Basic Information | |
---|---|
Family ID | F040817 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 161 |
Average Sequence Length | 43 residues |
Representative Sequence | HFDAAVAAFNKCAAIPGSLQPTCKNGADEAKKLGATQLSAPK |
Number of Associated Samples | 140 |
Number of Associated Scaffolds | 161 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.76 % |
% of genes from short scaffolds (< 2000 bps) | 91.30 % |
Associated GOLD sequencing projects | 137 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.65 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.516 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.118 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.466 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.143 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.71% β-sheet: 0.00% Coil/Unstructured: 54.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 161 Family Scaffolds |
---|---|---|
PF14622 | Ribonucleas_3_3 | 86.96 |
PF10502 | Peptidase_S26 | 5.59 |
PF00717 | Peptidase_S24 | 4.97 |
PF13414 | TPR_11 | 0.62 |
PF05170 | AsmA | 0.62 |
COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
---|---|---|---|
COG2982 | Uncharacterized conserved protein AsmA involved in outer membrane biogenesis | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.52 % |
Unclassified | root | N/A | 2.48 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001356|JGI12269J14319_10259643 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300001545|JGI12630J15595_10010497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2000 | Open in IMG/M |
3300001593|JGI12635J15846_10083057 | All Organisms → cellular organisms → Bacteria | 2338 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100046980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3915 | Open in IMG/M |
3300004080|Ga0062385_10564182 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300004092|Ga0062389_100863850 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
3300004479|Ga0062595_100438804 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300005179|Ga0066684_10400750 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300005184|Ga0066671_10757238 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300005446|Ga0066686_10369459 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
3300005526|Ga0073909_10617818 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300005537|Ga0070730_10356954 | Not Available | 950 | Open in IMG/M |
3300005538|Ga0070731_10796490 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300005541|Ga0070733_10764959 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300005542|Ga0070732_10921806 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300005552|Ga0066701_10582090 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300005554|Ga0066661_10309093 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300005591|Ga0070761_10434530 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300005598|Ga0066706_10045320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2935 | Open in IMG/M |
3300005598|Ga0066706_10217153 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
3300005950|Ga0066787_10006063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1836 | Open in IMG/M |
3300006046|Ga0066652_101340768 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300006102|Ga0075015_100564904 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300006173|Ga0070716_100108110 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
3300006174|Ga0075014_100200156 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300006354|Ga0075021_10581287 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300006893|Ga0073928_10527459 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300006954|Ga0079219_10908271 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300006954|Ga0079219_11456823 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300007255|Ga0099791_10280314 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300007265|Ga0099794_10372402 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300009012|Ga0066710_100759143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1484 | Open in IMG/M |
