| Basic Information | |
|---|---|
| Family ID | F040778 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 161 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSETADIQTKPKPARDSSKDKRTLDQVEKWMEMIREISREPVKN |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.58 % |
| % of genes near scaffold ends (potentially truncated) | 23.60 % |
| % of genes from short scaffolds (< 2000 bps) | 78.26 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.503 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.224 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.509 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (73.913 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.36% β-sheet: 0.00% Coil/Unstructured: 63.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 44.72 |
| PF01713 | Smr | 36.65 |
| PF06725 | 3D | 4.97 |
| PF10431 | ClpB_D2-small | 3.73 |
| PF00227 | Proteasome | 0.62 |
| PF10947 | DUF2628 | 0.62 |
| PF00814 | TsaD | 0.62 |
| PF04444 | Dioxygenase_N | 0.62 |
| PF04280 | Tim44 | 0.62 |
| PF00977 | His_biosynth | 0.62 |
| PF00117 | GATase | 0.62 |
| PF14384 | BrnA_antitoxin | 0.62 |
| PF12071 | DUF3551 | 0.62 |
| PF07045 | DUF1330 | 0.62 |
| PF07690 | MFS_1 | 0.62 |
| PF12697 | Abhydrolase_6 | 0.62 |
| PF03972 | MmgE_PrpD | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 44.72 |
| COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.62 |
| COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.62 |
| COG4395 | Predicted lipid-binding transport protein, Tim44 family | Lipid transport and metabolism [I] | 0.62 |
| COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.50 % |
| Unclassified | root | N/A | 20.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10028456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3319 | Open in IMG/M |
| 3300000567|JGI12270J11330_10112326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1141 | Open in IMG/M |
| 3300001593|JGI12635J15846_10826983 | Not Available | 530 | Open in IMG/M |
| 3300001619|JGI20250J16331_102001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 859 | Open in IMG/M |
| 3300004631|Ga0058899_12199021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300005436|Ga0070713_100120893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2297 | Open in IMG/M |
| 3300005437|Ga0070710_10142522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 1471 | Open in IMG/M |
| 3300005538|Ga0070731_10136663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1624 | Open in IMG/M |
| 3300005538|Ga0070731_10166914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1461 | Open in IMG/M |
| 3300005538|Ga0070731_10549982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 768 | Open in IMG/M |
| 3300005542|Ga0070732_10000029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 160785 | Open in IMG/M |
| 3300005602|Ga0070762_10149234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris | 1397 | Open in IMG/M |
| 3300005602|Ga0070762_11155823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300005610|Ga0070763_10033064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 2378 | Open in IMG/M |
| 3300005610|Ga0070763_10377924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 793 | Open in IMG/M |
| 3300005610|Ga0070763_10569939 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300005712|Ga0070764_10044062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 2277 | Open in IMG/M |
| 3300005712|Ga0070764_10179269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1178 | Open in IMG/M |
| 3300005921|Ga0070766_10040228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2590 | Open in IMG/M |
| 3300005921|Ga0070766_10205671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1232 | Open in IMG/M |
| 3300005921|Ga0070766_10296891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1037 | Open in IMG/M |
| 3300005921|Ga0070766_10306852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1021 | Open in IMG/M |
| 3300005921|Ga0070766_10406282 | Not Available | 893 | Open in IMG/M |
| 3300005921|Ga0070766_10798745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 643 | Open in IMG/M |
| 3300005921|Ga0070766_10947533 | Not Available | 591 | Open in IMG/M |
| 3300006028|Ga0070717_10688243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 929 | Open in IMG/M |
