Basic Information | |
---|---|
Family ID | F040741 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 161 |
Average Sequence Length | 43 residues |
Representative Sequence | AATFPTLQQWKAGTLSDAALWHQCFFDPPETFTQSGASASQ |
Number of Associated Samples | 142 |
Number of Associated Scaffolds | 161 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.24 % |
% of genes near scaffold ends (potentially truncated) | 98.76 % |
% of genes from short scaffolds (< 2000 bps) | 91.30 % |
Associated GOLD sequencing projects | 130 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.758 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.286 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.255 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.658 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.09% β-sheet: 0.00% Coil/Unstructured: 73.91% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 161 Family Scaffolds |
---|---|---|
PF01040 | UbiA | 39.75 |
PF00232 | Glyco_hydro_1 | 4.97 |
PF12867 | DinB_2 | 3.11 |
PF03544 | TonB_C | 1.86 |
PF00155 | Aminotran_1_2 | 1.86 |
PF13517 | FG-GAP_3 | 0.62 |
PF13506 | Glyco_transf_21 | 0.62 |
PF07971 | Glyco_hydro_92 | 0.62 |
PF01087 | GalP_UDP_transf | 0.62 |
PF02744 | GalP_UDP_tr_C | 0.62 |
PF01979 | Amidohydro_1 | 0.62 |
PF00083 | Sugar_tr | 0.62 |
PF00882 | Zn_dep_PLPC | 0.62 |
PF03631 | Virul_fac_BrkB | 0.62 |
PF13561 | adh_short_C2 | 0.62 |
PF13620 | CarboxypepD_reg | 0.62 |
PF00704 | Glyco_hydro_18 | 0.62 |
COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
---|---|---|---|
COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 4.97 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.86 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.62 |
COG3537 | Putative alpha-1,2-mannosidase | Carbohydrate transport and metabolism [G] | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.76 % |
Unclassified | root | N/A | 1.24 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001175|JGI12649J13570_1004069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2015 | Open in IMG/M |
3300001356|JGI12269J14319_10062030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2123 | Open in IMG/M |
3300001593|JGI12635J15846_10032280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4174 | Open in IMG/M |
3300001593|JGI12635J15846_10368952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
3300001593|JGI12635J15846_10396985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 833 | Open in IMG/M |
3300004080|Ga0062385_10680262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 661 | Open in IMG/M |
3300004091|Ga0062387_101232377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300004092|Ga0062389_101204865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
3300004101|Ga0058896_1415524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 653 | Open in IMG/M |
3300004152|Ga0062386_100296071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1289 | Open in IMG/M |
3300005554|Ga0066661_10499404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
3300005555|Ga0066692_10485671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 787 | Open in IMG/M |
3300005598|Ga0066706_10007959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5581 | Open in IMG/M |
3300005712|Ga0070764_10064175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1905 | Open in IMG/M |
3300005995|Ga0066790_10012706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3721 | Open in IMG/M |
3300006052|Ga0075029_100142564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 1468 | Open in IMG/M |
3300006052|Ga0075029_100257075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
3300006086|Ga0075019_11094313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
3300006162|Ga0075030_100510690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
3300006176|Ga0070765_100293133 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
3300006176|Ga0070765_101936236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300006796|Ga0066665_10955386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
3300006800|Ga0066660_10990784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