3300009038|Ga0099829_11628517 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300009088|Ga0099830_11472856 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300009088|Ga0099830_11831025 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300009089|Ga0099828_10654723 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300009137|Ga0066709_101163890 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
3300009521|Ga0116222_1305053 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300010339|Ga0074046_10612116 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300010343|Ga0074044_10289993 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
3300010343|Ga0074044_11009664 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300010359|Ga0126376_13203632 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300010360|Ga0126372_10108524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2109 | Open in IMG/M |
3300010360|Ga0126372_10551137 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300010360|Ga0126372_11951798 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300010364|Ga0134066_10265391 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300011269|Ga0137392_11457757 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300011270|Ga0137391_11308899 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300011271|Ga0137393_10341258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1279 | Open in IMG/M |
3300012096|Ga0137389_10149162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1912 | Open in IMG/M |
3300012096|Ga0137389_10258089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1466 | Open in IMG/M |
3300012189|Ga0137388_10358493 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
3300012189|Ga0137388_11017039 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300012200|Ga0137382_10228243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1285 | Open in IMG/M |
3300012285|Ga0137370_10224557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1107 | Open in IMG/M |
3300012349|Ga0137387_10686740 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300012359|Ga0137385_10975507 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300012361|Ga0137360_11161402 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300012917|Ga0137395_10726428 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300012918|Ga0137396_10045447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2987 | Open in IMG/M |
3300012924|Ga0137413_10737706 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300012927|Ga0137416_10972839 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300012944|Ga0137410_11003696 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300012948|Ga0126375_11340201 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300012960|Ga0164301_11424623 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300012977|Ga0134087_10220359 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300015053|Ga0137405_1384309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2317 | Open in IMG/M |
3300015241|Ga0137418_10867859 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300015264|Ga0137403_11105843 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300016294|Ga0182041_10235420 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
3300016387|Ga0182040_11130844 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300017934|Ga0187803_10004926 | All Organisms → cellular organisms → Bacteria | 5297 | Open in IMG/M |
3300017966|Ga0187776_10696444 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300017974|Ga0187777_10365821 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300018006|Ga0187804_10217335 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300018006|Ga0187804_10310231 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300019789|Ga0137408_1119386 | All Organisms → cellular organisms → Bacteria | 2123 | Open in IMG/M |