| 3300006052|Ga0075029_101231125 | Not Available | 523 | Open in IMG/M |
| 3300006086|Ga0075019_10422144 | Not Available | 819 | Open in IMG/M |
| 3300006162|Ga0075030_100611738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 864 | Open in IMG/M |
| 3300006174|Ga0075014_100656403 | Not Available | 606 | Open in IMG/M |
| 3300006176|Ga0070765_100197197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1825 | Open in IMG/M |
| 3300006176|Ga0070765_100393696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1292 | Open in IMG/M |
| 3300006176|Ga0070765_100683216 | Not Available | 969 | Open in IMG/M |
| 3300006176|Ga0070765_100726020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 938 | Open in IMG/M |
| 3300006176|Ga0070765_101100980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 751 | Open in IMG/M |
| 3300006893|Ga0073928_10018216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 7389 | Open in IMG/M |
| 3300006893|Ga0073928_10256400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1334 | Open in IMG/M |
| 3300006893|Ga0073928_11123288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300006893|Ga0073928_11171799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
| 3300009519|Ga0116108_1043067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1451 | Open in IMG/M |
| 3300009520|Ga0116214_1383317 | Not Available | 547 | Open in IMG/M |
| 3300009521|Ga0116222_1256568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 754 | Open in IMG/M |
| 3300009522|Ga0116218_1343895 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300009523|Ga0116221_1480415 | Not Available | 543 | Open in IMG/M |
| 3300009525|Ga0116220_10185197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 900 | Open in IMG/M |
| 3300009643|Ga0116110_1049957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 1504 | Open in IMG/M |
| 3300009683|Ga0116224_10060503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1847 | Open in IMG/M |
| 3300009700|Ga0116217_10371945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 910 | Open in IMG/M |
| 3300009700|Ga0116217_10994055 | Not Available | 513 | Open in IMG/M |
| 3300009839|Ga0116223_10358170 | Not Available | 863 | Open in IMG/M |
| 3300010379|Ga0136449_101327436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1118 | Open in IMG/M |
| 3300010379|Ga0136449_101699136 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 951 | Open in IMG/M |
| 3300010379|Ga0136449_103420488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 607 | Open in IMG/M |
| 3300010379|Ga0136449_103786587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
| 3300010876|Ga0126361_10926404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 745 | Open in IMG/M |
| 3300011120|Ga0150983_10891315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300011120|Ga0150983_11340888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 541 | Open in IMG/M |
| 3300011120|Ga0150983_16208155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300012077|Ga0153929_1066249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300012361|Ga0137360_11851660 | Not Available | 509 | Open in IMG/M |
| 3300014200|Ga0181526_10096162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1892 | Open in IMG/M |
| 3300014489|Ga0182018_10048373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2612 | Open in IMG/M |
| 3300014501|Ga0182024_10087363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4609 | Open in IMG/M |
| 3300014501|Ga0182024_10223509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2550 | Open in IMG/M |
| 3300014501|Ga0182024_10706570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1243 | Open in IMG/M |
| 3300014657|Ga0181522_10057577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2196 | Open in IMG/M |
| 3300015080|Ga0167639_1029100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 758 | Open in IMG/M |
| 3300015089|Ga0167643_1027902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 872 | Open in IMG/M |
| 3300017946|Ga0187879_10018589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4314 | Open in IMG/M |
| 3300017946|Ga0187879_10330369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 846 | Open in IMG/M |
| 3300017948|Ga0187847_10501084 | Not Available | 673 | Open in IMG/M |
| 3300018030|Ga0187869_10298742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 775 | Open in IMG/M |