3300006914|Ga0075436_101519314 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300009088|Ga0099830_11722305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300009088|Ga0099830_11883446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300009090|Ga0099827_10781314 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300009143|Ga0099792_10278500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
3300009552|Ga0116138_1177452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
3300009630|Ga0116114_1012019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2760 | Open in IMG/M |
3300009630|Ga0116114_1151519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
3300009635|Ga0116117_1216523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300009638|Ga0116113_1154587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300009665|Ga0116135_1355904 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300009665|Ga0116135_1469370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300009762|Ga0116130_1256797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
3300010359|Ga0126376_11774354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
3300010379|Ga0136449_102523521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
3300010379|Ga0136449_103565164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
3300011269|Ga0137392_10446118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1075 | Open in IMG/M |
3300011270|Ga0137391_11155025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
3300011271|Ga0137393_10148300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1956 | Open in IMG/M |
3300012207|Ga0137381_10326301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
3300012918|Ga0137396_11149322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
3300014153|Ga0181527_1332246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
3300017822|Ga0187802_10124179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 979 | Open in IMG/M |
3300017924|Ga0187820_1269910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300017925|Ga0187856_1219125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
3300017925|Ga0187856_1219129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
3300017946|Ga0187879_10311385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
3300017955|Ga0187817_10321791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
3300017955|Ga0187817_10719227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
3300017959|Ga0187779_10402574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
3300017995|Ga0187816_10564965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300018006|Ga0187804_10284575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
3300018007|Ga0187805_10648842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300018019|Ga0187874_10150100 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300018030|Ga0187869_10556113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
3300018038|Ga0187855_10419268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
3300018044|Ga0187890_10053496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2399 | Open in IMG/M |
3300018058|Ga0187766_10390481 | Not Available | 919 | Open in IMG/M |
3300018085|Ga0187772_10076079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2118 | Open in IMG/M |
3300018086|Ga0187769_11183267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
3300018088|Ga0187771_11506687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
3300018468|Ga0066662_12819918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300019275|Ga0187798_1865395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300019278|Ga0187800_1302694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
3300019787|Ga0182031_1236001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1675 | Open in IMG/M |
3300020579|Ga0210407_11095612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
3300020581|Ga0210399_11449936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300020582|Ga0210395_10190694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1536 | Open in IMG/M |
3300020583|Ga0210401_11359008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300021402|Ga0210385_10928407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
3300021402|Ga0210385_10949173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
3300021403|Ga0210397_10978023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
3300021404|Ga0210389_10393945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
3300021405|Ga0210387_11440716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
3300021420|Ga0210394_10353556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1291 | Open in IMG/M |
3300021420|Ga0210394_10671607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
3300021432|Ga0210384_11205420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
3300021433|Ga0210391_10166825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1733 | Open in IMG/M |
3300021433|Ga0210391_10497701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 957 | Open in IMG/M |
3300021474|Ga0210390_11353672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
3300022509|Ga0242649_1007397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1095 | Open in IMG/M |
3300022509|Ga0242649_1070043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
3300022557|Ga0212123_10215121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1410 | Open in IMG/M |
3300022713|Ga0242677_1053000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300022722|Ga0242657_1193012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300022726|Ga0242654_10011370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1967 | Open in IMG/M |
3300022873|Ga0224550_1048677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
3300024225|Ga0224572_1059962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
3300025412|Ga0208194_1034767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 790 | Open in IMG/M |
3300025612|Ga0208691_1120303 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300026538|Ga0209056_10074432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2895 | Open in IMG/M |
3300026548|Ga0209161_10017695 | All Organisms → cellular organisms → Bacteria | 5188 | Open in IMG/M |
3300026551|Ga0209648_10193671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1559 | Open in IMG/M |
3300026557|Ga0179587_10284130 | Not Available | 1064 | Open in IMG/M |
3300026557|Ga0179587_11088912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300027029|Ga0208731_1037278 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300027480|Ga0208993_1086514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
3300027567|Ga0209115_1116756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
3300027591|Ga0209733_1129805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
3300027648|Ga0209420_1034724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1563 | Open in IMG/M |
3300027648|Ga0209420_1165279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
3300027678|Ga0209011_1185008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300027853|Ga0209274_10026230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2678 | Open in IMG/M |
3300027862|Ga0209701_10696573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300027869|Ga0209579_10636994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300027879|Ga0209169_10062356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1929 | Open in IMG/M |
3300027879|Ga0209169_10197600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1051 | Open in IMG/M |
3300027884|Ga0209275_10002944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7067 | Open in IMG/M |
3300027889|Ga0209380_10136648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
3300027898|Ga0209067_10029762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2785 | Open in IMG/M |
3300027905|Ga0209415_10755506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
3300027911|Ga0209698_10846786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
3300027911|Ga0209698_10846787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
3300028016|Ga0265354_1009488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
3300028017|Ga0265356_1030116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300028566|Ga0302147_10169590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
3300028572|Ga0302152_10309212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300028759|Ga0302224_10082856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1223 | Open in IMG/M |
3300028780|Ga0302225_10259126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
3300028789|Ga0302232_10424314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
3300028798|Ga0302222_10370312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 559 | Open in IMG/M |
3300028866|Ga0302278_10266894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 811 | Open in IMG/M |
3300028874|Ga0302155_10046798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1995 | Open in IMG/M |
3300028906|Ga0308309_10539641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1010 | Open in IMG/M |
3300029636|Ga0222749_10369517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
3300029945|Ga0311330_10550286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
3300029982|Ga0302277_1065137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1696 | Open in IMG/M |
3300029993|Ga0302304_10053536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1600 | Open in IMG/M |
3300030007|Ga0311338_11851819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
3300030043|Ga0302306_10431422 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300030051|Ga0302195_10486720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300030053|Ga0302177_10722365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300030054|Ga0302182_10183509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
3300030520|Ga0311372_11073193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1051 | Open in IMG/M |
3300030520|Ga0311372_12818410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300030618|Ga0311354_11209849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
3300030688|Ga0311345_10088947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3587 | Open in IMG/M |
3300030706|Ga0310039_10352541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300030740|Ga0265460_11377137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
3300030759|Ga0265745_1009918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
3300030813|Ga0265750_1009706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
3300030862|Ga0265753_1082792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 624 | Open in IMG/M |
3300030991|Ga0073994_12055542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
3300031231|Ga0170824_115346591 | All Organisms → cellular organisms → Bacteria | 1950 | Open in IMG/M |
3300031234|Ga0302325_12645760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
3300031236|Ga0302324_101091008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1075 | Open in IMG/M |
3300031261|Ga0302140_10537769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
3300031474|Ga0170818_102657849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
3300031740|Ga0307468_100268707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1214 | Open in IMG/M |
3300031753|Ga0307477_11168382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300031808|Ga0316037_104463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
3300031962|Ga0307479_11160061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
3300032174|Ga0307470_10897062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
3300032515|Ga0348332_11473258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1935 | Open in IMG/M |
3300032893|Ga0335069_11836801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300032955|Ga0335076_11058339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
3300033134|Ga0335073_11293357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
3300033158|Ga0335077_10266318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1891 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.29% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.70% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.45% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.45% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.21% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.59% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.59% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.35% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.35% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.35% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.11% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.11% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.48% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.48% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.48% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.24% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.24% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.24% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.24% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.62% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.62% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.62% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.62% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.62% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.62% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.62% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.62% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.62% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001175 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004101 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF228 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027029 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes) | Environmental | Open in IMG/M |
3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300029982 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1 | Environmental | Open in IMG/M |
3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300030759 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031808 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12649J13570_10040691 | 3300001175 | Forest Soil | TLPTVQQWKAGALNDAALWHQCYFDPPETFTVAGPAGGH* |
JGI12269J14319_100620303 | 3300001356 | Peatlands Soil | TLPTVQQWKAGRLTDAALWHRCYFDPPETFSASSPAVSSSAGNH* |
JGI12635J15846_100322804 | 3300001593 | Forest Soil | GGMIAATLPTVQQWKAGTLSDAALWHQCYFDPPETFNVAGPAGGQ* |
JGI12635J15846_103689522 | 3300001593 | Forest Soil | DGGMIAATLPTLQQWKAGKLSDAALWHQCFFDPPETFTPSSSASSQ* |
JGI12635J15846_103969852 | 3300001593 | Forest Soil | TLQQWKAGTLSDAALWHQCFFDPPEIFTGTGAAGSP* |
Ga0062385_106802621 | 3300004080 | Bog Forest Soil | GIVVIFDAVDGGMIAATFPTLQLWKAGKLSDAALWHQCFFDPPEIFSESGAAASR* |
Ga0062387_1012323771 | 3300004091 | Bog Forest Soil | IAITLPTVQQWKAGKLTDAALWHRCYFDPPETFSVSSSLAGH* |
Ga0062389_1012048651 | 3300004092 | Bog Forest Soil | DGGMIAATFQTLQQWKAGKMSDAALWHQCFFDPPETFNNSGVLASQ* |
Ga0058896_14155242 | 3300004101 | Forest Soil | GMIAATVPTLRQWKAGSLSDAALWHQCFFDPPETFTGAGVSASQ* |
Ga0062386_1002960711 | 3300004152 | Bog Forest Soil | GMMAATLATLQQWKAGKLSDAALWHQCFFDPPETFSESGAAASQ* |
Ga0066661_104994042 | 3300005554 | Soil | DGGMIAATLASLEQWKAGALSDAALWHQCFFDPPETFDSSSSSASQ* |
Ga0066692_104856711 | 3300005555 | Soil | PTVQQWKAGTLSDAALWHQCFFDPPETFNVAGPAGGQ* |
Ga0066706_100079594 | 3300005598 | Soil | MIAATLASLEQWKAGALSDAALWHQCFFDPPETFDSSSSSASQ* |
Ga0070764_100641753 | 3300005712 | Soil | VDGGMIAATYATLQQWKAGKLSDAALWHQCFFDPPETFNPTGASASQ* |
Ga0066790_100127061 | 3300005995 | Soil | ATLQQWKAGTLSDSALWHKCFFDPPETFDSSGSSASQ* |
Ga0075029_1001425641 | 3300006052 | Watersheds | TLKEWKAGTLSDSALWHKCFFDPPETFDTTGSSASR* |
Ga0075029_1002570752 | 3300006052 | Watersheds | SSALAQWKAGTLSDSALWHKCFFDPPETFDSTGPSGN* |
Ga0075019_110943131 | 3300006086 | Watersheds | IQRWKAGGLTDAALWHQCYFDPPETFTVSKGSGSP* |
Ga0075030_1005106901 | 3300006162 | Watersheds | AATSSALAQWKAGTLSDSALWHKCFFDPPETFDSTGPLGN* |
Ga0070765_1002931333 | 3300006176 | Soil | MIAATFPTLQQWKAGTLSDAALWHQCFFDPPETFTASGSSASQ* |
Ga0070765_1019362362 | 3300006176 | Soil | LEQWKAGKMSDAALWHQCFFDPPETFNEPGASASQ* |
Ga0066665_109553862 | 3300006796 | Soil | RVQQWKAGTLSDAALWHQCFFDPPETFNVAGPAGGQ* |
Ga0066660_109907841 | 3300006800 | Soil | IFDSVDGGMIAATLASLEQWKAGALSDAALWHQCFFDPPETFDSSSSSASQ* |
Ga0075436_1015193141 | 3300006914 | Populus Rhizosphere | ALHQWKAGTLSDSALWHKCFFDPPETFDSAAPAGSQ* |
Ga0099830_117223052 | 3300009088 | Vadose Zone Soil | GMIAVPVAVLTQWKAGKWSDAALWHQSFFDPPETFSSTGLSASQ* |
Ga0099830_118834462 | 3300009088 | Vadose Zone Soil | LIFDSVDGGMIAATLPMVQQWKAGKLSDAGLWHQCFFDPPETFSPSGSAASQ* |
Ga0099827_107813142 | 3300009090 | Vadose Zone Soil | DSAEGGMIAVPVAVLTQWKAGKWSDAALWHQSFFDPPETFSSTGLSASQ* |
Ga0099792_102785001 | 3300009143 | Vadose Zone Soil | LSTLQQWKAGKLSDAALWHQCFFDPPETFTPYGSAASQ* |
Ga0116138_11774521 | 3300009552 | Peatland | PTLQQWKAGKLSDAALWHQCFFDPPETFNESGAAASQ* |
Ga0116114_10120195 | 3300009630 | Peatland | AATFPTLQQWKAGTLSDAALWHQCFFDPPETFTQSGASASQ* |
Ga0116114_11515192 | 3300009630 | Peatland | AATFPTLQQWKAGTLSDAALWHQCFFDPPETFTQSGASASH* |
Ga0116117_12165232 | 3300009635 | Peatland | VLQQWKAGTLSDAALWHQSFFDPPEIFSGSGSSASQ* |
Ga0116113_11545871 | 3300009638 | Peatland | PTVRQWKAGTLTDAALWHQCYFDPPETFTVPAPAGGH* |
Ga0116135_13559041 | 3300009665 | Peatland | VTLPVLQQWKAGTLSDAALWHQSFFDPPETFGASAGPSASQ* |
Ga0116135_14693701 | 3300009665 | Peatland | SVDGGMIAAALPTLQQWKAGTLSDAALWHQCFFDPPETFNVSGSSASQ* |
Ga0116130_12567971 | 3300009762 | Peatland | AATLPTLQQWKAGTLSDAALWHQCFFDPPETFTESGAAGGQ* |
Ga0126376_117743542 | 3300010359 | Tropical Forest Soil | VDGGMLAATSAALEQWKAGKLSDAALWHKCFFDPPEIFTGSAPSGGN* |
Ga0136449_1025235211 | 3300010379 | Peatlands Soil | ADGGMIATTVSTLQQWKAGKLSDSALWHQSYFDPPEKFNSDGLTASQ* |
Ga0136449_1035651642 | 3300010379 | Peatlands Soil | AGIVLIFDSVDGGMIAATFPTLQQWKAGKMSDVAMWHQCFFDPPETFNESGVSASQ* |
Ga0137392_104461182 | 3300011269 | Vadose Zone Soil | QQWKAGKLSDAALWHQCFFDPPETFNESGAPASQ* |
Ga0137391_111550251 | 3300011270 | Vadose Zone Soil | ADGGMIAVPVAVLTQWKAGKWSDAALWHQSFFDPPETFSSTGLSASQ* |
Ga0137393_101483004 | 3300011271 | Vadose Zone Soil | DSVDGGMIAAAFPTLQQWKAGKLSDAALWHQCFFDPPETFNESGAPVSQ* |
Ga0137381_103263011 | 3300012207 | Vadose Zone Soil | EQWKAGALSDAALWHQCFFDPPETFDSSSSSASQ* |
Ga0137396_111493222 | 3300012918 | Vadose Zone Soil | SLEQWKAGALSDAALWHQCFFDPPETFDSSSSSASQ* |
Ga0181527_13322462 | 3300014153 | Bog | DGGMIAATFPTLQQWKAGTLSDAALWHQCFFDPPETFTQSGASASQ* |
Ga0187802_101241791 | 3300017822 | Freshwater Sediment | MIAASKATLAQWKAGNLSDGALWHNCFFDPPETFLASGPSATR |
Ga0187820_12699101 | 3300017924 | Freshwater Sediment | IAATQAVLQKWKVGSLSDAALWHSCYFDPPETFSSGGNSASQ |
Ga0187856_12191252 | 3300017925 | Peatland | AATFPTLQQWKAGTLSDAALWHQCFFDPPETFTQSGASASQ |
Ga0187856_12191292 | 3300017925 | Peatland | AATFPTLQQWKAGTLSDAALWHQCFFDPPETFTQSGASASH |
Ga0187879_103113852 | 3300017946 | Peatland | PTLQQWKAGKLSDAALWHQCFFDPPETFNESGAAASQ |
Ga0187817_103217912 | 3300017955 | Freshwater Sediment | SVDGGMIAATFVTLQQWKAGTLSDAGLWHQCFFDPPETFAETGAGASP |
Ga0187817_107192271 | 3300017955 | Freshwater Sediment | DSADGGMIAASTATLAQWKAGNLSDGALWHNCFFDPPETFLASGPSATR |
Ga0187779_104025741 | 3300017959 | Tropical Peatland | IAAPVATLQQWKIGALSDAALWHQCFFDPPETFDSAQLSQK |
Ga0187816_105649651 | 3300017995 | Freshwater Sediment | MIAATAATLQQWKAGTLTDAALWHKCFFDPPETFDSAAASGSR |
Ga0187804_102845751 | 3300018006 | Freshwater Sediment | TLPTIQRWRAGTLNDAAMWHQCYFDPPETFTITSAAGSR |
Ga0187805_106488421 | 3300018007 | Freshwater Sediment | AATAPTIQRWKAGTLTDAALWHQCYFDPPETFSVSSASVSR |
Ga0187874_101501001 | 3300018019 | Peatland | GTLEQWKAGKLSDSALWHQSYFDPPETFGAAGSSASQ |
Ga0187869_105561132 | 3300018030 | Peatland | FPTLQQWKAGTLSDAALWHQCFFDPPETFTQSGASASH |
Ga0187855_104192681 | 3300018038 | Peatland | MAATLATLQQWKAGKLSDAGLWHQCFFDPPETFSESGAAASQ |
Ga0187890_100534961 | 3300018044 | Peatland | IAATLPTLQQWKAGTLSDAALWHQCFFDPPETFTESGAAGGQ |
Ga0187766_103904812 | 3300018058 | Tropical Peatland | ATLATIQRWKAGTLNDAALWHQCYFDPPETFTVSSAAASR |
Ga0187772_100760793 | 3300018085 | Tropical Peatland | ADGGMIAATFPTLQQWKAGKLTDAALWHQCFFDPPEILGSSGPSASE |
Ga0187769_111832672 | 3300018086 | Tropical Peatland | LLTIQRWKAGTLNDAAMWHQCYFDPPETFAISSASASR |
Ga0187771_115066871 | 3300018088 | Tropical Peatland | PTIQRWKAGALNDAALWHQCYFDPPETFSISGGTASR |
Ga0066662_128199181 | 3300018468 | Grasslands Soil | MIAVPVAVLTQWKAGKWSDAALWHQSFFDPPETFGSASLSGSQ |
Ga0187798_18653951 | 3300019275 | Peatland | MIAATSSTLQQWKAGKLSDAGLWHQCFFDPPETFTVSSASAGR |
Ga0187800_13026942 | 3300019278 | Peatland | VLIFDSADGGMIAATFPTLQQWKAGKLTDAALWHQCFFDPPEILGSSGPSASE |
Ga0182031_12360011 | 3300019787 | Bog | PSMAHDRGTFPTVRQWKAGTLSDAALWHQCYFDPPETFTVSNPPAGH |
Ga0210407_110956121 | 3300020579 | Soil | ATTVGTLQQWKAGKLSDSALWHQSYFDPPETFSSDSPSASQ |
Ga0210399_114499362 | 3300020581 | Soil | LPTLQQWKAGKLSDAALWHQCFFDPPETFNPIASAATH |
Ga0210395_101906943 | 3300020582 | Soil | VVVIFDAVDGGMLAATLPTLQQWKAGKLSDAALWHQCFFDPPETFSSTGASASQ |
Ga0210401_113590081 | 3300020583 | Soil | ATSSALAQWKAGTLSDSALWHKCFFDPPETFDSTGPSGN |
Ga0210385_109284071 | 3300021402 | Soil | ALPTLQQWKAGKLSDAAMWHQCFFDPPETFNAAGAGASQ |
Ga0210385_109491732 | 3300021402 | Soil | FATLQKWKAGSLSDAALWHQCFFDPPEIQGSPSASASE |
Ga0210397_109780231 | 3300021403 | Soil | DSADGGMIAATLLTLQQWKAGTLSDAALWHQCFFDPPETFTGAGVSASQ |
Ga0210389_103939452 | 3300021404 | Soil | DGGMIAAAFATLQQWKAGTLSDAALWHQCFFDPPEIFTGTGAAGSP |
Ga0210387_114407161 | 3300021405 | Soil | DAADGGMIAATLLTLQQWKAGKLSDAALWHQCFFDPPETFSESGAAASQ |
Ga0210394_103535561 | 3300021420 | Soil | DSVDGGMIATTFATLQQWKAGKMSDAALWHQCFFDPPEIFSESGVSASQ |
Ga0210394_106716071 | 3300021420 | Soil | DSVDGGMIAAAFPTLQQWKAGKLSDAGLWHQCFFDPPETFNESGTAASQ |
Ga0210384_112054201 | 3300021432 | Soil | SADGGMIAVPAAILQKWKSGKLSDSALWHACYFDPPETFGGDNSAGQ |
Ga0210391_101668251 | 3300021433 | Soil | GMIATTLSTLEEWKAGKLSDSALWHQSYFDPPETFGAAGSSASQ |
Ga0210391_104977012 | 3300021433 | Soil | IVLIFDSADGGMIGVTLPVLQQWKAGTLSDAALWHQSFFDPPETFGVSAGSSASQ |
Ga0210390_113536721 | 3300021474 | Soil | DGGMIAATLGTIRKWKAGGLTDAALWHQCYFDPPETFTISSVAGSQ |
Ga0242649_10073973 | 3300022509 | Soil | RRRSESCFDSADGSMIAVTLPILQQWKAGTLSDAALWHQSFFDPPETFGVSAGPSASQ |
Ga0242649_10700432 | 3300022509 | Soil | LQQWKAGKLSDAALWHQCFFDPPETFSESGAAASQ |
Ga0212123_102151214 | 3300022557 | Iron-Sulfur Acid Spring | VAAPQAALEKWKAGALSDSAFWRTCFFDPPETFNSGGSSASQ |
Ga0242677_10530002 | 3300022713 | Soil | IFDAVDGGMIAATLPTLQQWKAGKLSDAALWHQCFFDPPETFSESGAAASQ |
Ga0242657_11930121 | 3300022722 | Soil | TIQQWKSGKLSDAALWHQSYFDPPETLDSASPSASQ |
Ga0242654_100113705 | 3300022726 | Soil | FPTLQLWKAGKLSDAGLWHQCFFDPPETFNESRAAASQ |
Ga0224550_10486772 | 3300022873 | Soil | VLIFDSVDGGMIAATFPALQQWKAGKMSDAALWHQCFFDPPETFNESGASASQ |
Ga0224572_10599621 | 3300024225 | Rhizosphere | FDSADGGMIAATFPVLQQWKAGKLTDAGLWHQCFFDPPETFSTTGTAASQ |
Ga0208194_10347671 | 3300025412 | Peatland | FDAADGGMIAATFPTLQQWKAGKLSDAALWHQCFFDPPETFTQSGASASQ |
Ga0208691_11203031 | 3300025612 | Peatland | AVTLPVLQQWKAGTLSDAALWHQSFFDPPETFGASAGPSASQ |
Ga0209056_100744321 | 3300026538 | Soil | TLASLEQWKAGALSDAALWHQCFFDPPETFDSSSSSASQ |
Ga0209161_100176956 | 3300026548 | Soil | MIAATLASLEQWKAGALSDAALWHQCFFDPPETFDSSSSSASQ |
Ga0209648_101936712 | 3300026551 | Grasslands Soil | ATLASLAQWKAGALSDAALWHQCFFDPPETFDSSSSSASQ |
Ga0179587_102841302 | 3300026557 | Vadose Zone Soil | ATLPTVQQWKAGTLSDAALWHQCYFDPPETFNVAGPAGGQ |
Ga0179587_110889121 | 3300026557 | Vadose Zone Soil | IAATISTLQQWKAGALSDAALWHQCFFDPPESFNSSGSAGTF |
Ga0208731_10372781 | 3300027029 | Forest Soil | LSTLEEWKAGKLSDSALWHQSYFDPPETFGAAGSSASQ |
Ga0208993_10865141 | 3300027480 | Forest Soil | ASLEQWKAGTLSDAALWHQCFFDPPETFDSSSSSASQ |
Ga0209115_11167561 | 3300027567 | Forest Soil | DGGMIAATFATLQQWKAGKMSDAALWHQCFFDPPETFNESGASASQ |
Ga0209733_11298051 | 3300027591 | Forest Soil | MIAATLPTVQAWKAGTLSDSALWHQCYFDPPETFTVSSNPVSGH |
Ga0209420_10347241 | 3300027648 | Forest Soil | TFSTLKQWKAGQLSDAALWHQCFFDPPETFVPSGTPGSK |
Ga0209420_11652791 | 3300027648 | Forest Soil | VLIFDSVDGGMIAATFPTLQQWKAGKMSDAALWHQCFFDPPETFNESEMSVSQQPNR |
Ga0209011_11850081 | 3300027678 | Forest Soil | IAATLASLEQWKAGTLSDAALWHQCFFDPPETFDSSSSSASQ |
Ga0209274_100262304 | 3300027853 | Soil | PVLQQWKAGTLSDAALWHQSFFDPPETFGVSAGPSASQ |
Ga0209701_106965732 | 3300027862 | Vadose Zone Soil | GMIAVPVAVLTQWKAGKWSDAALWHQSFFDPPETFSSTGLSASQ |
Ga0209579_106369941 | 3300027869 | Surface Soil | GMIAATFETLQDWKAGKLSDAALWHQCFFDPPEIFTGPTVAASP |
Ga0209169_100623563 | 3300027879 | Soil | AVDGGMIAATYATLQQWKAGKLSDAALWHQCFFDPPETFNPTGASASQ |
Ga0209169_101976001 | 3300027879 | Soil | LLTLQQWKAGTLSDAALWHQCFFDPPETFTESGAAGGQ |
Ga0209275_100029449 | 3300027884 | Soil | VVVIFDAVDGGMLAATLPTLQQWKAGKLSDAALWHQCFFDPPETFSATGASASQ |
Ga0209380_101366481 | 3300027889 | Soil | TLQQWKAGTLSDAALWHQCFFDPPETFTESGAAGGQ |
Ga0209067_100297624 | 3300027898 | Watersheds | GMIAAPFSALQRWKAGTLSDAALWHQCFFDPPETFTVAGSSSGE |
Ga0209415_107555062 | 3300027905 | Peatlands Soil | DSADGGMIAATLPTLQQWKAGTLSDAALWHQCFFDPPESFTAAGSSGGQ |
Ga0209698_108467862 | 3300027911 | Watersheds | ALAQWKAGTLSDSALWHKCFFDPPETFDSTGPSGN |
Ga0209698_108467872 | 3300027911 | Watersheds | ALAQWKAGTLSDSALWHKCFFDPPETFDSTGPLGN |
Ga0265354_10094882 | 3300028016 | Rhizosphere | LQQWKAGKLSDAALWHQCFFDPPETFSATGSAASQ |
Ga0265356_10301161 | 3300028017 | Rhizosphere | TFPTLQQWKAGKLSDAGLWHQCFFDPPETFNVSNPAGSE |
Ga0302147_101695902 | 3300028566 | Bog | IAAAFPALQQWKAGKLTDAGLWHLCFFDPPETFDESAASGAAAASQ |
Ga0302152_103092122 | 3300028572 | Bog | DGGMIAAAFPALQQWKAGKLTDAGLWHLCFFDPPETFDESAASGAAAASQ |
Ga0302224_100828561 | 3300028759 | Palsa | GMIAATFPALQQWKAGKMSDAALWHQCFFDPPETFNESGASASQ |
Ga0302225_102591262 | 3300028780 | Palsa | MIAATFPVLQQWKAGTLSDAALWHQCFFDPPEILNGPGSSASQ |
Ga0302232_104243141 | 3300028789 | Palsa | QQWKAGKMSDAALWHQCFFDPPETFNESEISVSQQQNR |
Ga0302222_103703122 | 3300028798 | Palsa | VLIFDSADGGMIAVTLPVLQQWKAGTLSDAALWHQSFFDPPETFGVSAGSSASQ |
Ga0302278_102668941 | 3300028866 | Bog | GIVLIFDSADGGMIAATFPVLQQWKAGTLSDAALWHQSFFDPPEIFSGSGSSASQ |
Ga0302155_100467984 | 3300028874 | Bog | MIAAAFPALQQWKAGKLTDAGLWHLCFFDPPETFDESAASGAAAASQ |
Ga0308309_105396411 | 3300028906 | Soil | ADGGMIAATLLTLQQWKAGTLSDAALWHQCFFDPPETFTESGAAGGQ |
Ga0222749_103695171 | 3300029636 | Soil | GIVVIFDSVDGGMIAAAFPTLQQWKAGKLSDAALWHQCFFDPPETFNESGISASQ |
Ga0311330_105502861 | 3300029945 | Bog | GMIAATFPVLQQWKAGTLSDAALWHQSFFDPPEIFSGSGSSASQ |
Ga0302277_10651373 | 3300029982 | Bog | GMIAATFPTLQQWKAGKISDAALWHQCFFDPPETFNESEISASQQRAY |
Ga0302304_100535361 | 3300029993 | Palsa | DSIEGGMIAAPFPVLQQWKAGKLSDAGLWHRCLFDPPETFDESGPSASR |
Ga0311338_118518191 | 3300030007 | Palsa | LIFDSADGGMIAAALPVLAQWKAGTLSDAGLWHQCFFDPPETFDSTAASGSQ |
Ga0302306_104314222 | 3300030043 | Palsa | QQWKAGTLSDAALWHQSFFDPPETFGVSAGSSASQ |
Ga0302195_104867201 | 3300030051 | Bog | PALQQWKAGKLTDAGLWHLCFFDPPETFDESAASGAAAASQ |
Ga0302177_107223652 | 3300030053 | Palsa | LQQWKAGKMSDAALWHQCFFDPPETFNESGASASQ |
Ga0302182_101835091 | 3300030054 | Palsa | IAATFPTVQQWKAGTLTDAALWHQCYFDPPETFTVSSSSGGH |
Ga0311372_110731932 | 3300030520 | Palsa | WIVLIFDSVDGGMIAATFPTLQQWKAGKMSDAALWHQCFFDPPETFNESEISVSQQQNR |
Ga0311372_128184101 | 3300030520 | Palsa | DGGMIAATVPTVRQWKAGTLTDAALWHQCYFDPPETFTVPAPAGGH |
Ga0311354_112098491 | 3300030618 | Palsa | FATLQQWKAGKMSDAALWHQCFFDPPETFNESGVSASQ |
Ga0311345_100889471 | 3300030688 | Bog | QWKAGKLTDAGLWHLCFFDPPETFDESAASGAAAASQ |
Ga0310039_103525411 | 3300030706 | Peatlands Soil | TLPTVQQWKAGRLTDAALWHRCYFDPPETFSASSPAVSSSAGNH |
Ga0265460_113771372 | 3300030740 | Soil | ADGGMIAATLPTLQQWKAGTLSDAALWHQCFFDPPESFTAGTSSGGQ |
Ga0265745_10099181 | 3300030759 | Soil | PTLQQWKAGKLSDAALWHQCFFDPPETFSATGASASQ |
Ga0265750_10097062 | 3300030813 | Soil | AATFPTLQQWKAGKLSDAGLWHQCFFDPPETFNVSNPAGSE |
Ga0265753_10827922 | 3300030862 | Soil | DSADGGMIGVTLPVLQQWKAGTLSDAALWHQSFFDPPETFGVSAGSSASQ |
Ga0073994_120555421 | 3300030991 | Soil | GMIAASFATLQQWKAGTLSDAALWHQCFFDPPEIFTGTGAAGSP |
Ga0170824_1153465911 | 3300031231 | Forest Soil | RVLIFDSVDGGMIAATFPTLQQWKAGTLSDAALWHQCFFDPPETFAEAGAGAGP |
Ga0302325_126457602 | 3300031234 | Palsa | IAATSPALQQWKAGKMSDAALWHQCFFDPPETFNESGASASQ |
Ga0302324_1010910081 | 3300031236 | Palsa | IFDAVDGGMLAVTFPTLQQWKAGKLSDAALWHQCFFDPPETFSDSGPAASH |
Ga0302140_105377691 | 3300031261 | Bog | LPTVQQWKAGTLTDAALWHQCYFDPPETFTVQTAAPGH |
Ga0170818_1026578492 | 3300031474 | Forest Soil | MIAATLPTVQQWKAGTLSDAALWHQCYFDPPETFNVAGPAGGQ |
Ga0307468_1002687072 | 3300031740 | Hardwood Forest Soil | VLQQWKAGTLTDSALWHKCFFDPPEVFDSNDASGGQ |
Ga0307477_111683821 | 3300031753 | Hardwood Forest Soil | ATSATLQQWKAGTLSDAALWHNCFFDPPETFTSGGNSAAQ |
Ga0316037_1044631 | 3300031808 | Soil | QWKAGRLSDAALWHQCFFDPPETFNVSGSANVSGSSASQ |
Ga0307479_111600611 | 3300031962 | Hardwood Forest Soil | DGGMIAATMATLQEWRAGKLSDSALWHQCFFDPPETFEPSASSASQ |
Ga0307470_108970622 | 3300032174 | Hardwood Forest Soil | VDGGMIAATLPSLQQWKAGKLSDAALWHQCFFDPPEIFSPSGSAASQ |
Ga0348332_114732584 | 3300032515 | Plant Litter | FDAVDGGMIAAALPTLQQWKAGKLSDAAMWHQCFFDPPETFGAAGAGATQ |
Ga0335069_118368012 | 3300032893 | Soil | MIAATLPTIQRWKAGTLTDAAMWHQCYFDPPETFTVSGAGGSR |
Ga0335076_110583392 | 3300032955 | Soil | AATSDTLQQWKAGSLSDAALWHQCFFDPPETFDSATPSGGK |
Ga0335073_112933571 | 3300033134 | Soil | AATLPTIRKWKAGSLTDAAMWHQCYFDPPETFTISSAASGR |
Ga0335077_102663181 | 3300033158 | Soil | ATSDTLQQWKAGSLSDAALWHQCFFDPPETFDSATPSGGK |
⦗Top⦘ |