PCC | 0.62 |
| PF07728 | AAA_5 | 0.62 |
| PF13426 | PAS_9 | 0.62 |
| PF13519 | VWA_2 | 0.62 |
| PF00571 | CBS | 0.62 |
| PF00440 | TetR_N | 0.62 |
| PF12543 | DUF3738 | 0.62 |
| PF05565 | Sipho_Gp157 | 0.62 |
| PF03050 | DDE_Tnp_IS66 | 0.62 |
| PF02771 | Acyl-CoA_dh_N | 0.62 |
| PF13155 | Toprim_2 | 0.62 |
| PF02954 | HTH_8 | 0.62 |
| PF04932 | Wzy_C | 0.62 |
| PF13517 | FG-GAP_3 | 0.62 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.62 |
| PF13551 | HTH_29 | 0.62 |
| PF01061 | ABC2_membrane | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.48 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.86 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.86 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.86 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 1.24 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 1.24 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 1.24 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 1.24 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 1.24 |
| COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.62 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.62 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.62 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.62 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.62 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.62 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.62 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.62 |
| COG1815 | Flagellar basal body rod protein FlgB | Cell motility [N] | 0.62 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.62 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.62 |
| COG3534 | Alpha-L-arabinofuranosidase | Carbohydrate transport and metabolism [G] | 0.62 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.62 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.62 |
| COG4786 | Flagellar basal body rod protein FlgG | Cell motility [N] | 0.62 |
| COG4787 | Flagellar basal body rod protein FlgF | Cell motility [N] | 0.62 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.62 |
| COG0108 | 3,4-dihydroxy-2-butanone 4-phosphate synthase | Coenzyme transport and metabolism [H] | 0.62 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.62 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.62 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.62 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.62 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.62 |
| COG1256 | Flagellar hook-associated protein FlgK | Cell motility [N] | 0.62 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.62 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.62 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.62 |
| COG1558 | Flagellar basal body rod protein FlgC | Cell motility [N] | 0.62 |
| COG1661 | Predicted DNA-binding protein with PD1-like DNA-binding motif, PPC/DUF296 domain | General function prediction only [R] | 0.62 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.62 |
| COG1749 | Flagellar hook protein FlgE | Cell motility [N] | 0.62 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.62 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.11 % |
| Unclassified | root | N/A | 37.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY02GXM6Q | Not Available | 558 | Open in IMG/M |
| 3300001356|JGI12269J14319_10204264 | Not Available | 774 | Open in IMG/M |
| 3300002568|C688J35102_120852823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1827 | Open in IMG/M |
| 3300004114|Ga0062593_101098616 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300004156|Ga0062589_100266513 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300005354|Ga0070675_101444596 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005364|Ga0070673_101707819 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005434|Ga0070709_10542410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 889 | Open in IMG/M |
| 3300005440|Ga0070705_100195492 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300005504|Ga0074230_1000115 | Not Available | 538 | Open in IMG/M |
| 3300005538|Ga0070731_10124960 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
| 3300005602|Ga0070762_10062657 | All Organisms → cellular organisms → Bacteria | 2075 | Open in IMG/M |
| 3300005844|Ga0068862_101536272 | Not Available | 672 | Open in IMG/M |