3300020580|Ga0210403_11288102 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300020581|Ga0210399_10421992 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
3300021086|Ga0179596_10732522 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300021151|Ga0179584_1270589 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300021168|Ga0210406_10144255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2001 | Open in IMG/M |
3300021168|Ga0210406_10875285 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300021170|Ga0210400_10968047 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300021180|Ga0210396_11065809 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300021180|Ga0210396_11496661 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300021181|Ga0210388_11256187 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300021181|Ga0210388_11491119 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300021181|Ga0210388_11522385 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300021384|Ga0213876_10341982 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300021406|Ga0210386_10298352 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
3300021406|Ga0210386_10386759 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
3300021406|Ga0210386_10874540 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300021420|Ga0210394_10716568 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300021474|Ga0210390_10613379 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300021477|Ga0210398_11207854 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300021478|Ga0210402_10229338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1712 | Open in IMG/M |
3300021479|Ga0210410_10093147 | All Organisms → cellular organisms → Bacteria | 2656 | Open in IMG/M |
3300021559|Ga0210409_10200078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1820 | Open in IMG/M |
3300022507|Ga0222729_1063313 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300024251|Ga0247679_1078780 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300024288|Ga0179589_10147043 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300025498|Ga0208819_1058052 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300025899|Ga0207642_11066384 | Not Available | 522 | Open in IMG/M |
3300026215|Ga0209849_1053262 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300026277|Ga0209350_1067556 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300026306|Ga0209468_1108173 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300026320|Ga0209131_1070342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1914 | Open in IMG/M |
3300026328|Ga0209802_1057398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1895 | Open in IMG/M |
3300026330|Ga0209473_1166613 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300026376|Ga0257167_1077500 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300026540|Ga0209376_1243931 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300026550|Ga0209474_10218503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1202 | Open in IMG/M |
3300026887|Ga0207805_1004119 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
3300026959|Ga0207852_1008737 | Not Available | 1125 | Open in IMG/M |
3300026999|Ga0207949_1027166 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300027105|Ga0207944_1013841 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300027633|Ga0208988_1042901 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
3300027674|Ga0209118_1070840 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300027676|Ga0209333_1199696 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300027684|Ga0209626_1094282 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300027703|Ga0207862_1199698 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300027821|Ga0209811_10146213 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300027829|Ga0209773_10222125 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300027884|Ga0209275_10054870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1928 | Open in IMG/M |