| 3300018040|Ga0187862_10557772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300019888|Ga0193751_1012994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4316 | Open in IMG/M |
| 3300020021|Ga0193726_1000070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 184083 | Open in IMG/M |
| 3300020579|Ga0210407_10200660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1550 | Open in IMG/M |
| 3300020579|Ga0210407_11355980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300020580|Ga0210403_10480864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1010 | Open in IMG/M |
| 3300020581|Ga0210399_11450078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 534 | Open in IMG/M |
| 3300020582|Ga0210395_10167497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1643 | Open in IMG/M |
| 3300020582|Ga0210395_11274157 | Not Available | 539 | Open in IMG/M |
| 3300020583|Ga0210401_10646190 | Not Available | 919 | Open in IMG/M |
| 3300021170|Ga0210400_10768363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 791 | Open in IMG/M |
| 3300021178|Ga0210408_10000011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 296970 | Open in IMG/M |
| 3300021178|Ga0210408_10118695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2084 | Open in IMG/M |
| 3300021180|Ga0210396_10000004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 612621 | Open in IMG/M |
| 3300021180|Ga0210396_10132854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2243 | Open in IMG/M |
| 3300021180|Ga0210396_11458376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
| 3300021181|Ga0210388_10902262 | Not Available | 762 | Open in IMG/M |
| 3300021181|Ga0210388_10925641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 750 | Open in IMG/M |
| 3300021181|Ga0210388_11003092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 716 | Open in IMG/M |
| 3300021401|Ga0210393_10974603 | Not Available | 687 | Open in IMG/M |
| 3300021402|Ga0210385_10000136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 79273 | Open in IMG/M |
| 3300021402|Ga0210385_10422056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1004 | Open in IMG/M |
| 3300021404|Ga0210389_10684088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 804 | Open in IMG/M |
| 3300021404|Ga0210389_10819603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300021407|Ga0210383_11197131 | Not Available | 638 | Open in IMG/M |
| 3300021420|Ga0210394_10050608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3630 | Open in IMG/M |
| 3300021420|Ga0210394_10103659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2461 | Open in IMG/M |
| 3300021420|Ga0210394_11832524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300021433|Ga0210391_10326021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1205 | Open in IMG/M |
| 3300021474|Ga0210390_11079735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 653 | Open in IMG/M |
| 3300021474|Ga0210390_11313494 | Not Available | 579 | Open in IMG/M |
| 3300021475|Ga0210392_10130368 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1695 | Open in IMG/M |
| 3300021477|Ga0210398_10012258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7536 | Open in IMG/M |
| 3300021477|Ga0210398_10066054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2947 | Open in IMG/M |
| 3300021478|Ga0210402_10129444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2287 | Open in IMG/M |
| 3300021478|Ga0210402_10713490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 926 | Open in IMG/M |
| 3300021479|Ga0210410_10046470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 3779 | Open in IMG/M |
| 3300021479|Ga0210410_10242347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1616 | Open in IMG/M |
| 3300021479|Ga0210410_10325681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1378 | Open in IMG/M |
| 3300021479|Ga0210410_10671991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 916 | Open in IMG/M |
| 3300022506|Ga0242648_1080971 | Not Available | 542 | Open in IMG/M |
| 3300022522|Ga0242659_1097016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 579 | Open in IMG/M |
| 3300022557|Ga0212123_10268960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1211 | Open in IMG/M |
| 3300022557|Ga0212123_10288081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1155 | Open in IMG/M |