| 3300006052|Ga0075029_100054363 | All Organisms → cellular organisms → Bacteria | 2324 | Open in IMG/M |
| 3300006057|Ga0075026_100069826 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
| 3300006172|Ga0075018_10588506 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300006237|Ga0097621_100745869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 904 | Open in IMG/M |
| 3300006354|Ga0075021_10072505 | All Organisms → cellular organisms → Bacteria | 2016 | Open in IMG/M |
| 3300006358|Ga0068871_100460897 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300006640|Ga0075527_10230067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 538 | Open in IMG/M |
| 3300006893|Ga0073928_10250657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1354 | Open in IMG/M |
| 3300009029|Ga0066793_10134474 | Not Available | 1442 | Open in IMG/M |
| 3300009088|Ga0099830_10802027 | Not Available | 777 | Open in IMG/M |
| 3300009090|Ga0099827_10064941 | All Organisms → cellular organisms → Bacteria | 2797 | Open in IMG/M |
| 3300009101|Ga0105247_11544607 | Not Available | 543 | Open in IMG/M |
| 3300009521|Ga0116222_1079014 | Not Available | 1420 | Open in IMG/M |
| 3300009524|Ga0116225_1204232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 892 | Open in IMG/M |
| 3300009524|Ga0116225_1564237 | Not Available | 504 | Open in IMG/M |
| 3300009632|Ga0116102_1112716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 773 | Open in IMG/M |
| 3300009665|Ga0116135_1324437 | Not Available | 612 | Open in IMG/M |
| 3300009665|Ga0116135_1501516 | Not Available | 503 | Open in IMG/M |
| 3300009700|Ga0116217_10189022 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300009762|Ga0116130_1225194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300009824|Ga0116219_10362098 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300010339|Ga0074046_10706277 | Not Available | 592 | Open in IMG/M |
| 3300010359|Ga0126376_10541083 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1088 | Open in IMG/M |
| 3300010359|Ga0126376_13091394 | Not Available | 515 | Open in IMG/M |
| 3300010366|Ga0126379_10348244 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300010366|Ga0126379_11949650 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300010375|Ga0105239_12803763 | Not Available | 569 | Open in IMG/M |
| 3300010376|Ga0126381_101071201 | Not Available | 1164 | Open in IMG/M |
| 3300010379|Ga0136449_103592531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300010398|Ga0126383_13265420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. MZ04 | 530 | Open in IMG/M |
| 3300012096|Ga0137389_11483143 | Not Available | 574 | Open in IMG/M |
| 3300012189|Ga0137388_10570242 | Not Available | 1052 | Open in IMG/M |
| 3300012212|Ga0150985_109255588 | All Organisms → cellular organisms → Bacteria | 2540 | Open in IMG/M |
| 3300012212|Ga0150985_118790158 | Not Available | 1099 | Open in IMG/M |
| 3300012349|Ga0137387_11043572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 585 | Open in IMG/M |
| 3300012361|Ga0137360_10908810 | Not Available | 759 | Open in IMG/M |
| 3300012469|Ga0150984_110925949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1785 | Open in IMG/M |
| 3300012903|Ga0157289_10059676 | Not Available | 992 | Open in IMG/M |
| 3300012971|Ga0126369_10974592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 935 | Open in IMG/M |
| 3300013308|Ga0157375_11631962 | Not Available | 763 | Open in IMG/M |
| 3300014167|Ga0181528_10239564 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300014199|Ga0181535_10854187 | Not Available | 514 | Open in IMG/M |
| 3300014489|Ga0182018_10001338 | All Organisms → cellular organisms → Bacteria | 28332 | Open in IMG/M |
| 3300014491|Ga0182014_10041736 | All Organisms → cellular organisms → Bacteria | 3309 | Open in IMG/M |
| 3300014493|Ga0182016_10521416 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300014494|Ga0182017_10217343 | Not Available | 1216 | Open in IMG/M |
| 3300014495|Ga0182015_10841656 | Not Available | 576 | Open in IMG/M |
| 3300014501|Ga0182024_10432539 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
| 3300014638|Ga0181536_10221284 | Not Available | 926 | Open in IMG/M |
| 3300014654|Ga0181525_10031579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3154 | Open in IMG/M |
| 3300014658|Ga0181519_10781205 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300014839|Ga0182027_11116208 | Not Available | 799 | Open in IMG/M |
| 3300015197|Ga0167638_1095173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300015241|Ga0137418_10403688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1114 | Open in IMG/M |
| 3300016294|Ga0182041_10429415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatirhabdium → Desulfatirhabdium butyrativorans | 1131 | Open in IMG/M |
| 3300016422|Ga0182039_10174154 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300016445|Ga0182038_11447501 | Not Available | 616 | Open in IMG/M |
| 3300017787|Ga0183260_10083948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2322 | Open in IMG/M |
| 3300017935|Ga0187848_10433253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300017946|Ga0187879_10781257 | Not Available | 533 | Open in IMG/M |
| 3300017948|Ga0187847_10149122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1279 | Open in IMG/M |
| 3300017972|Ga0187781_10401214 | Not Available | 979 | Open in IMG/M |
| 3300017975|Ga0187782_10985205 | Not Available | 655 | Open in IMG/M |
| 3300017988|Ga0181520_10597263 | Not Available | 766 | Open in IMG/M |
| 3300017988|Ga0181520_10897238 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300018009|Ga0187884_10201759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300018014|Ga0187860_1406631 | Not Available | 509 | Open in IMG/M |
| 3300018034|Ga0187863_10504443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 677 | Open in IMG/M |
| 3300018038|Ga0187855_10008205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 7181 | Open in IMG/M |
| 3300018038|Ga0187855_10363011 | Not Available | 845 | Open in IMG/M |
| 3300018038|Ga0187855_10385641 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300018038|Ga0187855_10520653 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300018038|Ga0187855_10580357 | Not Available | 653 | Open in IMG/M |
| 3300018047|Ga0187859_10341019 | Not Available | 816 | Open in IMG/M |
| 3300018047|Ga0187859_10598306 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300018081|Ga0184625_10207106 | Not Available | 1028 | Open in IMG/M |
| 3300018086|Ga0187769_11028850 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300018422|Ga0190265_11627463 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300018468|Ga0066662_10146966 | Not Available | 1775 | Open in IMG/M |
| 3300018468|Ga0066662_12103014 | Not Available | 592 | Open in IMG/M |
| 3300019356|Ga0173481_10680341 | Not Available | 553 | Open in IMG/M |
| 3300020579|Ga0210407_11021818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. S8 | 630 | Open in IMG/M |
| 3300020583|Ga0210401_10228813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1718 | Open in IMG/M |
| 3300021168|Ga0210406_10382587 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300021402|Ga0210385_10824188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 712 | Open in IMG/M |
| 3300021477|Ga0210398_10580516 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300021479|Ga0210410_10444051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1161 | Open in IMG/M |
| 3300021560|Ga0126371_11130526 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300021560|Ga0126371_13880278 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300022522|Ga0242659_1119181 | Not Available | 538 | Open in IMG/M |
| 3300022524|Ga0224534_1017992 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
| 3300022727|Ga0224567_100271 | Not Available | 1144 | Open in IMG/M |
| 3300023090|Ga0224558_1003278 | All Organisms → cellular organisms → Bacteria | 13653 | Open in IMG/M |
| 3300023101|Ga0224557_1011371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5266 | Open in IMG/M |
| 3300023101|Ga0224557_1032996 | All Organisms → cellular organisms → Bacteria | 2595 | Open in IMG/M |
| 3300023547|Ga0247554_101419 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300024330|Ga0137417_1502149 | All Organisms → cellular organisms → Bacteria | 4379 | Open in IMG/M |
| 3300025569|Ga0210073_1015841 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300025907|Ga0207645_10325027 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300025926|Ga0207659_10560290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| 3300025929|Ga0207664_11476762 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300027619|Ga0209330_1156059 | Not Available | 514 | Open in IMG/M |