3300027903|Ga0209488_10507969 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300028746|Ga0302233_10073316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1374 | Open in IMG/M |
3300030596|Ga0210278_1145603 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300030730|Ga0307482_1251020 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300030743|Ga0265461_11295708 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300030743|Ga0265461_12728834 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10218942 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300031446|Ga0170820_13548465 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300031549|Ga0318571_10367378 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300031640|Ga0318555_10077548 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
3300031682|Ga0318560_10264726 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300031715|Ga0307476_10345476 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300031720|Ga0307469_10353790 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
3300031720|Ga0307469_11670324 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300031782|Ga0318552_10416714 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300031833|Ga0310917_10795078 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300031896|Ga0318551_10437217 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300031910|Ga0306923_12111871 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300031912|Ga0306921_11937483 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300031942|Ga0310916_10408592 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
3300031942|Ga0310916_11117059 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300031962|Ga0307479_10611792 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300032001|Ga0306922_12132956 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300032059|Ga0318533_10142627 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
3300032076|Ga0306924_10255542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2012 | Open in IMG/M |
3300032180|Ga0307471_100064983 | All Organisms → cellular organisms → Bacteria | 3108 | Open in IMG/M |
3300032180|Ga0307471_100465828 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
3300032261|Ga0306920_101381586 | Not Available | 1010 | Open in IMG/M |
3300032261|Ga0306920_103451677 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300032261|Ga0306920_103858523 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300032783|Ga0335079_10390768 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
3300032828|Ga0335080_11837852 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300033004|Ga0335084_10372348 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
3300033158|Ga0335077_10194093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2289 | Open in IMG/M |
3300033480|Ga0316620_10623009 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300033755|Ga0371489_0137053 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.12% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.07% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.59% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.59% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.35% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.73% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.11% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.11% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.48% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.86% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.86% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.86% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.86% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.86% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.24% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.24% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.24% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.24% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.24% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.24% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.62% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.62% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.62% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.62% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.62% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.62% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.62% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.62% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026887 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 49 (SPAdes) | Environmental | Open in IMG/M |
3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
3300027105 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF018 (SPAdes) | Environmental | Open in IMG/M |
3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030596 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12269J14319_102596432 | 3300001356 | Peatlands Soil | SAFNKCAAIPGSLQPTCKSGSEEAKKLGATQLSAPK* |
JGI12630J15595_100104971 | 3300001545 | Forest Soil | KTSHFDDSIAAYNKCAATAGAMQETCKKGAEESKKLGGTQLSAPK* |
JGI12635J15846_100830571 | 3300001593 | Forest Soil | FNKCASMAGPLQGTCKTQAEDAKKLGTTQLSAPK* |
JGIcombinedJ26739_1000469804 | 3300002245 | Forest Soil | HFDDSIAAYNKCAATAGAMQETCKKGAEESKKLGGTQLSAPK* |
Ga0062385_105641822 | 3300004080 | Bog Forest Soil | ASHFQDAAAAFTKCASMPSSMQQTCKSGAEEAKKLSNTQLSVPK* |
Ga0062389_1008638501 | 3300004092 | Bog Forest Soil | ADEKTSHFDAAVTAFTKCAAVPGSLQPTCKNGAEEAKKLGSTQLSAPK* |
Ga0062595_1004388042 | 3300004479 | Soil | LGVVNQNTSHFDAAAAAYAHCAGIAGSLQNTCKTKSDEAKKLAATKLSAPK* |
Ga0066684_104007501 | 3300005179 | Soil | STSHFDDAITAFNKCAAVPGAMQAVCKAQADDAKKKSTTELSAPK* |
Ga0066671_107572381 | 3300005184 | Soil | KSTSHFDDAIAAFNKCAAITGQMQNICKTQAEDAKKKSATELSAPK* |
Ga0066686_103694591 | 3300005446 | Soil | SHFDDAVKAFSKCAEIQGPMQANCKQGVEEAKKLGATQLSAPK* |
Ga0073909_106178182 | 3300005526 | Surface Soil | VVNQNTSHFDAAVAAYAHCAGIAGSLQNTCKTKSDEAKKLAATKLSAPK* |
Ga0070730_103569541 | 3300005537 | Surface Soil | HFEDAVNAFTKCAAVPGGLQATCKSGADEAKKMATTQLSAPK* |
Ga0070731_107964901 | 3300005538 | Surface Soil | TSHFDAAVAAFTKCAAIPGGLQATCKNGAEEAKKLGANNLSAPK* |
Ga0070733_107649591 | 3300005541 | Surface Soil | KTSHFDAAVAAFNKCATVPGSLQPTCKSQAEEAKKLGATQLSAPK* |
Ga0070732_109218062 | 3300005542 | Surface Soil | FEDAVNAFTKCAAVPGGLQATCKTGADEAKKMATTQLSAPK* |
Ga0066701_105820901 | 3300005552 | Soil | MANKITSHFDDAVAAFNKCAAMNGPMQGTCKAQGEDAKKLGATQLSAPK* |
Ga0066661_103090933 | 3300005554 | Soil | FNKCAAMNGPMQGTCKAQAEDAKKLGATQLSAPK* |
Ga0070761_104345302 | 3300005591 | Soil | EKTSHFDAAVAAFNKCAAVPGSLQPTCKSNAEEAKKLGATQLSAPK* |
Ga0066706_100453204 | 3300005598 | Soil | ITSHFDDAVAAFNKCAAMTGPLQGTCKTQAEDAKKLGTTHLSAPK* |
Ga0066706_102171532 | 3300005598 | Soil | VANKNTSQIDDAITAFNKCASSPGQMQPVCKAQADDTKKKSSTELSAPK* |
Ga0066787_100060633 | 3300005950 | Soil | KASHFDDAIAAYDKCALAIKPMQDTCKKAAEEAKKLAATQLSAPK* |
Ga0066652_1013407681 | 3300006046 | Soil | LGVANQNTSHFDAAAAAYTHCASIAGSLQNTCKTKSDEAKKLAATKLSAPK* |
Ga0075015_1005649042 | 3300006102 | Watersheds | AFTKCAAIPGGLQATCKNSIDEAKKLGATQLSAPK* |
Ga0070716_1001081101 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AVAAFNKCAAMTGPLQGTCKTQAEDAKKLGTTQLSAPK* |
Ga0075014_1002001561 | 3300006174 | Watersheds | FTKCAAIPGGLQATCKNSIDEAKKLGATQLSAPK* |
Ga0075021_105812872 | 3300006354 | Watersheds | TSHFDDAVAAFNKCVAMAGPMQGTCKAQADDAKKLGATQLSAPK* |
Ga0073928_105274591 | 3300006893 | Iron-Sulfur Acid Spring | ISDEKASHFDDAVAAFTKCSTFPGGMQATCKGKIDEAKKLGATQLSAPK* |
Ga0079219_109082711 | 3300006954 | Agricultural Soil | EKTSHFDAAATAFSKCAGITGNLQQTCKSGEAEAKKQGSSQLSAPN* |
Ga0079219_114568231 | 3300006954 | Agricultural Soil | KGTSHFDDAITAFNKCAAIPGQMQAACKAQAEDTKKKSTTELSAPK* |
Ga0099791_102803142 | 3300007255 | Vadose Zone Soil | SHFDDAVAAFNHCVAMPGAMQTVCKSGADEAKKLGSTQLSSPK* |
Ga0099794_103724022 | 3300007265 | Vadose Zone Soil | AVAAFNHCVAMPGTMQATCKSAADEAKKLGSTQLSSPK* |
Ga0066710_1007591431 | 3300009012 | Grasslands Soil | ASHFDDAVKAFSKCAEILGPMQANCKQGVEEAKKLGATQLSAPK |