| 3300024225|Ga0224572_1002201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3101 | Open in IMG/M |
| 3300025500|Ga0208686_1050925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 967 | Open in IMG/M |
| 3300025898|Ga0207692_10211758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1145 | Open in IMG/M |
| 3300027029|Ga0208731_1007336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1093 | Open in IMG/M |
| 3300027090|Ga0208604_1000137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11136 | Open in IMG/M |
| 3300027326|Ga0209731_1059420 | Not Available | 586 | Open in IMG/M |
| 3300027497|Ga0208199_1047009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 926 | Open in IMG/M |
| 3300027562|Ga0209735_1101198 | Not Available | 628 | Open in IMG/M |
| 3300027567|Ga0209115_1001403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4227 | Open in IMG/M |
| 3300027568|Ga0208042_1006234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3302 | Open in IMG/M |
| 3300027568|Ga0208042_1122394 | Not Available | 656 | Open in IMG/M |
| 3300027570|Ga0208043_1003525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5641 | Open in IMG/M |
| 3300027610|Ga0209528_1084058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 704 | Open in IMG/M |
| 3300027629|Ga0209422_1015190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1904 | Open in IMG/M |
| 3300027641|Ga0208827_1213184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300027678|Ga0209011_1038693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1490 | Open in IMG/M |
| 3300027696|Ga0208696_1098447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 973 | Open in IMG/M |
| 3300027842|Ga0209580_10000003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 892418 | Open in IMG/M |
| 3300027855|Ga0209693_10072197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1703 | Open in IMG/M |
| 3300027869|Ga0209579_10005166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8934 | Open in IMG/M |
| 3300027869|Ga0209579_10340784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 810 | Open in IMG/M |
| 3300027884|Ga0209275_10524674 | Not Available | 676 | Open in IMG/M |
| 3300027889|Ga0209380_10015316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4374 | Open in IMG/M |
| 3300027889|Ga0209380_10797550 | Not Available | 536 | Open in IMG/M |
| 3300027895|Ga0209624_10224895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1247 | Open in IMG/M |
| 3300027908|Ga0209006_10101676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2548 | Open in IMG/M |
| 3300028906|Ga0308309_10682567 | Not Available | 892 | Open in IMG/M |
| 3300028906|Ga0308309_11558213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
| 3300028906|Ga0308309_11670633 | Not Available | 541 | Open in IMG/M |
| 3300028906|Ga0308309_11852088 | Not Available | 509 | Open in IMG/M |
| 3300030763|Ga0265763_1004058 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300030862|Ga0265753_1001668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1982 | Open in IMG/M |
| 3300031018|Ga0265773_1001395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1287 | Open in IMG/M |
| 3300031090|Ga0265760_10248154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 616 | Open in IMG/M |
| 3300031231|Ga0170824_106122067 | Not Available | 500 | Open in IMG/M |
| 3300031231|Ga0170824_117561571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300031247|Ga0265340_10207693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 880 | Open in IMG/M |
| 3300031474|Ga0170818_105022249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 832 | Open in IMG/M |
| 3300031718|Ga0307474_11144613 | Not Available | 616 | Open in IMG/M |
| 3300032160|Ga0311301_10015776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 22455 | Open in IMG/M |
| 3300032160|Ga0311301_10977437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1124 | Open in IMG/M |
| 3300032160|Ga0311301_12257686 | Not Available | 621 | Open in IMG/M |
| 3300032180|Ga0307471_103069330 | Not Available | 592 | Open in IMG/M |
| 3300032205|Ga0307472_101755858 | Not Available | 615 | Open in IMG/M |
| 3300032805|Ga0335078_10453902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1663 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.22% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 16.77% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 14.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.94% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.35% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.73% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.11% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.48% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.86% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.86% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.24% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.24% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.62% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.62% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.62% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.62% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.62% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001619 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012077 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ013 MetaG | Host-Associated | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015080 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027029 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes) | Environmental | Open in IMG/M |
| 3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100284562 | 3300000567 | Peatlands Soil | MSDTADIQTKPNPARDSSKDKRTLDQVEKWMEMIREISREPVKN* |
| JGI12270J11330_101123262 | 3300000567 | Peatlands Soil | MSDTADIQTKPKPARDNSKDKRTLDQVEKWMEMIREIGREPVNN* |
| JGI12635J15846_108269832 | 3300001593 | Forest Soil | MSETVDIQTKPKPARDSSKDKRTLDQVEKWLEMIREIS |
| JGI20250J16331_1020012 | 3300001619 | Forest Soil | MSETIDIQTKPKSARDSSKDKRTLDQVEKWMETIREISREPVKN* |
| Ga0058899_121990211 | 3300004631 | Forest Soil | MSETADIQTKSKPARDNSKDKRTLDQVEKWMEMIREIGREPVKN* |
| Ga0070713_1001208933 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSETVDIQVKPKPARDSSKDKRTLDQVEKWMEMIREIGREPVKN* |
| Ga0070710_101425222 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSETVDIQVKPKPARDSSKDKRTLDQVEKWMEMIREIGREPVKS* |
| Ga0070731_101366632 | 3300005538 | Surface Soil | MSETANIQTKPKPARDNSKDKRTLDQVEKWMEMIREISREPVKN* |
| Ga0070731_101669142 | 3300005538 | Surface Soil | MSDSVDIQTKLKPTRDSSKDKRTLDQVEKWMEMIREIGREPAKN* |
| Ga0070731_105499822 | 3300005538 | Surface Soil | MSETADIQTQPKPARDNSKDKRTLDQVEKWMEMIREISREPVKN* |
| Ga0070732_10000029148 | 3300005542 | Surface Soil | MSETVDIQMKRKTARDSSKDKRVLDQIEKWMEMIREISREPVKN* |
| Ga0070762_101492343 | 3300005602 | Soil | MSETADIQTKPKPARDSSKDKRTLDQVEKWMEMIREISREPVKN* |
| Ga0070762_111558232 | 3300005602 | Soil | MSETADIQTKPKPARDSCKDKRTLDQVEKWMEMIREISREPVKN* |
| Ga0070763_100330642 | 3300005610 | Soil | MSETADIQTKPKPARDSSKDKRTLDQVEKWMETIREISREPVKN* |
| Ga0070763_103779242 | 3300005610 | Soil | MSETVDTQVKLKPARDSSKDKRTLDQVEKWMEMIREISREPVKN* |
| Ga0070763_105699392 | 3300005610 | Soil | MSDTADIQTKPKPARDSSKDKRTLDQVEKWMEMIREISREPVKN* |
| Ga0070764_100440623 | 3300005712 | Soil | MSDTADVQTKPKPVRDSSKDKRTLDQVEKWMEMIREISREPAKN* |
| Ga0070764_101792692 | 3300005712 | Soil | MSDIADIQTKPKPARDSSKDKRTLDQVEKWMEMIREISREPVNS* |
| Ga0070766_100402283 | 3300005921 | Soil | MSDTADIQTKPKPARDSSKDKRTLDQVEKWMEMIREISREPVKS* |
| Ga0070766_102056712 | 3300005921 | Soil | MSETVDIQTKPKPARDNSKDKRTLDQVEKWMEMIREISREPAKN* |
| Ga0070766_102968911 | 3300005921 | Soil | MSDTADIQTKPKPARDSSKDKRTLDQVEKWMEMIREISRE |
| Ga0070766_103068522 | 3300005921 | Soil | MSETVDIQTQPKPARDNSKDKRTLDQVEKWMEMIREISREPVKN* |
| Ga0070766_104062822 | 3300005921 | Soil | MSETADIETKPKPARDNSKDKRTLDRVEKWMEMIREISREPV |
| Ga0070766_107987451 | 3300005921 | Soil | MSETVDIQTKPKPARDSSKDKRTLDQVEKWLEMIREISREPVKS* |
| Ga0070766_109475332 | 3300005921 | Soil | MSETVDIQTKPKPARDNSKDKRTLDQVEKWMEMIREISREP |
| Ga0070717_106882431 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GVRQIMSETVDIQVKPKPTRDSSKDKRTLDQVEKWMEMIREIGREPVKN* |
| Ga0075029_1012311251 | 3300006052 | Watersheds | SETVDTQLKPKTARDSSNDKRVLAQVEKWMEMIREISREPVKN* |
| Ga0075019_104221442 | 3300006086 | Watersheds | MSETVDVQAKPKPARDNAKDKRTLDQVEKWMEMIREISREP |
| Ga0075030_1006117382 | 3300006162 | Watersheds | MSDTADIQTKLKPARDSSKDKRTLDQVEKWMEMIREISREPVKN* |
| Ga0075014_1006564031 | 3300006174 | Watersheds | MPETVDTQLKPKTARDSSNDKRVLAQVEKWMEMIREISREPVKN* |
