Basic Information | |
---|---|
Family ID | F040719 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 161 |
Average Sequence Length | 40 residues |
Representative Sequence | MTNKTKPIFNSFQEYIEAEDMIFKTLQGDMTVTIGSKDIE |
Number of Associated Samples | 131 |
Number of Associated Scaffolds | 161 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 17.39 % |
% of genes from short scaffolds (< 2000 bps) | 80.75 % |
Associated GOLD sequencing projects | 120 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (56.522 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (18.634 % of family members) |
Environment Ontology (ENVO) | Unclassified (65.839 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (79.503 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.06% β-sheet: 0.00% Coil/Unstructured: 52.94% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 161 Family Scaffolds |
---|---|---|
PF14743 | DNA_ligase_OB_2 | 20.50 |
PF08279 | HTH_11 | 6.21 |
PF04404 | ERF | 3.73 |
PF04542 | Sigma70_r2 | 3.73 |
PF12684 | DUF3799 | 1.86 |
PF13662 | Toprim_4 | 1.24 |
PF02796 | HTH_7 | 1.24 |
PF01068 | DNA_ligase_A_M | 0.62 |
PF03819 | MazG | 0.62 |
PF01510 | Amidase_2 | 0.62 |
COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
---|---|---|---|
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 3.73 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 3.73 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 3.73 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 3.73 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.62 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 56.52 % |
All Organisms | root | All Organisms | 43.48 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000101|DelMOSum2010_c10023060 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3581 | Open in IMG/M |
3300000101|DelMOSum2010_c10050989 | All Organisms → Viruses → Predicted Viral | 2067 | Open in IMG/M |
3300000101|DelMOSum2010_c10060066 | All Organisms → Viruses → Predicted Viral | 1834 | Open in IMG/M |
3300000101|DelMOSum2010_c10113953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1084 | Open in IMG/M |
3300000101|DelMOSum2010_c10218151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 625 | Open in IMG/M |
3300000116|DelMOSpr2010_c10021286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3160 | Open in IMG/M |
3300000116|DelMOSpr2010_c10041126 | Not Available | 2086 | Open in IMG/M |
3300000116|DelMOSpr2010_c10084689 | Not Available | 1243 | Open in IMG/M |
3300000116|DelMOSpr2010_c10111562 | Not Available | 1006 | Open in IMG/M |
3300000116|DelMOSpr2010_c10147259 | Not Available | 811 | Open in IMG/M |
3300000117|DelMOWin2010_c10011590 | All Organisms → cellular organisms → Bacteria | 4946 | Open in IMG/M |
3300000117|DelMOWin2010_c10035091 | All Organisms → Viruses → Predicted Viral | 2387 | Open in IMG/M |
3300001349|JGI20160J14292_10039545 | All Organisms → Viruses → Predicted Viral | 2278 | Open in IMG/M |
3300001472|JGI24004J15324_10068821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 992 | Open in IMG/M |
3300001936|GOS2220_1021881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1681 | Open in IMG/M |
3300001957|GOS2250_1034819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1301 | Open in IMG/M |
3300001961|GOS2240_1006203 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
3300002231|KVRMV2_100287454 | Not Available | 541 | Open in IMG/M |
3300002231|KVRMV2_100483776 | All Organisms → Viruses → Predicted Viral | 3362 | Open in IMG/M |
3300003542|FS900DNA_11008677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 635 | Open in IMG/M |
3300005239|Ga0073579_1011119 | All Organisms → Viruses → Predicted Viral | 1708 | Open in IMG/M |
3300005239|Ga0073579_1189566 | Not Available | 13001 | Open in IMG/M |
3300005589|Ga0070729_10667074 | Not Available | 560 | Open in IMG/M |
3300005606|Ga0066835_10184775 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 700 | Open in IMG/M |
3300005608|Ga0066840_10084630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 654 | Open in IMG/M |
3300005748|Ga0076925_1087590 | Not Available | 831 | Open in IMG/M |
3300005837|Ga0078893_10752697 | All Organisms → Viruses → Predicted Viral | 1549 | Open in IMG/M |
3300006191|Ga0075447_10127357 | Not Available | 866 | Open in IMG/M |
3300006467|Ga0099972_12578942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1360 | Open in IMG/M |