Ga0099829_116285172 | 3300009038 | Vadose Zone Soil | NVKASHFDDAAIAFNKCAAIAGSLQNTCKNGADEAKKQGSTQLSAPK* |
Ga0099830_114728562 | 3300009088 | Vadose Zone Soil | FDDAITAFNKCATMAGPMQATCKAQADDTKKKSSTELNAPK* |
Ga0099830_118310252 | 3300009088 | Vadose Zone Soil | MANKVTSHFDDAIAAFNKCATMTGPLQGTCKAQAEDAKKLGATQLSAPK* |
Ga0099828_106547231 | 3300009089 | Vadose Zone Soil | KVTSHFDDAIAAFNKCATMTGPMQGTCKSQAEDAKKLGATQLSAPK* |
Ga0066709_1011638901 | 3300009137 | Grasslands Soil | VNQNTSHFDAAAAAYTHCASIAGSLQNTCKTKSDEAKKLAATKLSAPK* |
Ga0116222_13050531 | 3300009521 | Peatlands Soil | KGSHFDDAITAFTKCASFPGGLQPTCKAGIEEVKKLSATQLNVPR* |
Ga0074046_106121161 | 3300010339 | Bog Forest Soil | ITAFTKCASMPGGMQDPCKSGLEEAKKFSTTQLSTPK* |
Ga0074044_102899931 | 3300010343 | Bog Forest Soil | ICNQNTSHFEDAITAYTKCSEIPGGLQATCKTKIDEAKKLAATQLSAPK* |
Ga0074044_110096642 | 3300010343 | Bog Forest Soil | FDDAVLAFTKCAAIPGGLQTTCTQNAEEAKKLAATQLSAPK* |
Ga0126376_132036321 | 3300010359 | Tropical Forest Soil | HFEDAVAAFTKCAAMPSSLAGTCKGLIEEAKKLASTQLSAPK* |
Ga0126372_101085241 | 3300010360 | Tropical Forest Soil | DDAIAAFNKCAAMTGTMQATCKAQADDAKKKSATELSAPK* |
Ga0126372_105511373 | 3300010360 | Tropical Forest Soil | LANDKTSHFDAAATAFSKCAAIQSSLQATCKNGAEEVKKKGATQLSAPN* |
Ga0126372_119517982 | 3300010360 | Tropical Forest Soil | SHFDDAITAFNKCAAIAGPMQPTCKSQADDAKKKSATELSAPK* |
Ga0134066_102653912 | 3300010364 | Grasslands Soil | TSHFDDAVAAFNKCAAMTGPLQGTCKTQAEDAKKLGTTQLSAPK* |
Ga0137392_114577571 | 3300011269 | Vadose Zone Soil | NEKTSHFEDAANAFTKCAAVPGGLQATCKSGVDEAKKMATTQLSAPK* |
Ga0137391_113088992 | 3300011270 | Vadose Zone Soil | SHFDDAIAAFNKCTAMAGPMQGTCKAQAEDAKKLGATQLSAPK* |
Ga0137393_103412581 | 3300011271 | Vadose Zone Soil | SHFDDAITAFNKCATMAGPMQATCKAQADDTKKKSSTELNAPK* |
Ga0137389_101491621 | 3300012096 | Vadose Zone Soil | DAIVAFNKCAAIAGPMQPTCKAQADDTKKKSATELSAPK* |
Ga0137389_102580891 | 3300012096 | Vadose Zone Soil | ATAFTKCAAVPGGLQATCKTGADEAKKMATTQLSAPK* |
Ga0137388_103584933 | 3300012189 | Vadose Zone Soil | NQKASHFDDAVAAFNKCAGMQSSLQGTCKTLAEEAKKLGATQLSAPK* |
Ga0137388_110170392 | 3300012189 | Vadose Zone Soil | NAFTKCAAVPGGLQATCKSGADEAKKMATTQLSAPK* |
Ga0137382_102282431 | 3300012200 | Vadose Zone Soil | HFDDAIVAFNKCTTMTGPLQGTCKAQAEDAKKQSATQLSAPK* |
Ga0137370_102245573 | 3300012285 | Vadose Zone Soil | FNKCAAMTGPMQGTCKTQAEDAKKLGATQLSAPK* |
Ga0137387_106867402 | 3300012349 | Vadose Zone Soil | VAAFNKCAAMTGPMQGTCKAQAEDAKKLGATQLSAPK* |
Ga0137385_109755071 | 3300012359 | Vadose Zone Soil | NQNTSHFDAAAAAYTRCASIASSLQNTCKTKSDEAKKLAATKLSAPK* |
Ga0137360_111614021 | 3300012361 | Vadose Zone Soil | NTSHFDAAAAAYSHCAAIAGSLQGTCKTKTDEAKKLAATKLSAPK* |
Ga0137395_107264282 | 3300012917 | Vadose Zone Soil | VAAFNKCAAMTGPMQGICKTQAEDAKKAGATQLSAPK* |
Ga0137396_100454474 | 3300012918 | Vadose Zone Soil | MANKVTSHFDDAISVFYKCAAMTGPLQVTCKAQAEDAKKLSTTQLSAPK* |
Ga0137413_107377061 | 3300012924 | Vadose Zone Soil | VSAFNKCAAVPGGLQATCKSGADEAKKMATTQLSAPK* |
Ga0137416_109728391 | 3300012927 | Vadose Zone Soil | DDAVAAFNKCAAMTGPMQVTCKTQVDDAKKLGATQLSAPK* |
Ga0137410_110036961 | 3300012944 | Vadose Zone Soil | NQNTSHFDAAAAAFGHCASIISALQNTCKTKSEEAKKLAATQLSAPK* |
Ga0126375_113402011 | 3300012948 | Tropical Forest Soil | TSHFDDAITAFNKCAAIAGPMQPTCKSQADDAKKKSASELSAPK* |
Ga0164301_114246231 | 3300012960 | Soil | AAAAAFNKCAAIQSSLQPTCKAGADEAKKAGSSQLSAPN* |
Ga0134087_102203591 | 3300012977 | Grasslands Soil | HFDDAVTAFNKCAAIVGPMQNACKTQADDTKKKSSTELSAPK* |
Ga0137405_13843093 | 3300015053 | Vadose Zone Soil | VAFNKCVAIAGPMQGTCKAQSDDAKKLGATELSAPK* |
Ga0137418_108678591 | 3300015241 | Vadose Zone Soil | VAAFNKCATMAGPMQGTCKTQADDAKKLGATQLSAPK* |
Ga0137403_111058431 | 3300015264 | Vadose Zone Soil | DAITAFNKCAAMTGPMQVTCKSQAEDAKKLSTTQLSAPK* |
Ga0182041_102354203 | 3300016294 | Soil | FCNQKTSHFDDAVAAYQKCAAIPSGMQTTCTQGAEEAKKLAATQLSAPK |
Ga0182040_111308442 | 3300016387 | Soil | DAVAAFTKCAAIPGGLQATCKGNIDEAKKLAATQLSAPK |
Ga0187803_100049261 | 3300017934 | Freshwater Sediment | NQKAAHYDDAVAAFTKCAAAPGGLQSTCKAGMEEAKKLAATQLSAPK |
Ga0187776_106964441 | 3300017966 | Tropical Peatland | AIAAFNKCAETAGPMQPTCKAQAEDAKKKSATELSAPK |
Ga0187777_103658211 | 3300017974 | Tropical Peatland | TSHFDDAVAAYQKCAAIPSGMQATCTQGAEEAKKLGATQLSAPK |
Ga0187804_102173351 | 3300018006 | Freshwater Sediment | VTAFTKCAAIPSGMQATCTENIQEAKKLAATQLSVPK |
Ga0187804_103102312 | 3300018006 | Freshwater Sediment | HFDAAVTDFTKCSDMPGGLQATCKTHIDEAKKLGATQLSAPK |
Ga0137408_11193864 | 3300019789 | Vadose Zone Soil | KGASHFDDAVAAFNHCVAMPGAMQAVCKSGADEAKKLGSTQLSSPK |
Ga0210403_112881022 | 3300020580 | Soil | TAFNKCAAVPGSLQPTCKSGADEAKKLGATQLSAPK |
Ga0210399_104219921 | 3300020581 | Soil | NDKTSHFEAAATAFTKCAAIQSSLQPTCKNGAEESKKHASTQLSAPN |
Ga0179596_107325221 | 3300021086 | Vadose Zone Soil | ANKITSHFDDAVAAFNKCAAMTGPLQGTCKTQAEDAKKLGTTQLSAPK |
Ga0179584_12705891 | 3300021151 | Vadose Zone Soil | AFNKCAAMTGPMQVTCKTQVDDAKKLGATQLSAPK |
Ga0210406_101442551 | 3300021168 | Soil | FDAAVAAFTKCASIPGTLQPTCKNGAEEAKKLGATQLSAPK |
Ga0210406_108752851 | 3300021168 | Soil | DAIAAFTKCAAFPGSLAQTCKGGAEEAKKLSATQLSAPK |
Ga0210400_109680471 | 3300021170 | Soil | HFDAAVAAFTKCAAIPGSLQPTCKNGADEAKKLGATQLSAPK |
Ga0210396_110658091 | 3300021180 | Soil | DEKTSHFDGAVTAFNKCAAIPGSLQATCKSGSEEAKKLGSTQLSAPK |
Ga0210396_114966612 | 3300021180 | Soil | FEDAVNAFTKCAAVPSGLQTTCKSGADEAKKMATTQLSAPK |
Ga0210388_112561872 | 3300021181 | Soil | FEDAVSAFTKCAAVPGGLQATCKSGADEARKMATTQLSAPK |
Ga0210388_114911191 | 3300021181 | Soil | SDEKTSHFDAAVAAFVKCSTIPGSLQPTCKSGAEEAKKLGSTQLSAPK |
Ga0210388_115223851 | 3300021181 | Soil | TDFTKCSELPGGLQATCKTNIDEAKKLGATQLSAPK |
Ga0213876_103419822 | 3300021384 | Plant Roots | HFDAAAAAFTKCAAIQSSLQANCKSGIETAKKANSTQLSAPK |
Ga0210386_102983523 | 3300021406 | Soil | GPPNEKTSHFEDAVNAFTKCAAVPGGLQTTCKSGADEAKKMATTQLSAPK |
Ga0210386_103867591 | 3300021406 | Soil | AVTDFTKCSDIPGGIQAACKTQIDEAKKLSTTQLSAPK |
Ga0210386_108745401 | 3300021406 | Soil | DAAVAAFTKCAAIQSSLQANCKSGIDTAKKANSTQLSAPK |
Ga0210394_107165682 | 3300021420 | Soil | AVAAYTKCAAIQSSLQPNCKQGIESAKKASSTQLSAPN |
Ga0210390_106133791 | 3300021474 | Soil | HFDAAVTAFNKCAAVPGSLQPTCKSGADEAKKLGATQLSAPK |
Ga0210398_112078541 | 3300021477 | Soil | EKTSHFDAAVSAFNKCAAIPGSLQPTCKSGAEEAKKLGATQLSAPK |
Ga0210402_102293383 | 3300021478 | Soil | NQNTSHFDDAAAAFGKCALIAGQLQDTCKGKAEEAKKLAASKLSAPK |
Ga0210410_100931474 | 3300021479 | Soil | HFDAAVTAYSKCASIPGSLQPTCKNGVEQAKKLGATQLSAPK |
Ga0210409_102000781 | 3300021559 | Soil | HFDDSVAAYNKCAATAGAMQETCKKGAEEAKKLAATQLSAPK |
Ga0222729_10633131 | 3300022507 | Soil | KNASHFDDAVAAFNKCAAMNGQMQANCKNGAEDAKKLGSTQLSAPK |
Ga0247679_10787801 | 3300024251 | Soil | NQNTSHFDAAAAAYTHCASIAGSLQNTCKTKSDEAKKLAATKLSAPK |
Ga0179589_101470431 | 3300024288 | Vadose Zone Soil | AVSAFNKCAAVPGGLQATCKSGADEAKKMATTQLSVPK |
Ga0208819_10580521 | 3300025498 | Peatland | DAIAAFTKCASFPGGLQPTCKAGIEEVKKLAATQLNVPR |
Ga0207642_110663842 | 3300025899 | Miscanthus Rhizosphere | TSHYEAAATAFNKCAAIQSSLQPTCKAGADEAKKAGSTQMSAPN |
Ga0209849_10532622 | 3300026215 | Soil | SHFEDAIAAFTKCAAIPNSLQATCKSGIDEAKKLSATQLSVPK |
Ga0209350_10675563 | 3300026277 | Grasslands Soil | NKSTSHFDDAVAAFNKCAAMTGPLQGTCKTQAEDAKKLGTTQLSAPK |
Ga0209468_11081732 | 3300026306 | Soil | ANKITSHFDDAVAAFNKCAAMNGPMQGTCKAQGEDAKKLGATQLSAPK |
Ga0209131_10703421 | 3300026320 | Grasslands Soil | ISNEKTSHFDDAVSAFTKCAAVPGVLQATCKTGADEARKMATTQLSAPK |
Ga0209802_10573981 | 3300026328 | Soil | HFDDATAVFNKCAAMTGPLQGTCKAQAEDAKKLGATQLSAPK |
Ga0209473_11666131 | 3300026330 | Soil | TSHFDDAVAAFNKCAAMNGPMQGTCKAQGEDAKKLGATQLSAPK |
Ga0257167_10775001 | 3300026376 | Soil | FDDSVAAFNKCATMAGPMQGTCKTQADDAKKLGATQLSAPK |
Ga0209376_12439311 | 3300026540 | Soil | DATAVFNKCAAMTGPLQGTCKAQAEDAKKLGATQLSAPK |
Ga0209474_102185033 | 3300026550 | Soil | NKITSHFDDAVAAFNKCAAMTGPLQGTCKTQAEDAKKLGTTQLSAPK |
Ga0207805_10041191 | 3300026887 | Tropical Forest Soil | VAAFTKCAAIPGGLQATCKNNIEEAKKLAATQLSAPK |
Ga0207852_10087371 | 3300026959 | Tropical Forest Soil | CQQKTSHFDDAVAAFTKCAAIPGGLQATCKNNIEEAKKLAATQLSAPK |
Ga0207949_10271662 | 3300026999 | Forest Soil | SHFDDAIAAFNKCTAMAGPMQGTCKAQAEDAKKKSATELSAPK |
Ga0207944_10138411 | 3300027105 | Forest Soil | EDAVNAFTKCAAVPGGLQATCKTGADEAKKMATTQLSAPK |
Ga0208988_10429011 | 3300027633 | Forest Soil | MANKVTSHFDDSVAAFNKCATMAGPMQGTCKTQADDAKKLGATQLSAPK |
Ga0209118_10708401 | 3300027674 | Forest Soil | KTSHFDDSAAAYNKCAATAGAMQETCKKGAEESKKLGATQLSAPK |
Ga0209333_11996962 | 3300027676 | Forest Soil | VAAFTKCAAIQGSLQANCKSGIESAKKASSTQLSAPK |
Ga0209626_10942822 | 3300027684 | Forest Soil | DSVTAYNKCAATAGAMQETCKKGAEESKKLGATQLSAPK |
Ga0207862_11996981 | 3300027703 | Tropical Forest Soil | FDDAVAAYQKCAAIPGGMQSTCTQGAEEAKKLAATQLSAPK |
Ga0209811_101462133 | 3300027821 | Surface Soil | ILGVVNQNTSHFDAAVAAYAHCAGIAGSLQNTCKTKSDEAKKLAATKLSAPK |
Ga0209773_102221251 | 3300027829 | Bog Forest Soil | CNEKTSHYDAAVIDFTKCSDIPGGLQAACKSSIDEAKKLGATQLSAPN |
Ga0209275_100548701 | 3300027884 | Soil | SHFDAAVAAFTKCAAIQSSLQANCKSGIDTAKKANSTQLSAPK |
Ga0209488_105079692 | 3300027903 | Vadose Zone Soil | TSHFDDAIAAFNKCAAMNGPMQGTCKVQAEDAKKLGATQLSAPK |
Ga0302233_100733163 | 3300028746 | Palsa | HFDAATVAFNKCAEIQSSLQNNCKASADAAKKQGATQLSAPK |
Ga0210278_11456032 | 3300030596 | Soil | DEKTSHFDAAVAAFNKCATISGSLQPTCKNGAEEAKKLGATQLSAPK |
Ga0307482_12510201 | 3300030730 | Hardwood Forest Soil | DEKTSHFDAAVAAFTKCAAIPGGLQATCKNGAEEAKKLGANNLSAPK |
Ga0265461_112957081 | 3300030743 | Soil | HFDAAVAAFNKCAAIPGSLQPTCKNGADEAKKLGATQLSAPK |
Ga0265461_127288342 | 3300030743 | Soil | LAISDEKTSHFDAAVAAFNKCATISGSLQPTCKNGAEEAKKLGATQLSAPK |
(restricted) Ga0255310_102189421 | 3300031197 | Sandy Soil | HYDDAVAAFNKCAALPGGLQTTCKTAADEAKKLAATRLSAPK |
Ga0170820_135484652 | 3300031446 | Forest Soil | LHFDDSATAYNKCASIAGSMQETCKKGAEEAKKLAGTQLSAPK |
Ga0318571_103673781 | 3300031549 | Soil | VAAFTKCAAIPGGLQATCKGNIDEAKKLAATQLSAPK |
Ga0318555_100775483 | 3300031640 | Soil | HFDDAVAAFTKCAAIPGGLQATCKGNIDEAKKLAATQLSAPK |
Ga0318560_102647261 | 3300031682 | Soil | TSHFDDAVAAFTKCAAIPGGLQATCKNNIDEAKKLAATQLSAPK |
Ga0307476_103454763 | 3300031715 | Hardwood Forest Soil | AVAAFTKCAAMPGGMQTNCTQGAEEAKKLGATQLSAPK |
Ga0307469_103537901 | 3300031720 | Hardwood Forest Soil | SHFDDAVAAYTKCAAIPGGMQSTCTQSIEEAKKLAATQLSAPK |
Ga0307469_116703241 | 3300031720 | Hardwood Forest Soil | NTSHFEDAAGAFSKCAAIPGKLQDTCKTKTEEAKKLAATKLSVPK |
Ga0318552_104167141 | 3300031782 | Soil | AFNKCAAIAGQMQAVCKAQVDDTKKKSSTELSAPK |
Ga0310917_107950781 | 3300031833 | Soil | VTAFTKCAAIPGGLQATCKNNIDEAKKLAATQLSAPK |
Ga0318551_104372171 | 3300031896 | Soil | ANKGTSHFDDAITAFNKCAAIAGQMQAVCKAQVDDTKKKSSTELSAPK |
Ga0306923_121118712 | 3300031910 | Soil | FDDAVTAFTKCAAIQSSLQATCKQGIDEAKKLSTTQLSVPK |
Ga0306921_119374831 | 3300031912 | Soil | NQKTSHFDDAVAAYQKCAAIPGGMQSTCTQGAEEAKKLAATQLSAPK |
Ga0310916_104085921 | 3300031942 | Soil | SHFDDAVAAFTKCAAIPGGLQATCKGNIDEAKKLAATQLSAPK |
Ga0310916_111170591 | 3300031942 | Soil | EKASHFDDAVIDFTKCSDIPGGLQATCKTEIDKAKNMSTTQLSAPK |
Ga0307479_106117921 | 3300031962 | Hardwood Forest Soil | AKTSHFDDSAAAYNKCAAMPGAMQETCKKGAEEAKKLGATQLSAPK |
Ga0306922_121329562 | 3300032001 | Soil | TSHFDDATFAFGKCASIPGKLQDTCKTRSEEAKKLAATKLSVPK |
Ga0318533_101426273 | 3300032059 | Soil | DAVTAFTKCAAIPGGLQATCKNNIDEAKKLAATQLSAPK |
Ga0306924_102555421 | 3300032076 | Soil | FDDAVAAFTKCAAIPGGLQATCKNNIDEAKKLAATQLSAPK |
Ga0307471_1000649834 | 3300032180 | Hardwood Forest Soil | NSKTSHFEAAAAAFNKCAAIQSSLQPTCKAGADEAKKAGSSQLSAPN |
Ga0307471_1004658283 | 3300032180 | Hardwood Forest Soil | FDDAIGAFTKCAAIQSSMQPTCKNGIEEAKKLAATQLSAPK |
Ga0306920_1013815861 | 3300032261 | Soil | EQKTSHFDDAVAAFTKCAAISGSMQGTCKSSAEEAKKLGATQLSAPK |
Ga0306920_1034516772 | 3300032261 | Soil | DDAVAAFTKCAAIPGGLQATCKGNIDEAKKLAATQLSAPK |
Ga0306920_1038585232 | 3300032261 | Soil | AIAVFNKCAAAGPMQAQCKAQLDDTKKKSATELSAPK |
Ga0335079_103907681 | 3300032783 | Soil | SNEKASHFDDAVAAFTKCAAIPSGLQATCKQGIDEAKKLSSTQMSVPK |
Ga0335080_118378522 | 3300032828 | Soil | DAAVAAFTKCSSAPGGLQETCKTKIDEAKKLGATQLSSPK |
Ga0335084_103723483 | 3300033004 | Soil | CNQKASHFDDAVAAYTKCAAIPGGMQATCQQGVEEAKKLAATQLSAPK |
Ga0335077_101940934 | 3300033158 | Soil | ADEQTSHFDDAIAAFTKCAAIPSGMKDTCAHGVEEAKKLGATQLSSPK |
Ga0316620_106230091 | 3300033480 | Soil | IAEEKTSHFDAAVAAFTKCASAASSLQPTCKTGAEQAKKLGATQLSAPK |
Ga0371489_0137053_2_139 | 3300033755 | Peat Soil | KGSHFDDAIAAFTKCASFPGGLQPTCKSGIEEVKKLEKTELNVPR |
⦗Top⦘ |