| Ga0070765_1001971972 | 3300006176 | Soil | MSETADIQTKPKPARDNSKDKRTLDQVEKWMETIREISREPAKN* |
| Ga0070765_1003936961 | 3300006176 | Soil | VIGVRQIMSETADIQTKPKPARENSKDKRTLDQVEKWMEMIREISREPVKN* |
| Ga0070765_1006832162 | 3300006176 | Soil | MSETADIHTKPKPARDSSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0070765_1007260202 | 3300006176 | Soil | MSETADIETKPKPARDNSKDKRTLDRVEKWMEMIREISREPVKN* |
| Ga0070765_1011009803 | 3300006176 | Soil | MSETVDIQTKPKSARDSSKDKRTLDQVEKWMETIREISREPVKN* |
| Ga0073928_1001821610 | 3300006893 | Iron-Sulfur Acid Spring | MSETVDIQTKPKPARDSSKDKRTLDQVEKWMEMIREISREPTKN* |
| Ga0073928_102564002 | 3300006893 | Iron-Sulfur Acid Spring | MSETVDIETKTKPARDNSKDKRTLDQVEKWMEMIREISREPVKN* |
| Ga0073928_111232882 | 3300006893 | Iron-Sulfur Acid Spring | MSETADIQTKPKPARDSSKDKRTLDQVEKWMEMIREIS |
| Ga0073928_111717991 | 3300006893 | Iron-Sulfur Acid Spring | VIGVRQIMSETVDIQTKPKPARDNSKDKRTLDQVEKWMEMIREIGREPVKN* |
| Ga0116108_10430673 | 3300009519 | Peatland | MSDIADIQTKPKPARDNSKDKRTLDQVEKWMEMIREIGREPVNN* |
| Ga0116214_13833171 | 3300009520 | Peatlands Soil | MSDTADIQTKPKPAHDSSKDKRTLDQVEKWMEMIREINREPVRN* |
| Ga0116222_12565682 | 3300009521 | Peatlands Soil | MSDTADIQTKPKPACDNSKDKRTLDQVEKWMEMIREIGREPVNN* |
| Ga0116218_13438952 | 3300009522 | Peatlands Soil | MSDTADIQTKPKPARDNSKDRRTLDQVEKWMEMIREIGREPVKN* |
| Ga0116221_14804152 | 3300009523 | Peatlands Soil | MSDTADIQTKPKPARDNSKDKRTLDQVEKWMEMILEIGREPVNN* |
| Ga0116220_101851972 | 3300009525 | Peatlands Soil | MSETADIQTKPKTARDSSKDKRTLDQVEKWMEMIREINREPAKN* |
| Ga0116110_10499572 | 3300009643 | Peatland | MSDTADIQTKPKPARDNSKDKRTLDQVEKWMEMIREIGREPVKN* |
| Ga0116224_100605033 | 3300009683 | Peatlands Soil | MSDTADIQTKPKPARDNSKDRRTLDQVEKWMEMIREIGREPVNN* |
| Ga0116217_103719451 | 3300009700 | Peatlands Soil | KPNPARDSSKDKRTLDQVEKWMEMIREISREPVKN* |
| Ga0116217_109940552 | 3300009700 | Peatlands Soil | MSDIADIQTKPNPARDSSKDKRTLDQVEKWMEMIREISREPVKN* |
| Ga0116223_103581702 | 3300009839 | Peatlands Soil | MSGTADIQTKPKPARDSSKDKRTLDQVEKWMEMIREISREPVKN* |
| Ga0136449_1013274362 | 3300010379 | Peatlands Soil | MSDTADIQTKPKPARDNSKDKRTLDQVEKWMEMIREVGREPVKN* |
| Ga0136449_1016991362 | 3300010379 | Peatlands Soil | MSDTADIQTKPKPAHDSSKDKRTLDQVEKWMETIREISREPVKN* |
| Ga0136449_1034204882 | 3300010379 | Peatlands Soil | MSETADIQTKPKTARDSSKDKRTLDQVEKWMEMIREINREPVRN* |
| Ga0136449_1037865871 | 3300010379 | Peatlands Soil | MSETVDIQTKPKPARDSSKDKRTLDQVEKWMETIREISREPAKN* |
| Ga0126361_109264042 | 3300010876 | Boreal Forest Soil | MSEAVDIQTKPKPARDNSKDKRTLDQVEKWMEMIREISREPVKN* |
| Ga0150983_108913152 | 3300011120 | Forest Soil | PVIGVRQIMSETVDIQTKPKPARDNSKDKRTLDQVEKWMEMIREISREPVKN* |
| Ga0150983_113408882 | 3300011120 | Forest Soil | MSETADIQTKPKPARDSSKDKRTLDQIEKWMEMIREISREPVKN* |
| Ga0150983_162081552 | 3300011120 | Forest Soil | MSETVDIQTKPKPARDSSKDKRTLDQVEKWMETIREISREPVKN* |
| Ga0153929_10662491 | 3300012077 | Attine Ant Fungus Gardens | MPVSQSEYVMAETVTTQQKPKTTRNGSDDGRALAQVEKWMEMIREVSREQLDDPVKN* |
| Ga0137360_118516602 | 3300012361 | Vadose Zone Soil | MSETVDIQPKPKTARDGSNDRRVLAQVEKWMEMIREISREPVKN* |
| Ga0181526_100961622 | 3300014200 | Bog | MSDTADIQTKPKPARDSSKDKRTLDQVEKWMETIREISREPVKN* |
| Ga0182018_100483732 | 3300014489 | Palsa | MSETVDIQTKPARDNSKDKRTLDQVEKWMEMIREISREPAKN* |
| Ga0182024_100873634 | 3300014501 | Permafrost | MSEAVDIQTKPKPARDNSKDKRTLDQVEKWMEMIREISREPAKN* |
| Ga0182024_102235094 | 3300014501 | Permafrost | MSETVDIQTKPKPARDNSKDKRTLDQVEKWMDMIREISREPAKN* |
| Ga0182024_107065702 | 3300014501 | Permafrost | MSETVDTQTKPKTARDGSNDKRVLAQVEKWMEMIREISREPVKN* |
| Ga0181522_100575773 | 3300014657 | Bog | MSDTADIQTKPQPARDSSKDKRTLDQVEKWMEMIREISREP |
| Ga0167639_10291002 | 3300015080 | Glacier Forefield Soil | MSETVDIQTKPKPARDSSKDKRTLDQVEKWMEMIREISREPAKN* |
| Ga0167643_10279022 | 3300015089 | Glacier Forefield Soil | MSETADIQTKPKPARDNSKDKRTLDQVEKWMEMIREISREPVKN* |
| Ga0187879_100185893 | 3300017946 | Peatland | MSDTADIQTKPKPARDNSKDKRTLDQVEKWMEMIREIGREPVNN |
| Ga0187879_103303692 | 3300017946 | Peatland | MSDTADIQTKPKPARDSSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0187847_105010841 | 3300017948 | Peatland | MSDTADIQTKPKPARDSSKDKRTLDQVEKWMEMIRE |
| Ga0187869_102987422 | 3300018030 | Peatland | MSDTADIQTKPKPARDNSEDKRTLDQVEKWMEMIREIGREPVNN |
| Ga0187862_105577721 | 3300018040 | Peatland | IGVRLIMSDTADIQTKPKPARDSSKDKRTLDQVEKWMEMIREISREPVKS |
| Ga0193751_10129943 | 3300019888 | Soil | MSETADIQTKPKPARDSSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0193726_100007042 | 3300020021 | Soil | MSETVDIQTKPKPARDNSKDKRTLDQVEKWMEMIREISREPMKN |
| Ga0210407_102006602 | 3300020579 | Soil | MSETADIETKPKPARDNSKDKRTLDRVEKWMEMIREISREPMKN |
| Ga0210407_113559802 | 3300020579 | Soil | MSETADIQTKSKPARDNSKDKRTLDQVEKWMEMIREIGREPVKN |
| Ga0210403_104808641 | 3300020580 | Soil | MSETADIQTQPKPARDNSKDKRTLDQVEKWMEMIREISREP |
| Ga0210399_114500782 | 3300020581 | Soil | MSETADIQTQPKPARDNSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0210395_101674972 | 3300020582 | Soil | MSDTADIQTKPKPARDSSKDKRTLDQVEKWMEMIREINREPVKN |
| Ga0210395_112741572 | 3300020582 | Soil | MSETVDIQTKPKPARDSSKDRRTLDQVEKWMEMIREISREPVKN |
| Ga0210401_106461902 | 3300020583 | Soil | MSDTADIQTKPKPARDSSKDKRTLDQVEKWMEMIREISREPVNN |
| Ga0210400_107683632 | 3300021170 | Soil | GMPVIGVRQIMSETADIQTQPKPARDNSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0210408_10000011108 | 3300021178 | Soil | MSETVDIQVKPKPARDSSKDKRTLDQVEKWMETIREIGREPVKS |
| Ga0210408_101186953 | 3300021178 | Soil | MSETADIQTKPKPARDNSKDKRTLDQVEKWMETIREISREPVKN |
| Ga0210396_1000000446 | 3300021180 | Soil | MSETADIQTKPKPARDSSKDKRTLDQVEKWMETIREISREPVKN |
| Ga0210396_101328545 | 3300021180 | Soil | FGVRLIMSDTADVQTKPKLVRDSSKDKRTLDQVEKWMEMIREISREPAKN |
| Ga0210396_114583762 | 3300021180 | Soil | MSETADIETKPKPARDNSKDKRTLDRVEKWMEMIREISREPVKN |
| Ga0210388_109022622 | 3300021181 | Soil | MSETVDTQVKPKPVRDSSKDKRTLDQVEKWMEMIREISHEPVKN |
| Ga0210388_109256411 | 3300021181 | Soil | DIQTKPKPARDSSKDRRTLDQVEKWMEMIREISREPVKN |
| Ga0210388_110030921 | 3300021181 | Soil | QPKPARDNSKDKRTLDQVEKWMETIREISREPAKN |
| Ga0210393_109746031 | 3300021401 | Soil | MSETADIQTQPKPARDNSKDKRTLDQVEKWMEMIR |
| Ga0210385_1000013654 | 3300021402 | Soil | MSDTADIQTKPKPARDSSKDKRTLDQVEKWMEMIREISHEPVKN |
| Ga0210385_104220562 | 3300021402 | Soil | MSETVDIQTKPKPARDNSKDKRTLDQVEKWMEMIREISREPVKS |
| Ga0210389_106840882 | 3300021404 | Soil | IGMPVIGVRQIMSETADIQTQPKPARDNSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0210389_108196031 | 3300021404 | Soil | MSETVDIQAKPKPARDNSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0210383_111971311 | 3300021407 | Soil | MSDTADIQTKPKPARDSSKDKRTLDQVEKWMETIREISGEPVKS |
| Ga0210394_100506083 | 3300021420 | Soil | MSETVDVQAKPKPVRDNAKDKRTLDQVEKWMEMIREISGEPVKS |
| Ga0210394_101036592 | 3300021420 | Soil | MSETVDIQTKPKPARDSSKDKRTLDQVEKWLEMIREISREPVQS |
| Ga0210394_118325242 | 3300021420 | Soil | MSETVDIQTKPKSARDSSKDKRTLDQVEKWMETIREISREPVKN |
| Ga0210391_103260212 | 3300021433 | Soil | MSDTADVQTKPKPVRDSSKDKRTLDQVEKWMEMIREISREPAKN |
| Ga0210390_110797351 | 3300021474 | Soil | MSDTADVQTKPKPARDSSKDKRTLDQVEKWMEMIREISREPAKN |
| Ga0210390_113134941 | 3300021474 | Soil | MSDTADIQTKPKPARDSSKDKRTLDQVEKWMEMIREISR |
| Ga0210392_101303682 | 3300021475 | Soil | MSETVDIQTKPKPARDNAKDKRTLDQVEKWMEMIREISREPAKN |
| Ga0210398_100122588 | 3300021477 | Soil | MSETADIQTKPKPARDSREDKRTLDQVEKWMEMIREISREPVKN |
| Ga0210398_100660543 | 3300021477 | Soil | MSETVDIQTKPKPVRDNSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0210402_101294442 | 3300021478 | Soil | MSETADIQTKPKPARDSSKDKRTLDQVEKWMEMIREISREPATN |
| Ga0210402_107134902 | 3300021478 | Soil | MSETADIQTKPKPARDSSKDIRTLDQVEKWMEMIREISREPVNS |
| Ga0210410_100464702 | 3300021479 | Soil | MSETADIQTKPKPARDSSKDTRTLDQVEKWMEMIREISREPVKN |
| Ga0210410_102423472 | 3300021479 | Soil | MSETADIQMQPKPARDNSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0210410_103256813 | 3300021479 | Soil | SETVDIQTKPKPARDNSKDKRTLDRVEKWMEMIREISREPVKN |
| Ga0210410_106719912 | 3300021479 | Soil | MSETADIQTKPKTARDGSKDKRTLDQVEKWMETIREISREPVKN |
| Ga0242648_10809712 | 3300022506 | Soil | MSETVDIQTKPKPARDNSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0242659_10970162 | 3300022522 | Soil | GVRQIMSETADIQMQPKPARDNSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0212123_102689601 | 3300022557 | Iron-Sulfur Acid Spring | MSETVDIQTKPKPARDSSKDKRTLDQVEKWMEMIREISREPTKN |
| Ga0212123_102880812 | 3300022557 | Iron-Sulfur Acid Spring | MSETVDIETKTKPARDNSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0224572_10022014 | 3300024225 | Rhizosphere | MSETVDIQTQPKPARDNSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0208686_10509251 | 3300025500 | Peatland | MSDIADIQTKPKPARDNSKDKRTLDQVEKWMEMIREIGREPVNN |
| Ga0207692_102117582 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MSETVDIQVKPKPARDSSKDKRTLDQVEKWMEMIREIGREPVKS |
| Ga0208731_10073361 | 3300027029 | Forest Soil | MSDTADIQTKPKPARDNSKDKRTLDQVEKWMEMIREISREPAKN |
| Ga0208604_10001372 | 3300027090 | Forest Soil | MSETIDIQTKPKSARDSSKDKRTLDQVEKWMETIREISREPVKN |
| Ga0209731_10594202 | 3300027326 | Forest Soil | MSETVDIQAKPKPARDSSKDKRTLDQVEKWMEMIRE |
| Ga0208199_10470091 | 3300027497 | Peatlands Soil | MSDTADIQTKPNPARDSSKDKRTLDQVEKWMEMIREISREPVK |
| Ga0209735_11011982 | 3300027562 | Forest Soil | MSETVDIQTKPKPARDSSKDKRTLDQVEKWMEMIREISREPVRN |
| Ga0209115_10014033 | 3300027567 | Forest Soil | MSDTADIQTKSKPARDSSKDKRTLDQVEKWMEMIREISREPAKN |
| Ga0208042_10062343 | 3300027568 | Peatlands Soil | MSDTADIQTKPNPARDSSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0208042_11223942 | 3300027568 | Peatlands Soil | MSDTADIQTKPKPACDNSKDKRTLDQVEKWMEMIREIGREPVNN |
| Ga0208043_10035253 | 3300027570 | Peatlands Soil | MSDIADIQTKPNPARDSSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0209528_10840583 | 3300027610 | Forest Soil | MSETVDIEIKPKPARDNSKDKRTLDQVEKWMEMIRELSREQVKN |
| Ga0209422_10151902 | 3300027629 | Forest Soil | MSETVDIQTKPKPARDSSKDKRTLDQVEKWLEMIREISREPVKS |
| Ga0208827_12131842 | 3300027641 | Peatlands Soil | HRRYPNKPNPARDSSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0209011_10386932 | 3300027678 | Forest Soil | MSDAADIQTKPRLARDSSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0208696_10984471 | 3300027696 | Peatlands Soil | MSDTADIQTKPKPARDNSKDRRTLDQVEKWMEMIREIGREPVKN |
| Ga0209580_10000003649 | 3300027842 | Surface Soil | MSETVDIQMKRKTARDSSKDKRVLDQIEKWMEMIREISREPVKN |
| Ga0209693_100721971 | 3300027855 | Soil | IMSDTADIQTQPKPARDNSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0209579_1000516614 | 3300027869 | Surface Soil | MSETANIQTKPKPARDNSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0209579_103407842 | 3300027869 | Surface Soil | MSDSVDIQTKLKPTRDSSKDKRTLDQVEKWMEMIREIGREPAKN |
| Ga0209275_105246742 | 3300027884 | Soil | MSDIADIQTKPKPARDSSKDKRTLDQVEKWMEMIREISREPVNS |
| Ga0209380_100153165 | 3300027889 | Soil | MSETVDTQVKLKPARDSSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0209380_107975502 | 3300027889 | Soil | MSETADIQTKPKPARDNSKDKRTLDQVEKWMEMIREINREPVKN |
| Ga0209624_102248952 | 3300027895 | Forest Soil | MSETVDTQVKPKPVRDSSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0209006_101016762 | 3300027908 | Forest Soil | MSETADIQTKPKPARDNAKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0308309_106825672 | 3300028906 | Soil | MSETADIQTKSKPVRDNSKDKRTLDQVEKWMEMIREISREPAKN |
| Ga0308309_115582131 | 3300028906 | Soil | IMSENADIETKPKPARDNSKDKRTLDRVEKWMEMIREISREPVKN |
| Ga0308309_116706331 | 3300028906 | Soil | MSETVDIQTKPKPTRDNSKDKRTLDQVEKWMETIREI |
| Ga0308309_118520882 | 3300028906 | Soil | MSETADIQTKPKPARDNSKDKRTLDQVEKWMETIREISREPAKN |
| Ga0265763_10040583 | 3300030763 | Soil | MSETADIQTKPKPACDSCKDKRTLDQVEKWMEMIREISREPVRN |
| Ga0265753_10016682 | 3300030862 | Soil | MSETADIQTKPKPARDSCKDKRTLDQVEKWMEMIREISREPVRN |
| Ga0265773_10013951 | 3300031018 | Soil | MSETADIQTKPKPARDSSKDKRTLDQVEKWMEMIREIGREPVKN |
| Ga0265760_102481542 | 3300031090 | Soil | MSDTADIQTKPKPARDSSKDKRTLDQVEKWMEMIREISLEPAKN |
| Ga0170824_1061220672 | 3300031231 | Forest Soil | MSETADIQTKPKPARDSSKDKRTLDQVEKWMQTIREIGREPVKN |
| Ga0170824_1175615712 | 3300031231 | Forest Soil | MSETADIQTKPKPARDSSKDKRTLDQVEKWMETIREISREPAKN |
| Ga0265340_102076932 | 3300031247 | Rhizosphere | MSETADIQTKPKPARDNSKDKRTLDQVEKWMEMIREISCEPVKN |
| Ga0170818_1050222492 | 3300031474 | Forest Soil | MSETADIQTKPKPARDSSKDKRTLDQVEKWMEMIREINREPVKN |
| Ga0307474_111446132 | 3300031718 | Hardwood Forest Soil | MSETVDIQAKPKPARDDSKDKRTLDQVEKWMEMIREISREPV |
| Ga0311301_1001577617 | 3300032160 | Peatlands Soil | MSGTADIQTKPKPARDSSKDKRTLDQVEKWMEMIREISREPVKN |
| Ga0311301_109774372 | 3300032160 | Peatlands Soil | MSDTADIQTKPKPARDNSKDKRTLDQVEKWMEMIREVGREPVKN |
| Ga0311301_122576862 | 3300032160 | Peatlands Soil | MSDTADIQTKPKPAHDSSKDKRTLDQVEKWMETIREISREPVKN |
| Ga0307471_1030693302 | 3300032180 | Hardwood Forest Soil | MSETVDIQVKPKPARDSSKDKRTLDQVEKWMEMIREISREPVRN |
| Ga0307472_1017558581 | 3300032205 | Hardwood Forest Soil | MSETVDIQTKPKPARDSSKDKRTLDQVEKWMEMIRE |
| Ga0335078_104539022 | 3300032805 | Soil | MSDSVDIQTKLKPARDSSKDKRTLDQVEKWMEMIREIGREPVKN |
| ⦗Top⦘ |