3300006467|Ga0099972_13644238 | Not Available | 632 | Open in IMG/M |
3300006484|Ga0070744_10002380 | Not Available | 5686 | Open in IMG/M |
3300006484|Ga0070744_10010842 | All Organisms → Viruses → Predicted Viral | 2706 | Open in IMG/M |
3300006484|Ga0070744_10242119 | Not Available | 511 | Open in IMG/M |
3300006735|Ga0098038_1073342 | Not Available | 1208 | Open in IMG/M |
3300006750|Ga0098058_1054571 | Not Available | 1121 | Open in IMG/M |
3300006752|Ga0098048_1126400 | Not Available | 767 | Open in IMG/M |
3300006752|Ga0098048_1137202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 731 | Open in IMG/M |
3300006789|Ga0098054_1056199 | Not Available | 1501 | Open in IMG/M |
3300006802|Ga0070749_10594401 | Not Available | 597 | Open in IMG/M |
3300006921|Ga0098060_1227980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 506 | Open in IMG/M |
3300007276|Ga0070747_1050480 | Not Available | 1595 | Open in IMG/M |
3300007538|Ga0099851_1105826 | Not Available | 1070 | Open in IMG/M |
3300007540|Ga0099847_1096689 | Not Available | 901 | Open in IMG/M |
3300007622|Ga0102863_1003321 | All Organisms → Viruses → Predicted Viral | 4281 | Open in IMG/M |
3300007958|Ga0105743_1007010 | Not Available | 945 | Open in IMG/M |
3300007963|Ga0110931_1039124 | Not Available | 1434 | Open in IMG/M |
3300007972|Ga0105745_1153878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 706 | Open in IMG/M |
3300007974|Ga0105747_1155416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 740 | Open in IMG/M |
3300007992|Ga0105748_10201867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 826 | Open in IMG/M |
3300008416|Ga0115362_100099079 | Not Available | 656 | Open in IMG/M |
3300008470|Ga0115371_10789310 | All Organisms → Viruses → Predicted Viral | 1424 | Open in IMG/M |
3300009002|Ga0102810_1037223 | All Organisms → cellular organisms → Bacteria | 1589 | Open in IMG/M |
3300009077|Ga0115552_1431894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 518 | Open in IMG/M |
3300009079|Ga0102814_10181890 | All Organisms → Viruses → Predicted Viral | 1147 | Open in IMG/M |
3300009136|Ga0118735_10126476 | Not Available | 807 | Open in IMG/M |
3300009426|Ga0115547_1265719 | Not Available | 535 | Open in IMG/M |
3300009428|Ga0114915_1091821 | Not Available | 913 | Open in IMG/M |
3300009436|Ga0115008_10578850 | Not Available | 807 | Open in IMG/M |
3300009495|Ga0115571_1065960 | Not Available | 1633 | Open in IMG/M |
3300009495|Ga0115571_1205249 | Not Available | 805 | Open in IMG/M |
3300009498|Ga0115568_10389500 | Not Available | 605 | Open in IMG/M |
3300009550|Ga0115013_10056637 | All Organisms → Viruses → Predicted Viral | 2164 | Open in IMG/M |
3300009593|Ga0115011_10287275 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
3300009593|Ga0115011_11139109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 669 | Open in IMG/M |
3300010149|Ga0098049_1051502 | Not Available | 1314 | Open in IMG/M |
3300010150|Ga0098056_1060654 | All Organisms → Viruses → Predicted Viral | 1303 | Open in IMG/M |
3300010153|Ga0098059_1107602 | Not Available | 1107 | Open in IMG/M |
3300010330|Ga0136651_10236881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 920 | Open in IMG/M |
3300010392|Ga0118731_108685982 | Not Available | 1263 | Open in IMG/M |
3300010392|Ga0118731_111756360 | Not Available | 1765 | Open in IMG/M |
3300011118|Ga0114922_11042932 | Not Available | 663 | Open in IMG/M |
3300011254|Ga0151675_1000671 | Not Available | 5026 | Open in IMG/M |
3300012953|Ga0163179_10178743 | All Organisms → Viruses → Predicted Viral | 1609 | Open in IMG/M |
3300013098|Ga0164320_10353473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 719 | Open in IMG/M |
3300013099|Ga0164315_10219889 | Not Available | 1549 | Open in IMG/M |
3300013101|Ga0164313_10430360 | Not Available | 1100 | Open in IMG/M |
3300013103|Ga0164318_11014680 | Not Available | 682 | Open in IMG/M |
3300014903|Ga0164321_10095040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1232 | Open in IMG/M |
3300017708|Ga0181369_1000980 | Not Available | 8121 | Open in IMG/M |
3300017708|Ga0181369_1074802 | Not Available | 728 | Open in IMG/M |
3300017709|Ga0181387_1046173 | Not Available | 864 | Open in IMG/M |
3300017713|Ga0181391_1037074 | All Organisms → Viruses → Predicted Viral | 1175 | Open in IMG/M |
3300017714|Ga0181412_1027282 | Not Available | 1555 | Open in IMG/M |
3300017719|Ga0181390_1020649 | All Organisms → Viruses → Predicted Viral | 2153 | Open in IMG/M |
3300017721|Ga0181373_1066326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 646 | Open in IMG/M |
3300017724|Ga0181388_1124961 | Not Available | 613 | Open in IMG/M |
3300017726|Ga0181381_1023475 | Not Available | 1401 | Open in IMG/M |
3300017734|Ga0187222_1130811 | Not Available | 561 | Open in IMG/M |
3300017741|Ga0181421_1041693 | Not Available | 1230 | Open in IMG/M |
3300017741|Ga0181421_1086011 | Not Available | 822 | Open in IMG/M |
3300017746|Ga0181389_1083927 | Not Available | 891 | Open in IMG/M |
3300017748|Ga0181393_1053764 | Not Available | 1095 | Open in IMG/M |
3300017756|Ga0181382_1049519 | Not Available | 1215 | Open in IMG/M |
3300017756|Ga0181382_1060737 | Not Available | 1073 | Open in IMG/M |
3300017762|Ga0181422_1065764 | Not Available | 1152 | Open in IMG/M |
3300017765|Ga0181413_1132980 | Not Available | 752 | Open in IMG/M |
3300017772|Ga0181430_1046089 | Not Available | 1361 | Open in IMG/M |
3300017772|Ga0181430_1057757 | Not Available | 1196 | Open in IMG/M |
3300017773|Ga0181386_1157085 | Not Available | 694 | Open in IMG/M |
3300017776|Ga0181394_1157681 | Not Available | 703 | Open in IMG/M |
3300017781|Ga0181423_1085464 | All Organisms → Viruses → Predicted Viral | 1243 | Open in IMG/M |
3300017782|Ga0181380_1285002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 543 | Open in IMG/M |
3300017783|Ga0181379_1146610 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium → unclassified Chryseobacterium → Chryseobacterium sp. | 844 | Open in IMG/M |
3300017786|Ga0181424_10108094 | Not Available | 1201 | Open in IMG/M |
3300019704|Ga0193979_1005467 | Not Available | 1164 | Open in IMG/M |
3300019707|Ga0193989_1038642 | Not Available | 573 | Open in IMG/M |
3300019741|Ga0194020_1060602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 539 | Open in IMG/M |
3300020185|Ga0206131_10189515 | All Organisms → Viruses → Predicted Viral | 1024 | Open in IMG/M |
3300020187|Ga0206130_10158005 | Not Available | 1169 | Open in IMG/M |
3300020264|Ga0211526_1003084 | Not Available | 2864 | Open in IMG/M |
3300020421|Ga0211653_10518809 | Not Available | 506 | Open in IMG/M |
3300020428|Ga0211521_10050637 | All Organisms → Viruses → Predicted Viral | 2148 | Open in IMG/M |
3300020428|Ga0211521_10506580 | Not Available | 517 | Open in IMG/M |
3300020438|Ga0211576_10256139 | Not Available | 918 | Open in IMG/M |
3300020438|Ga0211576_10450745 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium → unclassified Chryseobacterium → Chryseobacterium sp. | 654 | Open in IMG/M |
3300020469|Ga0211577_10451397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 787 | Open in IMG/M |
3300021087|Ga0206683_10595372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 535 | Open in IMG/M |
3300021185|Ga0206682_10026872 | Not Available | 3499 | Open in IMG/M |
3300021335|Ga0213867_1014968 | Not Available | 3225 | Open in IMG/M |
3300021335|Ga0213867_1113065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 961 | Open in IMG/M |
3300021364|Ga0213859_10228126 | Not Available | 857 | Open in IMG/M |
3300021471|Ga0190359_1089344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1129 | Open in IMG/M |
3300022053|Ga0212030_1063201 | Not Available | 527 | Open in IMG/M |
3300022057|Ga0212025_1070057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 605 | Open in IMG/M |
3300022061|Ga0212023_1037309 | Not Available | 676 | Open in IMG/M |
3300022068|Ga0212021_1069949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 719 | Open in IMG/M |
3300022169|Ga0196903_1001448 | All Organisms → Viruses → Predicted Viral | 3346 | Open in IMG/M |
(restricted) 3300023109|Ga0233432_10037881 | All Organisms → Viruses | 3196 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10092316 | Not Available | 1265 | Open in IMG/M |
3300024188|Ga0228602_1007468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1256 | Open in IMG/M |
(restricted) 3300024264|Ga0233444_10048776 | All Organisms → Viruses → Predicted Viral | 2555 | Open in IMG/M |
(restricted) 3300024264|Ga0233444_10224433 | Not Available | 851 | Open in IMG/M |
3300024346|Ga0244775_10000272 | Not Available | 66408 | Open in IMG/M |
(restricted) 3300024519|Ga0255046_10375345 | Not Available | 672 | Open in IMG/M |
3300025026|Ga0207879_104135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 661 | Open in IMG/M |
3300025070|Ga0208667_1011024 | All Organisms → Viruses → Predicted Viral | 2052 | Open in IMG/M |
3300025070|Ga0208667_1055683 | Not Available | 629 | Open in IMG/M |
3300025099|Ga0208669_1095549 | Not Available | 624 | Open in IMG/M |
3300025103|Ga0208013_1080723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 841 | Open in IMG/M |
3300025127|Ga0209348_1011359 | All Organisms → Viruses → Predicted Viral | 3547 | Open in IMG/M |
3300025132|Ga0209232_1067323 | Not Available | 1267 | Open in IMG/M |
3300025151|Ga0209645_1025184 | All Organisms → Viruses | 2231 | Open in IMG/M |
3300025151|Ga0209645_1031857 | All Organisms → Viruses | 1937 | Open in IMG/M |
3300025626|Ga0209716_1005022 | Not Available | 7345 | Open in IMG/M |
3300025626|Ga0209716_1007021 | Not Available | 5751 | Open in IMG/M |
3300025699|Ga0209715_1047563 | All Organisms → Viruses → Predicted Viral | 1862 | Open in IMG/M |
3300025816|Ga0209193_1071493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 912 | Open in IMG/M |
3300025849|Ga0209603_1010550 | Not Available | 6604 | Open in IMG/M |
3300026434|Ga0247591_1104575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 521 | Open in IMG/M |
3300026504|Ga0247587_1045337 | Not Available | 1071 | Open in IMG/M |
3300027214|Ga0208306_1040321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 832 | Open in IMG/M |
3300027828|Ga0209692_10458906 | Not Available | 536 | Open in IMG/M |
3300027833|Ga0209092_10529636 | Not Available | 598 | Open in IMG/M |
3300027906|Ga0209404_10419031 | Not Available | 875 | Open in IMG/M |
3300028022|Ga0256382_1123983 | Not Available | 620 | Open in IMG/M |
3300031766|Ga0315322_10003384 | Not Available | 12309 | Open in IMG/M |
3300031766|Ga0315322_10751456 | Not Available | 608 | Open in IMG/M |
3300031851|Ga0315320_10615440 | Not Available | 711 | Open in IMG/M |
3300032088|Ga0315321_10502746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 734 | Open in IMG/M |
3300032212|Ga0316207_10362519 | Not Available | 526 | Open in IMG/M |
3300032277|Ga0316202_10251203 | Not Available | 822 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 18.63% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 14.91% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 7.45% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 6.21% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.59% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.59% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.73% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.73% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 3.11% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.48% |
Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 2.48% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.48% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.48% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.48% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.86% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.86% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.86% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.24% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.24% |
Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.24% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.24% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.62% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.62% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.62% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.62% |
Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.62% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.62% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.62% |
Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.62% |
Hydrothermal Vent Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat | 0.62% |
Marine Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent | 0.62% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.62% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.62% |
Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
3300001936 | Marine microbial communities from Halifax, Nova Scotia, Canada - GS004 | Environmental | Open in IMG/M |
3300001957 | Marine microbial communities from Wolf Island, Equador - GS035 | Environmental | Open in IMG/M |
3300001961 | Marine microbial communities from Dirty Rock, Cocos Island, Costa Rica - GS025 | Environmental | Open in IMG/M |
3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
3300003542 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS900_Dependable_DNA | Environmental | Open in IMG/M |
3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
3300005608 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A | Environmental | Open in IMG/M |
3300005748 | Seawater microbial communities from Vineyard Sound, MA, USA - control T7 | Environmental | Open in IMG/M |
3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007958 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459BC_3.0um | Environmental | Open in IMG/M |
3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300008416 | Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC12B | Environmental | Open in IMG/M |
3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
3300009002 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 | Environmental | Open in IMG/M |
3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
3300009136 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsf | Environmental | Open in IMG/M |
3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
3300010330 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG | Environmental | Open in IMG/M |
3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
3300013099 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cm | Environmental | Open in IMG/M |
3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
3300013103 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay9, Core 4571-4, 0-3 cm | Environmental | Open in IMG/M |
3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
3300019704 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_0-1_MG | Environmental | Open in IMG/M |
3300019707 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_0-1_MG | Environmental | Open in IMG/M |
3300019741 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_6-7_MG | Environmental | Open in IMG/M |
3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
3300020264 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556116-ERR599158) | Environmental | Open in IMG/M |
3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
3300021087 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 | Environmental | Open in IMG/M |
3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
3300021471 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-18-2-3_MG | Environmental | Open in IMG/M |
3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
3300024188 | Seawater microbial communities from Monterey Bay, California, United States - 2D | Environmental | Open in IMG/M |
3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
3300025026 | Marine viral communities from the Pacific Ocean - LP-24 (SPAdes) | Environmental | Open in IMG/M |
3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
3300025699 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes) | Environmental | Open in IMG/M |
3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
3300026434 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 53R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026504 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027214 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
3300032212 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-week pyrite | Environmental | Open in IMG/M |
3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSum2010_100230608 | 3300000101 | Marine | TQKLKPIFDSFQEYIEAEDMIFETLQDRVTNGNKDIK* |
DelMOSum2010_100509893 | 3300000101 | Marine | MTQKLKPIFDSFQEYIEAEDMIFETLQDRVTNGTKDIK* |
DelMOSum2010_100600662 | 3300000101 | Marine | MTQKLKPIFDSFQEYIEAEDMIFETLQDRVTNGNKDIK* |
DelMOSum2010_101139535 | 3300000101 | Marine | MNNKPKPIFNSFQEYIEAENMIFKTLQGDMETVTIGSNDIE* |
DelMOSum2010_102181511 | 3300000101 | Marine | MNTSSKIFDSFQEYIEAENMIFKTLQGDMTVTIGSKDIE* |
DelMOSpr2010_100212861 | 3300000116 | Marine | YMTQKLKPIFDSFQEYIEAEDMIFETLQDRVTNGNKDIK* |
DelMOSpr2010_100411266 | 3300000116 | Marine | MTNKTKPIFNSFQEYIEAENMVFKTLQGNMETVTIGSKDIE* |
DelMOSpr2010_100846895 | 3300000116 | Marine | MTKKLEPIFNSFQEYIEAEDMIFETLQDRVTNGTKDIK* |
DelMOSpr2010_101115625 | 3300000116 | