Basic Information | |
---|---|
Family ID | F040728 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 161 |
Average Sequence Length | 47 residues |
Representative Sequence | MYKSQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVENSEVVES |
Number of Associated Samples | 128 |
Number of Associated Scaffolds | 161 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 20.50 % |
% of genes near scaffold ends (potentially truncated) | 22.98 % |
% of genes from short scaffolds (< 2000 bps) | 88.20 % |
Associated GOLD sequencing projects | 120 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.62 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (56.522 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (5.590 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.677 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.478 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.89% β-sheet: 2.63% Coil/Unstructured: 64.47% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 161 Family Scaffolds |
---|---|---|
PF00582 | Usp | 1.86 |
PF01557 | FAA_hydrolase | 1.86 |
PF00005 | ABC_tran | 1.86 |
PF03449 | GreA_GreB_N | 1.24 |
PF00903 | Glyoxalase | 1.24 |
PF02652 | Lactate_perm | 1.24 |
PF00160 | Pro_isomerase | 1.24 |
PF03994 | DUF350 | 1.24 |
PF00248 | Aldo_ket_red | 1.24 |
PF02687 | FtsX | 1.24 |
PF01425 | Amidase | 1.24 |
PF00484 | Pro_CA | 0.62 |
PF01610 | DDE_Tnp_ISL3 | 0.62 |
PF12681 | Glyoxalase_2 | 0.62 |
PF08002 | DUF1697 | 0.62 |
PF07589 | PEP-CTERM | 0.62 |
PF05988 | DUF899 | 0.62 |
PF01814 | Hemerythrin | 0.62 |
PF01833 | TIG | 0.62 |
PF03965 | Penicillinase_R | 0.62 |
PF01594 | AI-2E_transport | 0.62 |
PF03786 | UxuA | 0.62 |
PF01638 | HxlR | 0.62 |
PF14686 | fn3_3 | 0.62 |
PF00069 | Pkinase | 0.62 |
PF08241 | Methyltransf_11 | 0.62 |
PF07883 | Cupin_2 | 0.62 |
PF01411 | tRNA-synt_2c | 0.62 |
PF00361 | Proton_antipo_M | 0.62 |
PF00884 | Sulfatase | 0.62 |
PF02773 | S-AdoMet_synt_C | 0.62 |
PF01863 | YgjP-like | 0.62 |
PF06439 | 3keto-disac_hyd | 0.62 |
PF00849 | PseudoU_synth_2 | 0.62 |
PF13701 | DDE_Tnp_1_4 | 0.62 |
PF00106 | adh_short | 0.62 |
PF00196 | GerE | 0.62 |
PF00092 | VWA | 0.62 |
PF13847 | Methyltransf_31 | 0.62 |
PF03551 | PadR | 0.62 |
PF02374 | ArsA_ATPase | 0.62 |
PF00155 | Aminotran_1_2 | 0.62 |
PF01738 | DLH | 0.62 |
PF01243 | Putative_PNPOx | 0.62 |
PF06831 | H2TH | 0.62 |
PF13620 | CarboxypepD_reg | 0.62 |
PF12543 | DUF3738 | 0.62 |
PF00135 | COesterase | 0.62 |
PF13565 | HTH_32 | 0.62 |
PF15780 | ASH | 0.62 |
PF05199 | GMC_oxred_C | 0.62 |
PF00012 | HSP70 | 0.62 |
PF01558 | POR | 0.62 |
PF12848 | ABC_tran_Xtn | 0.62 |
PF07931 | CPT | 0.62 |
PF03372 | Exo_endo_phos | 0.62 |
PF13551 | HTH_29 | 0.62 |
PF13692 | Glyco_trans_1_4 | 0.62 |
COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.48 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.24 |
COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 1.24 |
COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 1.24 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.24 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.24 |
COG1620 | L-lactate permease | Energy production and conversion [C] | 1.24 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.62 |
COG0013 | Alanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
COG3896 | Chloramphenicol 3-O-phosphotransferase | Defense mechanisms [V] | 0.62 |
COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.62 |
COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.62 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.62 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.62 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.62 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.62 |
COG1451 | UTP pyrophosphatase, metal-dependent hydrolase family | General function prediction only [R] | 0.62 |
COG1312 | D-mannonate dehydratase | Carbohydrate transport and metabolism [G] | 0.62 |
COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 0.62 |
COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 0.62 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.62 |
COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 0.62 |
COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.62 |
COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.62 |
COG0192 | S-adenosylmethionine synthetase | Coenzyme transport and metabolism [H] | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.14 % |
Unclassified | root | N/A | 42.86 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000559|F14TC_101189940 | Not Available | 629 | Open in IMG/M |
3300000956|JGI10216J12902_105310950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1534 | Open in IMG/M |
3300002568|C688J35102_119178297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 650 | Open in IMG/M |
3300004092|Ga0062389_103821002 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Arcticibacter → Arcticibacter eurypsychrophilus | 565 | Open in IMG/M |
3300004114|Ga0062593_101549587 | All Organisms → cellular organisms → Bacteria → PVC group | 716 | Open in IMG/M |
3300004114|Ga0062593_103419111 | Not Available | 509 | Open in IMG/M |
3300005329|Ga0070683_100000063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 79423 | Open in IMG/M |
3300005329|Ga0070683_100431246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1258 | Open in IMG/M |
3300005334|Ga0068869_101119753 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300005335|Ga0070666_10401953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 985 | Open in IMG/M |
3300005338|Ga0068868_100179034 | All Organisms → cellular organisms → Bacteria | 1758 | Open in IMG/M |
3300005338|Ga0068868_101765475 | Not Available | 584 | Open in IMG/M |
3300005364|Ga0070673_100176751 | All Organisms → cellular organisms → Bacteria | 1825 | Open in IMG/M |
3300005366|Ga0070659_100662985 | Not Available | 900 | Open in IMG/M |
3300005367|Ga0070667_100599671 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300005439|Ga0070711_100883470 | Not Available | 762 | Open in IMG/M |
3300005531|Ga0070738_10059430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 2307 | Open in IMG/M |
3300005535|Ga0070684_100347483 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1364 | Open in IMG/M |
3300005577|Ga0068857_100390854 | Not Available | 1293 | Open in IMG/M |
3300005602|Ga0070762_11141736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 538 | Open in IMG/M |
3300005610|Ga0070763_10622272 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Arcticibacter → Arcticibacter eurypsychrophilus | 627 | Open in IMG/M |
3300005614|Ga0068856_100607759 | Not Available | 1114 | Open in IMG/M |
3300005764|Ga0066903_102224751 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1058 | Open in IMG/M |
3300005764|Ga0066903_104501328 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300005841|Ga0068863_101373379 | Not Available | 714 | Open in IMG/M |
3300005842|Ga0068858_100471497 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
3300005995|Ga0066790_10310519 | Not Available | 673 | Open in IMG/M |
3300006176|Ga0070765_101998301 | Not Available | 542 | Open in IMG/M |
3300006804|Ga0079221_11071751 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300006844|Ga0075428_101581787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 686 | Open in IMG/M |
3300006881|Ga0068865_102207026 | Not Available | 501 | Open in IMG/M |
3300006931|Ga0097620_102774849 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300009093|Ga0105240_12446038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 540 | Open in IMG/M |
3300009094|Ga0111539_10290728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1902 | Open in IMG/M |
3300009094|Ga0111539_12640324 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300009098|Ga0105245_11509086 | Not Available | 723 | Open in IMG/M |
3300009100|Ga0075418_10511186 | Not Available | 1290 | Open in IMG/M |
3300009101|Ga0105247_11293213 | Not Available | 585 | Open in IMG/M |
3300009156|Ga0111538_10188023 | Not Available | 2622 | Open in IMG/M |
3300009175|Ga0073936_10001522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 35513 | Open in IMG/M |
3300009176|Ga0105242_12280242 | Not Available | 587 | Open in IMG/M |
3300009177|Ga0105248_10532781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 1324 | Open in IMG/M |
3300009177|Ga0105248_10700273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1143 | Open in IMG/M |
3300009610|Ga0105340_1010823 | All Organisms → cellular organisms → Bacteria | 3604 | Open in IMG/M |
3300009623|Ga0116133_1111449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
3300009624|Ga0116105_1155423 | Not Available | 609 | Open in IMG/M |
3300010048|Ga0126373_11384230 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300010371|Ga0134125_12386249 | Not Available | 575 | Open in IMG/M |
3300010375|Ga0105239_11097882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 916 | Open in IMG/M |
3300010376|Ga0126381_100563561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1616 | Open in IMG/M |
3300010376|Ga0126381_101522346 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300010376|Ga0126381_102828918 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300010397|Ga0134124_13126764 | Not Available | 507 | Open in IMG/M |
3300010401|Ga0134121_12275583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
3300010403|Ga0134123_13276972 | Not Available | 522 | Open in IMG/M |
3300011120|Ga0150983_10943257 | Not Available | 599 | Open in IMG/M |
3300012212|Ga0150985_100593617 | Not Available | 663 | Open in IMG/M |