| 3300027825|Ga0209039_10269879 | Not Available | 675 | Open in IMG/M |
| 3300027826|Ga0209060_10517121 | Not Available | 541 | Open in IMG/M |
| 3300027840|Ga0209683_10286960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Zetaproteobacteria → unclassified Zetaproteobacteria → Zetaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300027854|Ga0209517_10629411 | Not Available | 563 | Open in IMG/M |
| 3300027879|Ga0209169_10300199 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae | 844 | Open in IMG/M |
| 3300027905|Ga0209415_10005525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 22674 | Open in IMG/M |
| 3300027905|Ga0209415_10016722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 11750 | Open in IMG/M |
| 3300027905|Ga0209415_10986276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 562 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10594674 | Not Available | 526 | Open in IMG/M |
| 3300028574|Ga0302153_10109185 | Not Available | 942 | Open in IMG/M |
| 3300029913|Ga0311362_11263623 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 542 | Open in IMG/M |
| 3300029999|Ga0311339_10655539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 1035 | Open in IMG/M |
| 3300030503|Ga0311370_12320571 | Not Available | 522 | Open in IMG/M |
| 3300030524|Ga0311357_10921720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 775 | Open in IMG/M |
| 3300030618|Ga0311354_10214054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2050 | Open in IMG/M |
| 3300031231|Ga0170824_109672952 | Not Available | 643 | Open in IMG/M |
| 3300031236|Ga0302324_100558158 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
| 3300031525|Ga0302326_11617876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300031708|Ga0310686_119792867 | Not Available | 504 | Open in IMG/M |
| 3300031708|Ga0310686_119839151 | Not Available | 906 | Open in IMG/M |
| 3300031753|Ga0307477_10462146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
| 3300032160|Ga0311301_10098863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 5732 | Open in IMG/M |
| 3300032160|Ga0311301_11600392 | Not Available | 793 | Open in IMG/M |
| 3300032205|Ga0307472_100282458 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300032261|Ga0306920_100491213 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300032516|Ga0315273_10537876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 1559 | Open in IMG/M |
| 3300032829|Ga0335070_11556638 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300032893|Ga0335069_12429293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 544 | Open in IMG/M |
| 3300032897|Ga0335071_10026079 | All Organisms → cellular organisms → Bacteria | 5831 | Open in IMG/M |
| 3300032897|Ga0335071_11980668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 526 | Open in IMG/M |
| 3300032954|Ga0335083_10173136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2007 | Open in IMG/M |
| 3300033158|Ga0335077_12163480 | Not Available | 512 | Open in IMG/M |
| 3300033402|Ga0326728_10327622 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300033405|Ga0326727_10497077 | Not Available | 1063 | Open in IMG/M |
| 3300033405|Ga0326727_10827675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300033482|Ga0316627_102160603 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300033887|Ga0334790_098265 | Not Available | 955 | Open in IMG/M |
| 3300034124|Ga0370483_0148884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300034124|Ga0370483_0164385 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300034147|Ga0364925_0062204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1283 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.07% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.07% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.59% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.97% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.73% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.73% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 3.11% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.48% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.48% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.86% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.86% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.24% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.24% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.24% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.24% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.24% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.24% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.24% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.24% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.24% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.24% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.24% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.24% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.62% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.62% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.62% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.62% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.62% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.62% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.62% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.62% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.62% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.62% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.62% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.62% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.62% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.62% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.62% |
| Poplar Biomass Bioreactor | Engineered → Solid Waste → Wood → Composting → Bioreactor → Poplar Biomass Bioreactor | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005504 | Poplar biomass bioreactor microbial communities from Brookhaven National Lab, NY - total biomass decay community | Engineered | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022524 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24 | Environmental | Open in IMG/M |
| 3300022727 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU3 | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300023547 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025569 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300028574 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_03443380 | 2170459010 | Grass Soil | MAMFTANDAVLPFPFRQALDRVDEQLDLLIFGAFPL |
| JGI12269J14319_102042642 | 3300001356 | Peatlands Soil | RVFRPAVAMFTGNDAVLPFPLRASLDRVDTQLDELIYQAFPQIKVA* |
| C688J35102_1208528231 | 3300002568 | Soil | DARVFRPAMAMFTANDAVLPFPLRRALNRVDDQLDKLIYNAFPLQKAS* |
| Ga0062593_1010986162 | 3300004114 | Soil | MAMFTANDAVLPFPLRQALDRVDTQLDTLIYDAFPLPKAS* |
| Ga0062589_1002665133 | 3300004156 | Soil | VFRPAVAMFTSNDAVLPFPLRASLDRVDAQLDELIYQAFPQAKAS* |
| Ga0070675_1014445961 | 3300005354 | Miscanthus Rhizosphere | RVFRPAVAMFTGNDAVLPFPLRASLDRVDTQLDELIYQAFPQAKAA* |
| Ga0070673_1017078191 | 3300005364 | Switchgrass Rhizosphere | PAMGMFTANDAVLPFPLRQALDRVDKQLDHLIYDAVPLPKAG* |
| Ga0070709_105424101 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | RPAIAMFTANDAVLPFPLRRALNRVDDQLDELIYDAFPLQNAS* |
| Ga0070705_1001954921 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MFTGNDAVLPFPLRSALDRADAQLDVLIYQAFPLPKASEE |
| Ga0074230_10001151 | 3300005504 | Poplar Biomass Bioreactor | ANDAVLPFPLRQALDRVDAQLDVLIYDAFPLPKAS* |
| Ga0070731_101249603 | 3300005538 | Surface Soil | MEGGAAVFRPAMAMLTANDAVRPFPLKRALDSVDAQLKALIYEAFPLPKAA* |
| Ga0070762_100626571 | 3300005602 | Soil | PAMAMFTASDAVLPFPLRQALDRVDTQLDLLIYDAFPLPKAS* |
| Ga0068862_1015362722 | 3300005844 | Switchgrass Rhizosphere | ANDAVLPFPLRQALNRVDKQLDRLIYDAVPLPKAG* |
| Ga0075029_1000543632 | 3300006052 | Watersheds | MAMFTANDAVLPFPLRQALDRTDAQLDLLIYDAFPLSKAS* |
| Ga0075026_1000698263 | 3300006057 | Watersheds | VFRPALAMFTANDAVLPFPLRASLNRVDQHMDELIYQAFPQAKVA* |
| Ga0075018_105885061 | 3300006172 | Watersheds | VFCPAVAAFTSDDAVLTFPLRARFDAQLDELIYRAFLQTKAS* |
| Ga0097621_1007458692 | 3300006237 | Miscanthus Rhizosphere | MAMLTANDVVRPFPLRQALDHVDKELDRLIYDVVPLQKAG* |
| Ga0075021_100725052 | 3300006354 | Watersheds | VFRPAVAAFTSDDAVLTFPLRACFDAQLDELIYRAFLQTKAS* |
| Ga0068871_1004608974 | 3300006358 | Miscanthus Rhizosphere | FTANDAVLPFPLRQALERVDKQLDRLIYDAVPLQKAG* |
| Ga0075527_102300671 | 3300006640 | Arctic Peat Soil | MFTANDAVLPFPLRQSLDRVDSQLDVLIYEAFPLPKTG* |
| Ga0073928_102506571 | 3300006893 | Iron-Sulfur Acid Spring | SKDATLPFPLRKALDRVDAQLDSLVYEGFPMAKAS* |
| Ga0066793_101344742 | 3300009029 | Prmafrost Soil | MAMFTANDAVLPFPLRRALDRTDAQLDTLIYQAFPVPKAV* |
| Ga0099830_108020271 | 3300009088 | Vadose Zone Soil | MAMFTGNDAVLPFPLRSALDRADAQLDVLIYQAFPLPKAV* |
| Ga0099827_100649414 | 3300009090 | Vadose Zone Soil | AMSMFTGNDAVLPFPLRKALDRVDAQLDFLIYEAFPIAKAS* |
| Ga0105247_115446071 | 3300009101 | Switchgrass Rhizosphere | MAMFTANDAVLPFPLKRALDRVDAQLDALIYEAFPLPKAG* |
| Ga0116222_10790142 | 3300009521 | Peatlands Soil | AMFTGNDAVLPFPLRASLDRVDTQLDELIYQAFPQIKVA* |
| Ga0116225_12042321 | 3300009524 | Peatlands Soil | MAMFTANDAVLPFTPRQALDRTDAQLDLLIYQAFPL* |
| Ga0116225_15642371 | 3300009524 | Peatlands Soil | FRPAMAMFTANDAVLPFPLRQSLDRVDSQLDALIYEAFPLPKTG* |
| Ga0116102_11127161 | 3300009632 | Peatland | MATITANDAVLPFPLRQALDRVDEQLDLLIFNAFPAQKAGEKAA* |
| Ga0116135_13244371 | 3300009665 | Peatland | RVFRPAIAMFTSNDAVLPFPLRASLNRVDSQLDELIYQAFPQAKAS* |
| Ga0116135_15015162 | 3300009665 | Peatland | MFTANDAVLPFPLKRAPDQVDAQLDALIYEALPLPKAVENLTLLDRSQLH* |
| Ga0116217_101890222 | 3300009700 | Peatlands Soil | MAFRPAMAMFTANDVVLPFPLRQALNRVDTQLVLLIYEAFPLPKAN* |
| Ga0116130_12251942 | 3300009762 | Peatland | FRPAMAMFTATDAVLPFPLRQALDRVDAQLDHLIYDAFPLPKAG* |
| Ga0116219_103620982 | 3300009824 | Peatlands Soil | VLPPARAMFTAQDAVLPFPLRSALDRVDAQLDELIYQAFPAKKAS* |
| Ga0074046_107062771 | 3300010339 | Bog Forest Soil | PAMAMFTANDAVLPFPLRQSLDRVDSQLDVLIYQSDHK* |
| Ga0126376_105410832 | 3300010359 | Tropical Forest Soil | MFAGNDAVLPFQLRASLDCVGAQLDALIHEAFPDAKAS* |
| Ga0126376_130913941 | 3300010359 | Tropical Forest Soil | FTANDAVLPFPLRQSLDRVDAELDLLIYDAFPLLKAG* |
| Ga0126379_103482443 | 3300010366 | Tropical Forest Soil | MFAGNDAVLPFQLRASLDCADAQLDALIYEAFPDAKAS* |
| Ga0126379_119496501 | 3300010366 | Tropical Forest Soil | RPAMATFTANDAVLPFPLRPALDHVDTQLDQLIYEAFPLPKAS* |
| Ga0105239_128037632 | 3300010375 | Corn Rhizosphere | FTANDAVLPFPLRQSLDRVDSQLDVLIYEAFPLPKTG* |
| Ga0126381_1010712012 | 3300010376 | Tropical Forest Soil | NDAVPPFPLRQALDRVDAQMDLLIYDAFPLPKAS* |
| Ga0136449_1035925312 | 3300010379 | Peatlands Soil | MAMFTINDAVLQFPLRQALDRVDERLVPLIFDAFPLCESQVKT* |
| Ga0126383_132654202 | 3300010398 | Tropical Forest Soil | MATFTANDAVLPFPLRQALDRVDSQLDQLIYQAFPLPKAG* |
| Ga0137389_114831431 | 3300012096 | Vadose Zone Soil | FTGNDAVLPFPLRSALDRADAQLDIVIYEACPLPKAV* |
| Ga0137388_105702422 | 3300012189 | Vadose Zone Soil | MFTSNDAVLPFPLRASLDRVDAQMEQLIYEAFPQAKAS* |
| Ga0150985_1092555883 | 3300012212 | Avena Fatua Rhizosphere | VFRPAVATFTGNDAVLPFPLRTSLNRVDAQLDQLIHDAFPHAKAS* |
| Ga0150985_1187901581 | 3300012212 | Avena Fatua Rhizosphere | VFRPAVATFTGNDTVLPFPLRASLNRVDAQLDQLIYHAFPHAKAS* |
| Ga0137387_110435722 | 3300012349 | Vadose Zone Soil | VFRPAIAMFTANDAVLPFPLRQALDRTDAQLDLLIYEAFQLQKAG* |
| Ga0137360_109088102 | 3300012361 | Vadose Zone Soil | AMAMFTANDAVLPFPLRQALDRTDAQLDLLINDAFPLPKGS* |
| Ga0150984_1109259493 | 3300012469 | Avena Fatua Rhizosphere | VFRPAVATFTGNGAVLPFPLRASLNRVDAQLDELIYNAFPKAKAS* |
| Ga0157289_100596763 | 3300012903 | Soil | MFTSNDAVLPFPLRASLDRVDAQLDELIYQAFPQAKAS* |
| Ga0126369_109745921 | 3300012971 | Tropical Forest Soil | EARVFRPAIAMFTGNDAVLPFPLRASLDRVDAQLDELIYQAFPQIKAA* |
| Ga0157375_116319622 | 3300013308 | Miscanthus Rhizosphere | NDAVLPFPLRQSLDRVDSQLDVLIYEAFPLPKTG* |
| Ga0181528_102395642 | 3300014167 | Bog | MFTSNDAVLPFPLRASLNRVDAQLDKLIYEAFPQVKVA* |
| Ga0181535_108541872 | 3300014199 | Bog | VFRSAVAIFTSNDAGLPFPLRAFLNRVDAQLNELIYGAFPQGKPS* |
| Ga0182018_100013389 | 3300014489 | Palsa | MFTGNDAVLPFPLRASLDRVEAQMDELIYEAFPQATAS* |
| Ga0182014_100417361 | 3300014491 | Bog | RVFRPAMAMFTANDAVLPFPLRQALDRVDAQLDALIYEAFPLPKAS* |
| Ga0182016_105214163 | 3300014493 | Bog | VAMFTGNDAVLPFPLRASLDRVDAQLDELIYEAFPQTKAS* |
| Ga0182017_102173433 | 3300014494 | Fen | RVFRPAMAMFTANDAVLPFPLRQALDRVDAQMDILIYEAFPLPKAS* |
| Ga0182015_108416562 | 3300014495 | Palsa | MAMLTSNDAVVPFPLRASLDRVDAQLDELIYQAFPQ |
| Ga0182024_104325391 | 3300014501 | Permafrost | ARVFRPAVAMFTGNDAVLPFPLRASLDRVDAQLDELIYEAFPQTKAS* |
| Ga0181536_102212842 | 3300014638 | Bog | DAVLPFPLRQALDRVDEQLDLLIFNAFPAQKAGEKAA* |
| Ga0181525_100315795 | 3300014654 | Bog | NDAVLPFPLRASPDRVDAQLDELIYQAFPQIKAA* |
| Ga0181519_107812052 | 3300014658 | Bog | MFTGNDAVLPFPLRASLDRVDAQLDELIYEAFPQVKVA* |
| Ga0182027_111162082 | 3300014839 | Fen | AMFTANDAVLPFPLRQALDRVDTQMDLLIYEAFPLPKAS* |
| Ga0167638_10951732 | 3300015197 | Glacier Forefield Soil | MFTANDAVLPFPLRHALESVDAQLDLLIYEAFPLPKAS* |
| Ga0137418_104036882 | 3300015241 | Vadose Zone Soil | MFTANDAVLPFPLRQALDRVDSQLDLLIYDAFPLPKAS* |
| Ga0132258_135474711 | 3300015371 | Arabidopsis Rhizosphere | RPAIAMFTGTDAVLPFQLRASLDCADAQLDALIYEAFPDAKPCEPHYVL* |
| Ga0132255_1007811362 | 3300015374 | Arabidopsis Rhizosphere | MFTGTDAVLPFQLRASLDCADAQLDALIYEAFPDAKPCEPHYVL* |
| Ga0182041_104294153 | 3300016294 | Soil | AMFTANDAVLPFPLRQALDRVDSQLDRLLYDAFPLPKAG |
| Ga0182032_111490441 | 3300016357 | Soil | VFRPAIAVFAGSDAVLPFQLRASLDCAAAQLEALIYEAFPDAKAS |
| Ga0182034_111810722 | 3300016371 | Soil | TPGRRVFRPAIAVFAGSDAVLPFQLRASLDCAAAQLEALIYEAFPDAKAS |
| Ga0182039_101741541 | 3300016422 | Soil | GSDAVLPFQLRASLDCAAAQLEALIYEAFPDAKAS |
| Ga0182038_114475012 | 3300016445 | Soil | SMFTSNDAVLPFPLRQALDRVDAQLDLLIYDAFPLPKAG |
| Ga0183260_100839483 | 3300017787 | Polar Desert Sand | VFRPAIAMFTSNDAVLPFPLRASLNRVDAQLDPLLYEAFPQAKAS |
| Ga0187848_104332532 | 3300017935 | Peatland | FTSNDAVLPFPLRQALDRTDAQLDQLIYQAFPLPKAS |
| Ga0187879_107812572 | 3300017946 | Peatland | MAMFTGNDAVLPFPLRNALDRADAQLDALIYQAFPFPKAV |
| Ga0187847_101491223 | 3300017948 | Peatland | AIAMFTSNDAVLPFPLRASLNRVDSQLDELIYQAFPQAKAS |
| Ga0187781_104012142 | 3300017972 | Tropical Peatland | MAMFTANDAVLPFPLRQALDRVDAQLDLLIYDAFPLPKAS |
| Ga0187782_109852052 | 3300017975 | Tropical Peatland | MFTANDAVLPFPLRQALDRVDAQLDLLIYDAFPLPKAS |
| Ga0181520_105972632 | 3300017988 | Bog | MAMFTANDAVLPFPLRQALDRTDAQLDQLIYDAFPPQTAA |
| Ga0181520_108972381 | 3300017988 | Bog | AMAMFTANDAVLPFPLKRALDRVDAQLDTLIYEAFPLPKAG |
| Ga0187884_102017592 | 3300018009 | Peatland | MAMFTTNDAVLPFPLRPALDRVDAQLDQLIYEAFPLPKAC |
| Ga0187860_14066312 | 3300018014 | Peatland | FRPAMAMFTANDAVLPFPLRQSLDRVDAQLDLLIYDAFPLPKAG |
| Ga0187863_105044431 | 3300018034 | Peatland | MALFTANDAVLPFPLRRALDRVAAQLNAPIYEAFPLPKTG |
| Ga0187855_100082057 | 3300018038 | Peatland | AMAMFTANDAVLPFPLRRALDSVDAQLDTLIYEAFPLPKASQKLDTFR |
| Ga0187855_103630111 | 3300018038 | Peatland | AMAMFTANDAVLPFPLRRALDSVDAQLDTLIYEAFPLPKAS |
| Ga0187855_103856412 | 3300018038 | Peatland | MAMFIGNDAVLPFPLRQALDRVDTQLDLLIYDAFPLPKASRKT |
| Ga0187855_105206531 | 3300018038 | Peatland | LEAHVFRLAMAMFTANDAVLPFPLLQALDRADKQLDDLIYDEFPLPKAS |
| Ga0187855_105803572 | 3300018038 | Peatland | VFRSAVAIFTSNDAGLPFPLRAFLNRVDAQLNELIYGAFPQGKPS |
| Ga0187859_103410192 | 3300018047 | Peatland | MAMFTGNDAVLPFPLRNALDRADAQLDALIYQAFPFPEAV |
| Ga0187859_105983062 | 3300018047 | Peatland | AMFTGNDAVLPFPLRASLDRVDAQMDELIYEAFPQAKAS |
| Ga0184625_102071061 | 3300018081 | Groundwater Sediment | MFTGNDAVLPFPLRASLERVDAQLDELIYDAFPQAKAS |
| Ga0187769_110288501 | 3300018086 | Tropical Peatland | MFTATDAVLPFPLRQALDRVDTQLDYLIYDAFPPSQAA |
| Ga0190265_116274632 | 3300018422 | Soil | VFRPAIAIFTSNDAVLPFPLRASLNRVDAQLDQLIYEAFPQVKAS |
| Ga0066662_101469661 | 3300018468 | Grasslands Soil | ARVFRPAMAMFTANDAVLPFPLRRALNRVDDQLDKLIYNAFPLQKAS |
| Ga0066662_121030142 | 3300018468 | Grasslands Soil | GNDAVLPFPLRRALDRTDDQLDTLIYQAFPYAKAS |
| Ga0173481_106803411 | 3300019356 | Soil | MFTSNDAVLPFPLRASLDRVDAQLDELIYQAFPQAKAS |
| Ga0210407_110218182 | 3300020579 | Soil | MAMFTAKDAVLPFPLRQALDRTDAQLDLLIYDAFPLEKAG |
| Ga0210401_102288134 | 3300020583 | Soil | MFTGNDAVLPFPLRSALDRADAQLDVLIYQAFPLP |
| Ga0210406_103825872 | 3300021168 | Soil | MAMFTGNDAVLPFPLRSALDRADAQLDVLIYQAFPLPTAV |
| Ga0210385_108241881 | 3300021402 | Soil | VFRPAVAMFTSNDAVLPFPLRASLDRVDAQLDELIYQAFPQAKAS |
| Ga0210398_105805162 | 3300021477 | Soil | MFTGNDAVLPFPLRASLDRVDAQLDELIYEAFPQTKAS |
| Ga0210410_104440512 | 3300021479 | Soil | VFRPAMAMFTATDAVLPFPLRQALDRTDAQLDLLIYDAFPLEKAG |
| Ga0126371_111305263 | 3300021560 | Tropical Forest Soil | ATFTANHAVLPFPLRQALDRVDTQLDQLIYEAFPLPKAS |
| Ga0126371_138802781 | 3300021560 | Tropical Forest Soil | SNDAVLPFPLRQALDRADAQLDLLIYDAFPLPKAG |
| Ga0242659_11191811 | 3300022522 | Soil | TFTSNEAVLPFPLRASLNRVDNQLDELIYQAFPQTKAS |
| Ga0224534_10179921 | 3300022524 | Soil | MAMFTANDAVLPFPLRQALDRVDAQLDALIYEAFPLPKAS |
| Ga0224567_1002711 | 3300022727 | Plant Litter | ETRVFRPAFAMFTGNDAVLPFPLRASLNRVDAQLDQLIYQAFPQSMAS |
| Ga0224558_100327815 | 3300023090 | Soil | AMFTANDAVLPFPLRQALDRVDAQLDALIYEAFPLPKAS |
| Ga0224557_10113715 | 3300023101 | Soil | MFTGNDAVLPFPLRASLDRVEAQMDELIYEAFPQATAS |
| Ga0224557_10329961 | 3300023101 | Soil | MFTGNDAVLPFPPRASLDRVNAQMGELIYEAFPQAKAS |
| Ga0247554_1014191 | 3300023547 | Soil | MATFTATDAVLPFPLRQALDRVDQQLDLLIYEAFPLPKAG |
| Ga0137417_15021496 | 3300024330 | Vadose Zone Soil | MAMFTPMTPFLPFPLRQALDRVDTQLDLLIYDAFPLPKAS |
| Ga0210073_10158413 | 3300025569 | Natural And Restored Wetlands | RPAMAMFTTNDAVLPFPLRQALDRVDTQLDLLIYEAFPIPKAS |
| Ga0207645_103250272 | 3300025907 | Miscanthus Rhizosphere | MFTANDAVLPFPLRQALDRVDKQLDHLIYDAVPLPKAG |
| Ga0207659_105602901 | 3300025926 | Miscanthus Rhizosphere | ESRVFRPAVAMFTSNDAVLPFPLRASLDRVDSQLDELIYHAFPQAKAS |
| Ga0207664_114767622 | 3300025929 | Agricultural Soil | VAMFTGNDAVLPFALRTSLDRVDAQLDELIYQAFPQIRAA |
| Ga0209330_11560591 | 3300027619 | Forest Soil | MFTSNDTVAPFPLRVSLNRVDAQLGELIYRAFPQAKAS |
| Ga0209039_102698791 | 3300027825 | Bog Forest Soil | PVFRPAMAMFTANDAVLPFPLRQSLDRVDSQLDVLIYEAFPLPKTG |
| Ga0209060_105171213 | 3300027826 | Surface Soil | MAMFTGNDAVLPFPLRQALDRLDGQLDQLIYDAFPLPKAS |
| Ga0209683_102869602 | 3300027840 | Wetland Sediment | MQRPFFGANDAVLPFPLRASLDRVDAQMDELIYTAFPQAKAS |
| Ga0209517_106294112 | 3300027854 | Peatlands Soil | RVFRLAMALFTTNDAVLPFPLRPALDGVDTQLDLLIYEAFPLPKAS |
| Ga0209169_103001991 | 3300027879 | Soil | MAMFTANDAVLPFPLRQALDRVDTQLDLLIYDAFPLEKAG |
| Ga0209415_1000552532 | 3300027905 | Peatlands Soil | PAVAMFTGNDAVLPFPLRASLDRVDTQLDELIYQAFPQIKVA |
| Ga0209415_100167228 | 3300027905 | Peatlands Soil | PAVAMFTGNDAVLPFPLRASLDRVDAQLDELIYQAFPQIKVA |
| Ga0209415_109862762 | 3300027905 | Peatlands Soil | MAMFTANDAVLPFTPRQALDRTDAQLDLLIYQAFPL |
| (restricted) Ga0233417_105946741 | 3300028043 | Sediment | ESRVFRPAVAMFTGNDAVLPFPLRASLDRVDAQMDELIYTAFPQAKAS |
| Ga0302153_101091853 | 3300028574 | Bog | FTSNDAVLPFPLRRSLDSVDRQLDHLIDLAFPQTKAS |
| Ga0311362_112636231 | 3300029913 | Bog | FRPAVAMFTSNDAVLPLPLRASLNRVDSQLDELIYQAFPQAKTSSKTLNKS |
| Ga0311339_106555391 | 3300029999 | Palsa | AIATFTSNDAVLPFPLRASLKRVDNQLDQLIYQAFPQSKVA |
| Ga0311370_123205712 | 3300030503 | Palsa | PAMAMFTANDAVLPFPLKRALDRVDAQLDTLIYEAFPLPKAS |
| Ga0311357_109217203 | 3300030524 | Palsa | PAMAMFTSNDAVVPFPLRASLNRVDAQLDELIYRAFPQAKAS |
| Ga0311354_102140541 | 3300030618 | Palsa | MFTGNHAVLPFFLRQALDRIDAQLDLLVYDAFPLPKTS |
| Ga0170824_1096729521 | 3300031231 | Forest Soil | MAMITANDAVLPFPLRQALDRVDEQLDLLIYDAFPLEKAS |
| Ga0302324_1005581583 | 3300031236 | Palsa | AMFTSNDAVVPFPLRASLNRVDAQLDELIYQAFPQAKAS |
| Ga0302326_116178761 | 3300031525 | Palsa | MFTANDAVLPFPLRRALNRVDDQLDELIYDAFPLQKAS |
| Ga0310686_1197928672 | 3300031708 | Soil | TSNDAVLPFPLRASLDRVDAQLDELIYQAFTSSKAS |
| Ga0310686_1198391512 | 3300031708 | Soil | FRPAVAMFTSNDAVLPFPLRASLDRVDALDELIYQAFPSSKAS |
| Ga0307477_104621462 | 3300031753 | Hardwood Forest Soil | MSMFTANDAVLPFPLRQALDRVDGQLDLLIYDAFPLPKAS |
| Ga0306925_102664523 | 3300031890 | Soil | FRPAIAVFAGSDAVLPFQLRASLDCAAAQLEALIYEAFPDAKAS |
| Ga0310912_112269151 | 3300031941 | Soil | VFRPAIAVFAGSDAVLPFQLRASLDCAAAQLEALIYEAFPDA |
| Ga0311301_100988631 | 3300032160 | Peatlands Soil | MAFRPAMAMFTANDVVLPFPLRQALNRVDTQLVLLIYEAFPLPKAN |
| Ga0311301_116003923 | 3300032160 | Peatlands Soil | TFTANDAVLPFPLRQALDGVDTQLDELIYEAFPLPKAS |
| Ga0307472_1002824582 | 3300032205 | Hardwood Forest Soil | MAMFSGNDDVLPFPLRSALDRADAQLDVLIYQAFPLPTAV |
| Ga0306920_1004912131 | 3300032261 | Soil | MFTGNDAVLPFPLRQALDRVDAQLDLLIYDAFPLPKAA |
| Ga0315273_105378763 | 3300032516 | Sediment | RVFRSAMSMFTAHDAVLPFPLRQALDRVDAQLDTLIYGAFPLPKAS |
| Ga0335070_115566381 | 3300032829 | Soil | FRPAMAMFTATDAVLPFPLRQALDRVDSQLDHLIYEAFPLPKAG |
| Ga0335069_124292932 | 3300032893 | Soil | MAMSTASDAVLPFPLRQALDRVDTQLDVLIYDAFPLPKAS |
| Ga0335071_100260794 | 3300032897 | Soil | MATFTANDAVLPFPLRRALDRVDSQLDQLIYDAFPLPKAG |
| Ga0335071_119806682 | 3300032897 | Soil | TSNDAVLPFPLRASLDRVDAQLDELIYDAFPQAKAS |
| Ga0335083_101731361 | 3300032954 | Soil | TANDAVLPFPLRQALDRVDTQLDHLIYDAFPLPKAG |
| Ga0335077_121634801 | 3300033158 | Soil | TSNDAVLPFPLRASLHRVDAQLDHLVYQAFPQTKAA |
| Ga0326728_103276221 | 3300033402 | Peat Soil | EARVFRPAVAMFTSNDAVLPFPLRASLNRVDAQLDELIYEAFPQAKAS |
| Ga0326727_104970771 | 3300033405 | Peat Soil | PAMAMFTANDAVLPFPLRQALDRVDAQLDQLIYDAFPLPKAS |
| Ga0326727_108276751 | 3300033405 | Peat Soil | VAIFTGNDAVLPLPLRASLDRVDAQMDELIYEAFPQTKAS |
| Ga0316627_1021606031 | 3300033482 | Soil | TAHDAVLPFPLRQALDRVDAQLDTLIYGAFPLPKAS |
| Ga0334790_098265_696_818 | 3300033887 | Soil | MAMFPSNDAVVPFPLRASLDRVDAQLDELIYQAFPQAKAS |
| Ga0370483_0148884_592_714 | 3300034124 | Untreated Peat Soil | MAMFTSNDAVLPFPLRASLNRVDDQLDQLIYDAFPQLKAS |
| Ga0370483_0164385_265_381 | 3300034124 | Untreated Peat Soil | MFTGNDAVLPFPLRASLDRVDAQMDELIYEAFPQTKAS |
| Ga0364925_0062204_1168_1281 | 3300034147 | Sediment | FTGNDAVLPFPLRTSLNRVDAQLDELIYDAFPQAKAS |
| ⦗Top⦘ |