3300012212|Ga0150985_105762259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
3300012212|Ga0150985_107944868 | Not Available | 659 | Open in IMG/M |
3300012212|Ga0150985_109703732 | Not Available | 555 | Open in IMG/M |
3300012212|Ga0150985_110210830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 528 | Open in IMG/M |
3300012212|Ga0150985_113026592 | Not Available | 507 | Open in IMG/M |
3300012469|Ga0150984_100564356 | Not Available | 519 | Open in IMG/M |
3300012469|Ga0150984_107072713 | Not Available | 514 | Open in IMG/M |
3300012469|Ga0150984_107868081 | Not Available | 558 | Open in IMG/M |
3300012469|Ga0150984_115455662 | Not Available | 659 | Open in IMG/M |
3300012469|Ga0150984_117093670 | Not Available | 1154 | Open in IMG/M |
3300012469|Ga0150984_121489161 | Not Available | 1499 | Open in IMG/M |
3300012469|Ga0150984_121935754 | Not Available | 1229 | Open in IMG/M |
3300012929|Ga0137404_11823674 | Not Available | 566 | Open in IMG/M |
3300012961|Ga0164302_10637653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 779 | Open in IMG/M |
3300012971|Ga0126369_12983704 | Not Available | 554 | Open in IMG/M |
3300013104|Ga0157370_11455938 | Not Available | 616 | Open in IMG/M |
3300013296|Ga0157374_11929574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 616 | Open in IMG/M |
3300013297|Ga0157378_10749547 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300013297|Ga0157378_11831358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
3300013306|Ga0163162_12318323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300013307|Ga0157372_10229910 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 2150 | Open in IMG/M |
3300013308|Ga0157375_12138593 | Not Available | 666 | Open in IMG/M |
3300014160|Ga0181517_10531373 | Not Available | 593 | Open in IMG/M |
3300014161|Ga0181529_10037848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3572 | Open in IMG/M |
3300014161|Ga0181529_10742624 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300014164|Ga0181532_10521226 | Not Available | 650 | Open in IMG/M |
3300014168|Ga0181534_10761762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 570 | Open in IMG/M |
3300014169|Ga0181531_10047539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 2505 | Open in IMG/M |
3300014325|Ga0163163_10762735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1031 | Open in IMG/M |
3300014325|Ga0163163_11563427 | Not Available | 721 | Open in IMG/M |
3300014491|Ga0182014_10079207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2069 | Open in IMG/M |
3300014492|Ga0182013_10441422 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300014499|Ga0182012_10154226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1654 | Open in IMG/M |
3300014501|Ga0182024_12950368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300014838|Ga0182030_10553777 | Not Available | 1127 | Open in IMG/M |
3300014969|Ga0157376_12580508 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300015053|Ga0137405_1007182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1039 | Open in IMG/M |
3300015371|Ga0132258_13093364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1150 | Open in IMG/M |
3300016294|Ga0182041_11047377 | Not Available | 739 | Open in IMG/M |
3300017947|Ga0187785_10721376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium | 525 | Open in IMG/M |
3300017965|Ga0190266_10085946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1247 | Open in IMG/M |
3300017988|Ga0181520_10118636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2219 | Open in IMG/M |
3300017988|Ga0181520_11149907 | Not Available | 506 | Open in IMG/M |
3300018043|Ga0187887_10152367 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
3300018046|Ga0187851_10422668 | Not Available | 761 | Open in IMG/M |
3300018081|Ga0184625_10595420 | Not Available | 543 | Open in IMG/M |
3300018468|Ga0066662_11125353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 787 | Open in IMG/M |
3300020076|Ga0206355_1345450 | Not Available | 634 | Open in IMG/M |
3300020082|Ga0206353_10009383 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300020579|Ga0210407_10293345 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → unclassified Nitrospirales → Nitrospirales bacterium | 1270 | Open in IMG/M |
3300020581|Ga0210399_11399352 | Not Available | 547 | Open in IMG/M |
3300020583|Ga0210401_10167820 | All Organisms → cellular organisms → Bacteria | 2048 | Open in IMG/M |
3300021403|Ga0210397_11506699 | Not Available | 522 | Open in IMG/M |
3300021560|Ga0126371_12353033 | Not Available | 644 | Open in IMG/M |
3300021855|Ga0213854_1066228 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
3300022467|Ga0224712_10329811 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300022555|Ga0212088_10037146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 5651 | Open in IMG/M |
3300025913|Ga0207695_10121066 | Not Available | 2585 | Open in IMG/M |
3300025916|Ga0207663_10749040 | Not Available | 776 | Open in IMG/M |
3300025930|Ga0207701_11082480 | Not Available | 665 | Open in IMG/M |
3300025932|Ga0207690_10552028 | Not Available | 937 | Open in IMG/M |
3300025940|Ga0207691_11664011 | Not Available | 517 | Open in IMG/M |
3300026035|Ga0207703_12168929 | Not Available | 532 | Open in IMG/M |
3300026041|Ga0207639_11604118 | Not Available | 610 | Open in IMG/M |
3300026116|Ga0207674_10391917 | Not Available | 1342 | Open in IMG/M |
3300027965|Ga0209062_1041633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2315 | Open in IMG/M |
3300028379|Ga0268266_10164874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2007 | Open in IMG/M |
3300028379|Ga0268266_11884516 | Not Available | 572 | Open in IMG/M |
3300028800|Ga0265338_10686885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 707 | Open in IMG/M |
3300028813|Ga0302157_10418349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 711 | Open in IMG/M |
3300029911|Ga0311361_10687204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 943 | Open in IMG/M |
3300029913|Ga0311362_11238014 | Not Available | 551 | Open in IMG/M |
3300029922|Ga0311363_11395597 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300030007|Ga0311338_10305777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1753 | Open in IMG/M |
3300031057|Ga0170834_102628532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
3300031099|Ga0308181_1050840 | Not Available | 786 | Open in IMG/M |
3300031231|Ga0170824_124576818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
3300031234|Ga0302325_10038802 | All Organisms → cellular organisms → Bacteria | 9674 | Open in IMG/M |
3300031234|Ga0302325_12557493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 607 | Open in IMG/M |
3300031238|Ga0265332_10055085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1705 | Open in IMG/M |
3300031344|Ga0265316_10641992 | Not Available | 751 | Open in IMG/M |
3300031524|Ga0302320_12007547 | Not Available | 542 | Open in IMG/M |
3300031716|Ga0310813_12339433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 507 | Open in IMG/M |
3300031718|Ga0307474_10291952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 1255 | Open in IMG/M |
3300031897|Ga0318520_10707181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 630 | Open in IMG/M |
3300031910|Ga0306923_10253583 | Not Available | 2013 | Open in IMG/M |
3300031910|Ga0306923_12054589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 578 | Open in IMG/M |
3300031910|Ga0306923_12284596 | Not Available | 540 | Open in IMG/M |
3300031938|Ga0308175_100357798 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
3300031938|Ga0308175_101423208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 774 | Open in IMG/M |
3300031938|Ga0308175_101829040 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300031938|Ga0308175_102016877 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300031939|Ga0308174_10022243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3948 | Open in IMG/M |
3300031942|Ga0310916_10255102 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
3300031954|Ga0306926_12064996 | Not Available | 639 | Open in IMG/M |
3300031996|Ga0308176_10203862 | Not Available | 1862 | Open in IMG/M |
3300031996|Ga0308176_10682476 | Not Available | 1064 | Open in IMG/M |
3300032074|Ga0308173_10994833 | Not Available | 779 | Open in IMG/M |
3300032770|Ga0335085_10021911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 9089 | Open in IMG/M |
3300032770|Ga0335085_11949519 | Not Available | 597 | Open in IMG/M |
3300032893|Ga0335069_10725068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1128 | Open in IMG/M |
3300032893|Ga0335069_11571328 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 706 | Open in IMG/M |
3300034115|Ga0364945_0164500 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300034672|Ga0314797_111016 | Not Available | 573 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.59% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.97% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 4.35% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.73% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.11% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.11% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.11% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.48% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.48% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.48% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.48% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.48% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.48% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.48% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.86% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.86% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.86% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.86% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.86% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.86% |
Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 1.24% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.24% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.24% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.24% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.24% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.24% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.24% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.24% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.24% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.24% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.24% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.24% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.24% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.62% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.62% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.62% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.62% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.62% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.62% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.62% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.62% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.62% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.62% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.62% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.62% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.62% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.62% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F14TC_1011899402 | 3300000559 | Soil | MLYWPGMYKSKYTPAEAQEQLKLNDESSHHQARKDRVRRYIEARIVEVPELVEN* |
JGI10216J12902_1053109502 | 3300000956 | Soil | MYKSQYTPDEAQKQLKLNEESSHHQARKDRVKRYIQARIVDVPEVAEK* |
C688J35102_1191782971 | 3300002568 | Soil | MYKSQYTPQEAQEQFRLIEESSHHQARKDRHKRYVERRIVETPEAES* |
Ga0062389_1038210021 | 3300004092 | Bog Forest Soil | MYKTQYTPEEAQEQFRLIEDSSHHQDHKDRVTRYIQRRVVETLEVVENPLS* |
Ga0062593_1015495872 | 3300004114 | Soil | MYKTQYTPEEAREQIRMVEESSHHQARKDRVRRYIERRIVEASEALDQ* |
Ga0062593_1034191112 | 3300004114 | Soil | MLYLQGMYKSQYTPAEAQEQLKLNDESSHHQARKDRVRRYIEARIVEVPELVEN* |
Ga0070683_10000006316 | 3300005329 | Corn Rhizosphere | MYKSQYTPEEAQEQFRQVEESAHHQARKDRMKRYIQARIVDTPEAIEN* |
Ga0070683_1004312462 | 3300005329 | Corn Rhizosphere | MYKAQYTPQEAQEQFRLIDESSHHQARKDRVKRYIQNRTVEGQEIVEE* |
Ga0068869_1011197532 | 3300005334 | Miscanthus Rhizosphere | LGMYKTQYTPQEAQEQFRLIEESSHHQARKDRHKRYIERRIVENPEAGEN* |
Ga0070666_104019532 | 3300005335 | Switchgrass Rhizosphere | MGMYKTQYTPEEAQEQFRLIEDSSHHEARKDRVRRFIQRRIVEPTEVVND* |
Ga0068868_1001790342 | 3300005338 | Miscanthus Rhizosphere | MYKSQYTPEEAQEQFRLIEESAHHQERKDRVKRYIQRRIVEFPETAEN* |
Ga0068868_1017654752 | 3300005338 | Miscanthus Rhizosphere | MLS*TGMYKTQYTPEEAQEQFRLIEDSSHHEARKDRVRRFIQRRIVEPTEVVND* |
Ga0070673_1001767512 | 3300005364 | Switchgrass Rhizosphere | MYKSRYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVETSETGNN* |
Ga0070659_1006629851 | 3300005366 | Corn Rhizosphere | MYKTQYTQQEAQEQFRLIDESSHHQARKDRVKRYIQNRTVEGQEIVEE* |
Ga0070667_1005996711 | 3300005367 | Switchgrass Rhizosphere | MYKSQYTPDEAQEQFRLIEESTHHQARKDRVKRYIQRRIVESSEVAEQ* |
Ga0070711_1008834702 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MGMYKTQYTPQEAQEQFRLIEESSHDQLRKDRHRRYIERRIVDNLEVADQ* |
Ga0070738_100594302 | 3300005531 | Surface Soil | MYKSQYTPEEAQEQFRLVDESSHHQERKDRVKRYIQRRIVEVAEVVES* |
Ga0070684_1003474833 | 3300005535 | Corn Rhizosphere | MYKMQYTPQEAQEHFQTIDESSHHQERKDRVKRYIERRIVSNPEGGEN* |
Ga0068857_1003908542 | 3300005577 | Corn Rhizosphere | FRLIEESSHHQARKDRHKRYVERRIVESSEAVETSI* |
Ga0070762_111417361 | 3300005602 | Soil | MYKSQYTPDEAQEQFRLIDESNHHQGRKDRVKRYIQARIMETQEVVEN* |
Ga0070763_106222721 | 3300005610 | Soil | MYKTQYTPEEAQEQFRLIEESSHHQEHKDRVTRYIQRRVVETLEVIDN* |
Ga0068856_1006077592 | 3300005614 | Corn Rhizosphere | MYKTQYTPQEAQEQFRLIEESSHDQARKDRHRRYIERRIVESLEVADQ* |
Ga0066903_1022247512 | 3300005764 | Tropical Forest Soil | MYKSQYTPEEAQEQIRLVEESSHHQARKDRVRRYIERRVVESPELADR* |
Ga0066903_1045013282 | 3300005764 | Tropical Forest Soil | MGMYKSQYTPEEAQEQIRLVEESCHHQARKDRVRRYIERRTVETTEGLDQ* |
Ga0068863_1013733791 | 3300005841 | Switchgrass Rhizosphere | MYKSEYTPSEAQEQFKLIDESSHHDAYKERAKRYVRNRTVEAQEVVDK* |
Ga0068858_1004714972 | 3300005842 | Switchgrass Rhizosphere | MYKSQYTPEEAKEQFRLIEESAHHQERKDRVKRYIQRRIVEFPETAEN* |
Ga0066790_103105192 | 3300005995 | Soil | MYKSQYTPDEAQVLLKLNEESAHHQARKDRVRRYIQARIA |
Ga0070765_1019983011 | 3300006176 | Soil | MYKSQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVENSQVTES* |
Ga0079221_110717511 | 3300006804 | Agricultural Soil | MYKSEYTLIEAQEQFKLIDESSHHDAYKERAKRYIRNRIVEAQ |
Ga0075428_1015817873 | 3300006844 | Populus Rhizosphere | MLYLQRMYKSQYTPAEAQEQLQLNDESSHHQARKDRVRRYIEARIVEVPELVEN* |
Ga0068865_1022070262 | 3300006881 | Miscanthus Rhizosphere | MYKSQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVETSETGNN* |
Ga0097620_1027748492 | 3300006931 | Switchgrass Rhizosphere | MYKSQYTPEEAQEQFQLIEESNHHQARKDRVKRYIERRIVEMPEVVDN* |
Ga0105240_124460381 | 3300009093 | Corn Rhizosphere | MYKTQYTQQEAQEQFRLIDESSHHQAHKDRVKRYIQNRTVEGQEIVEE* |
Ga0111539_102907283 | 3300009094 | Populus Rhizosphere | MYKSKYTPAEAQEQLKLNDESSHHQARKDRVRRYIEARIVEVPELVEN* |
Ga0111539_126403242 | 3300009094 | Populus Rhizosphere | MYKLQYTPQEAQEQFQLIDQSNHPQARKDRVKRYIERRIVEMPE |
Ga0105245_115090861 | 3300009098 | Miscanthus Rhizosphere | MLSLVGMYKSQYTPEEAQEEFRLIDESSHHQARKDRVRRFIERRIVETTEVVNE* |
Ga0075418_105111861 | 3300009100 | Populus Rhizosphere | MYKSQYTPAEAQEQLQLNDESSHHQARKDRVRRYIEARIVEVPELAEN* |
Ga0105247_112932131 | 3300009101 | Switchgrass Rhizosphere | MYKTQYTPQEAQEQFRLIEESSHDQARKVRHRRYIERRIVESSEVADQ* |
Ga0111538_101880233 | 3300009156 | Populus Rhizosphere | MYKSQYTPAEAQEQLKLNDESSHHQARKDRVRRYIEARIVEVPELVEN* |
Ga0073936_1000152220 | 3300009175 | Freshwater Lake Hypolimnion | MYKSQYTPQEAQEHFKSIEESDHHRDRKDRVIRYIQRRIVEETETPQA* |
Ga0105242_122802422 | 3300009176 | Miscanthus Rhizosphere | MYKSEYTPQEAQEQFRLIDESAHHQARKDRVKRYIQRRIVESSEVAEQ* |
Ga0105248_105327813 | 3300009177 | Switchgrass Rhizosphere | MYKSQYTPQEAQEQFRLIDESAHHQARKDRVKRYIQRRIVESSEVAEQ* |
Ga0105248_107002732 | 3300009177 | Switchgrass Rhizosphere | MYKSQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVERSETENN* |
Ga0105340_10108233 | 3300009610 | Soil | PQEAQEQFQLIDQSNHPQARKDRVKRYIERRIVEMPEVVDN* |
Ga0116133_11114491 | 3300009623 | Peatland | MYKSQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVENSEVVES* |
Ga0116105_11554231 | 3300009624 | Peatland | MLTWEGMYKSQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVENSEVADK* |
Ga0126373_113842302 | 3300010048 | Tropical Forest Soil | MYKSQYTPEEAQEQIRLIEESSHHQERKDRVKRYIQRRVVETSGVVGS* |
Ga0134125_123862492 | 3300010371 | Terrestrial Soil | MYKSQYTPQEAQEQFRLIDESSHPEARKDRVRRYIERRIVETSELVEE* |
Ga0105239_110978822 | 3300010375 | Corn Rhizosphere | MYKSQYTPEEAQEQFRLIEESSHHHERKDRVKRYIQRRIVEISEISEN* |
Ga0126381_1005635612 | 3300010376 | Tropical Forest Soil | MGMYKSQYTPEEAQEQFRLIEESSHHQARKDRVKRYIERRIVESPEVVESSF* |
Ga0126381_1015223462 | 3300010376 | Tropical Forest Soil | MYKTHYTPQEAQEQFRLIEESSHDQARKDRHKRYIERRIVDSSEVVES* |
Ga0126381_1028289181 | 3300010376 | Tropical Forest Soil | MYKSQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVESSPEVGEN* |
Ga0134124_131267642 | 3300010397 | Terrestrial Soil | MYKTQYTPQEAQEQFRLIEESSHHQARKDRHKRYIERRIVENP |
Ga0134121_122755831 | 3300010401 | Terrestrial Soil | MYKSQYTPEEAQEEFRLIEESSHHQARKDRVRRFIERRIVETTEVVNE* |
Ga0134123_132769722 | 3300010403 | Terrestrial Soil | MYKTQYTPQEAQEQFRLIEESSHHQARKDRHKRYIERRIVENPEGGEN* |
Ga0150983_109432571 | 3300011120 | Forest Soil | MYKSQYTPDEAQELLKLNDESNHHQARKDRVRRYIQARIIDPQDVVEK* |
Ga0150985_1005936171 | 3300012212 | Avena Fatua Rhizosphere | MYKSQYTPEEAQEQFRQIEESAHHQARKDRVKRYIQARIVENPEVAEQ* |
Ga0150985_1057622591 | 3300012212 | Avena Fatua Rhizosphere | PQEAQEQFRLIEESSHHQARKDRVKRFIERRIVESSEVVDN* |
Ga0150985_1079448682 | 3300012212 | Avena Fatua Rhizosphere | YISQYTPEEAQEQFRLIEESSHHQARKDRHKRYVERRIVESSEVVETNI* |
Ga0150985_1097037321 | 3300012212 | Avena Fatua Rhizosphere | SQYTPEEAHEQLKLNEESSHHQARKDRVKRYIQARIVEVPELAEK* |
Ga0150985_1102108301 | 3300012212 | Avena Fatua Rhizosphere | MYKSQYTPEEAQEQFRLIEESSHHQARKDRHKRYVERRVVESSEAVETSI* |
Ga0150985_1130265921 | 3300012212 | Avena Fatua Rhizosphere | SQYTPEEAQEQFRLIEESSHHQARKDRHKRYVERRIVESSEAVETSI* |
Ga0150984_1005643561 | 3300012469 | Avena Fatua Rhizosphere | QYTPEEAHEQLKLNEESSHHQARKDRVKRYIQARIVEVPELAEK* |
Ga0150984_1070727131 | 3300012469 | Avena Fatua Rhizosphere | MYKSQYTPEEAQEQFRQIEESAHHQARKDRVKRYIQARIVENSEVAEQ* |
Ga0150984_1078680812 | 3300012469 | Avena Fatua Rhizosphere | PEEAQEQFRLIEESSHHQARKDRHKRYVERRIVESSEVVETNI* |
Ga0150984_1154556622 | 3300012469 | Avena Fatua Rhizosphere | MYKSQYTPDEAQEQFRLIEESTHHQARKDRVKRFIQRRIVESSEVAEQ* |
Ga0150984_1170936703 | 3300012469 | Avena Fatua Rhizosphere | MYKSQYTHEEAQEQFRLIDESSHHQAHKDRVKRYVRVRTVDSPDSLEQ* |
Ga0150984_1214891612 | 3300012469 | Avena Fatua Rhizosphere | MYKTQYTPQEAQEQFRLIDESSHPQPRKDRVKRYIQRRIVEQSELGEE* |
Ga0150984_1219357541 | 3300012469 | Avena Fatua Rhizosphere | QYTQDEAQEQFRLIDDSSHHQARKDRVKRYIQARTVETPEVEK* |
Ga0137404_118236742 | 3300012929 | Vadose Zone Soil | MYKSQYTPDEAQEQLKLNEESAHHQARKDRVKRYIQARIVEVPDGMEQ* |
Ga0164302_106376532 | 3300012961 | Soil | MYKSQYTPEEAQEQFRLIEESSHHQARKDRHKRYVERRIVERSEALETSI* |
Ga0126369_129837042 | 3300012971 | Tropical Forest Soil | MYKSQYTPEEAQEQIRLVEESCHHQARKDRVRRYIERRTVETTEGLDQ* |
Ga0157370_114559381 | 3300013104 | Corn Rhizosphere | MYKSEYTPNEAQEQFKLIDESLHHDAYKERAKRYIRNRTVEAQEVVDK* |
Ga0157374_119295742 | 3300013296 | Miscanthus Rhizosphere | MYKSQYTPQEAQEHFRQIEESSHHQARKDRMKRYIERRITETAETGND* |
Ga0157378_107495473 | 3300013297 | Miscanthus Rhizosphere | MYKTQYTPQEAQEQFRLIEESSHHQARKDRHKRYIERRIVENPEAGEN* |
Ga0157378_118313582 | 3300013297 | Miscanthus Rhizosphere | MYKSQYTPQEAQEQIQLIEESNHHQARKDRVKRYIERRIVEMPEVVDN* |
Ga0163162_123183231 | 3300013306 | Switchgrass Rhizosphere | EAQEQFQLIEESNHHQARKDRVKRYIERRIVEMPEVVDN* |
Ga0157372_102299103 | 3300013307 | Corn Rhizosphere | MYKMQYTPQEAQEHFQSIDESSHHQERKDRVKRYIERRIVINPEGGEN* |
Ga0157375_121385932 | 3300013308 | Miscanthus Rhizosphere | MYKSQYTPEEAQEQFRLIEDSSHHEARKDRVRRFIQRRIVEPTEVVND* |
Ga0181517_105313732 | 3300014160 | Bog | MYKTQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVENSEALES* |
Ga0181529_100378484 | 3300014161 | Bog | MYKTQYTPEEAQEQFQLIDESSHHQERKDRVKRYIQRRIVDTSEVVDS* |
Ga0181529_107426241 | 3300014161 | Bog | MYKTQYTPDEAQEQFKLIDESNRHDDYKTRAKRYVRNRIVETQEIAEQ* |
Ga0181532_105212261 | 3300014164 | Bog | MYKSQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVENSEVTEN* |
Ga0181534_107617622 | 3300014168 | Bog | MYKTQYTPEEAQEQFRLIEESSHHQDRKDRVKRYIQRRIVENSEVVES* |
Ga0181531_100475392 | 3300014169 | Bog | MLTWEGMYKSQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVENSEVLDN* |
Ga0163163_107627352 | 3300014325 | Switchgrass Rhizosphere | MYKTQYTPEEAQEQFRLIEDSSHHEARKDRVRRFIQRRIVEPTEVVND* |
Ga0163163_115634272 | 3300014325 | Switchgrass Rhizosphere | MYKSEYTPSEAQEQFKLIDESSNHDAYKERAKRYVRNRTVEAQEVVDK* |
Ga0182014_100792073 | 3300014491 | Bog | MYKSQYTPDEAQEQFKLIDESSNHQAYKERAKRYIRNRTVETQEVVEN* |
Ga0182013_104414221 | 3300014492 | Bog | MYKSQYTPEEAQEQFRLIEESSHHQERKDRVRRYIQRRIVETSEVVDK* |
Ga0182012_101542262 | 3300014499 | Bog | MYKSQYTPDEAQEQFKLIDESNRHDDYKSRAKRYVRNRIVESPEVPEQ* |
Ga0182024_129503682 | 3300014501 | Permafrost | MYKTRYTQEEAQEQLRLIDESSNHDAYKARATRYVRNRIVETQEVAEQ* |
Ga0182030_105537771 | 3300014838 | Bog | MYKSQYTPDEAQEQFRLIDESNRHDDYKNRAKRYVRNRIVESQEVPEQ* |
Ga0157376_125805082 | 3300014969 | Miscanthus Rhizosphere | GMYKTQYTPQEAQEQFRLIEESSHHQARKDRHKRYIERRIVENPEAGEN* |
Ga0137405_10071822 | 3300015053 | Vadose Zone Soil | MYKSHYTPDEAQEQLKLNEESAHHQARKDRVKRYIQARIVVPQDVVEN* |
Ga0132258_130933642 | 3300015371 | Arabidopsis Rhizosphere | MYKSQYTPEEAQEQFRLIEESSHHQARKDRHKRYVERRVVEISEAVETSI* |
Ga0182041_110473771 | 3300016294 | Soil | CYNCREMIKLKYTPAEAQECLRLNEESNHHQERKDRVRRYIERRIVHESEGVDK |
Ga0187785_107213761 | 3300017947 | Tropical Peatland | TPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVESSPEVGEN |
Ga0190266_100859462 | 3300017965 | Soil | MYKSEYTPAEAHEQLKLNEESTHHQERKDRVKRYILARIVESSEVVDN |
Ga0181520_101186363 | 3300017988 | Bog | MYKTQYTPEEAQEQFQLIDESSHHQERKDRVKRYIQRRIVDTSEVVDS |
Ga0181520_111499071 | 3300017988 | Bog | MYKTQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVENSEALES |
Ga0187887_101523673 | 3300018043 | Peatland | EEAQEQFRVIEESSHHQERKDRVKRYIQRRIVENSEVVES |
Ga0187851_104226682 | 3300018046 | Peatland | MYKSQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVENSEVTEN |
Ga0184625_105954201 | 3300018081 | Groundwater Sediment | MGMYKSEYTPQEAQQQFRLIEESSHHQARKDRVRRYIERRIVETTEVVNE |
Ga0066662_111253531 | 3300018468 | Grasslands Soil | MYKSQYTPDEAQEQFKLIDESSHHQARKDRVKRYIQARTMDSQEVVEK |
Ga0206355_13454501 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | MQYTPQEAQEHFQTIDESSHHQERKDRVKRYIERRIVSNPEGGEN |
Ga0206353_100093831 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MYKSQYTPEEAQEQFRQVEESAHHQARKDRMKRYIQARIVDTPEAIEN |
Ga0210407_102933452 | 3300020579 | Soil | MYKSQYLPDEAQEQLKLNDESAHHQARKDRVRRYIQARIAEPLDVVEK |
Ga0210399_113993522 | 3300020581 | Soil | MYKSQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVETTEVVES |
Ga0210401_101678201 | 3300020583 | Soil | MYKSQYTPHEAQEQFRLIDESGHHEARKERVKRYVQARIVETQEVTES |
Ga0210397_115066992 | 3300021403 | Soil | MYKTQYTPVEAHEQFKLIDESSNHDAYKERAKRYIRNRIVEIENNVEE |
Ga0126371_123530332 | 3300021560 | Tropical Forest Soil | MYKSQYTPQEAQEQFRLIDESSHHQERKDRVKRYIQRRIVDVPDVVEE |
Ga0213854_10662282 | 3300021855 | Watersheds | SQYTPDEAQELLKQNDESAHHQARKDRVRRYIQARIMEPQDTVEK |
Ga0224712_103298111 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | TPQEAQEHFQTIDESSHHQERKDRVKRYIERRIVSNPEGGEN |
Ga0212088_100371464 | 3300022555 | Freshwater Lake Hypolimnion | MYKSQYTPQEAQEHFKSIEESDHHRDRKDRVIRYIQRRIVEETETPQA |
Ga0207695_101210662 | 3300025913 | Corn Rhizosphere | MYKMQYTPQEAQEHFQTIDESSHHQERKDRVKRYIERRIVSNPEGGEN |
Ga0207663_107490403 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MYKTQYTPQEAQEQFRLIEESSHDQLRKDRHRRYIERRIVDNLEVADQ |
Ga0207701_110824802 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MLYLQGMYKSQYTPAEAQEQLKLNDESSHHQARKDRVRRYIEARIVEVPELVEN |
Ga0207690_105520283 | 3300025932 | Corn Rhizosphere | MYKTQYTQQEAQEQFRLIDESSHHQARKDRVKRYIQNRTVEGQEIVEE |
Ga0207691_116640112 | 3300025940 | Miscanthus Rhizosphere | MYKSQYTPDEAQEQFRLIEESTHHQARKDRVKRYIQRRIVESSEVAEQ |
Ga0207703_121689291 | 3300026035 | Switchgrass Rhizosphere | MYKSQYTPEEAQEQFQLIEESNHHQARKDRVKRYIERRIVEMPEVVDN |
Ga0207639_116041181 | 3300026041 | Corn Rhizosphere | YTPEEAQEQFRLIEESAHHQERKDRVKRYIQRRIVEFPETAEN |
Ga0207674_103919171 | 3300026116 | Corn Rhizosphere | FRLIEESSHHQARKDRHKRYVERRIVESSEAVETSI |
Ga0209062_10416332 | 3300027965 | Surface Soil | MYKSQYTPEEAQEQFRLVDESSHHQERKDRVKRYIQRRIVEVAEVVES |
Ga0268266_101648743 | 3300028379 | Switchgrass Rhizosphere | MYKSQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVETSETGNN |
Ga0268266_118845161 | 3300028379 | Switchgrass Rhizosphere | TPEEAQEQFRLIDESSHHDARKDRHRRYIERRIVESSEVPES |
Ga0265338_106868852 | 3300028800 | Rhizosphere | MYKTQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVETSEVVES |
Ga0302157_104183492 | 3300028813 | Bog | MLKYGYSMYKSQYTPDEAQEQFKLIDESSNHQAYKERAKRYIRNRTVETQEVVEN |
Ga0311361_106872042 | 3300029911 | Bog | MYKSQYTPDEAQEQFKLIDESNRHDDYKSRAKRYVRNRIVESPEVPEQ |
Ga0311362_112380142 | 3300029913 | Bog | MYKSQYTPEEAQEQFRLIEESSHHQERKDRVRRYIQRRIVETSEVVDK |
Ga0311363_113955971 | 3300029922 | Fen | MYKSQYTPEEAQEQFRLIEESSHHQERKDRVRRYIQRR |
Ga0311338_103057772 | 3300030007 | Palsa | MYKSHYTPEEAQEQFRLIDESSNHDAYKDRAKRYIRNRIVETQEVAKQ |
Ga0170834_1026285321 | 3300031057 | Forest Soil | MYKSHYTPDEAQEQFRLIDESSHHDGYKERAKRYVRNR |
Ga0308181_10508401 | 3300031099 | Soil | PAEAHEQLKLNDESSHHQARKDRVKRYIAARIVEVPEVVEK |
Ga0170824_1245768182 | 3300031231 | Forest Soil | MYKSHYTPDEAQEQFRLIDESSHHDGYKERAKRYVRNRIVEP |
Ga0302325_100388022 | 3300031234 | Palsa | MYKTQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRVVEILEVAEK |
Ga0302325_125574931 | 3300031234 | Palsa | MYKSQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVENSEVVES |
Ga0265332_100550852 | 3300031238 | Rhizosphere | MYKSQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVENSEVIES |
Ga0265316_106419923 | 3300031344 | Rhizosphere | PEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVENSEVIES |
Ga0302320_120075472 | 3300031524 | Bog | MYKSQYTPDEAQEQFRLIDESNRHDDYKNRAKRYVRNRIVESQEVPEQ |
Ga0310813_123394332 | 3300031716 | Soil | MYKTQYTPEEAREQIRMVEESSHHQARKDRVRRYIERR |
Ga0307474_102919521 | 3300031718 | Hardwood Forest Soil | MYKSQYTPAEAQEQFRLIDESAHHQARKDRVKRYIQARIVDPEDVVEN |
Ga0318520_107071811 | 3300031897 | Soil | MGMYKSQYTPEEAQEQIRLVEESCHHQARKDRVRRYIERRIVETTEGLDQ |
Ga0306923_102535832 | 3300031910 | Soil | MYKSQYTPEEAQEQIRLIEESSHHQERKDRVKRYIQRRVVETSGVVGS |
Ga0306923_120545892 | 3300031910 | Soil | MYKSQYTPEEAQEQIRLVEESSHHQDRKDRVKRYIQRRIVEIPE |
Ga0306923_122845961 | 3300031910 | Soil | MYKSQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVEQSEVGEN |
Ga0308175_1003577981 | 3300031938 | Soil | MGMYKSQYTPDEAQEQFRLIDESAHHQARKDRVKRYIQVRTVDTRENLEQ |
Ga0308175_1014232082 | 3300031938 | Soil | MYKTEYTPHEAQEQLKLIDEGPHHDAYKERAKRYIRNRTVEAQEVVDK |
Ga0308175_1018290402 | 3300031938 | Soil | MYKSQYTPEEAQEQFRLIDESSHHEARKDRHRRYVERRIVDSSEVSES |
Ga0308175_1020168772 | 3300031938 | Soil | MYKSQYTPEEAQEQFRRVEESAHHQARKDRMKRYIQARIVETSEAVEN |
Ga0308174_100222431 | 3300031939 | Soil | MYKMQYTPQEAQEHFQSIDESSHHQERKDRVKRYIERRIVVNPEGGEN |
Ga0310916_102551022 | 3300031942 | Soil | QIRLVEESSHHQERKDRVKRYIQRRVVETSGVVGS |
Ga0306926_120649961 | 3300031954 | Soil | MYKSQYTPEEAQEQIRLVEESCHHQARKDRVRRYIERRIVETIEGTDQ |
Ga0308176_102038622 | 3300031996 | Soil | MYKSQYTPQEAQEQFRLIDESSHHQARKDRVKRYIQNRTVDGQEIVEE |
Ga0308176_106824762 | 3300031996 | Soil | MYKSQYTPDEAQEQFRLIEESTHHQARKERVKRYIQRRIVESSEVAEQ |
Ga0308173_109948332 | 3300032074 | Soil | MGMYKSQYTPDEAQEQFRLIDESSHHQAHKDRVKRYVSVRTVDSQDTLEQ |
Ga0335085_100219114 | 3300032770 | Soil | MYKSQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVESSSEVGEN |
Ga0335085_119495192 | 3300032770 | Soil | TPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVDTLEVVEQ |
Ga0335069_107250682 | 3300032893 | Soil | MYKSQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVESSEVGEN |
Ga0335069_115713281 | 3300032893 | Soil | YKSQYTPEEAQEQFRLIEESSHHQERKDRVKRYIQRRIVESSSEVGEN |
Ga0364945_0164500_67_213 | 3300034115 | Sediment | MYKSQYTPQEAQEQFQLIDQSNHPQARKDRVKRYIERRIVEMPEVVDN |
Ga0314797_111016_1_135 | 3300034672 | Soil | KYTPAEAQEQLKLNDESSHHQARKDRVRRYIEARIVEVPELVEN |
⦗Top⦘ |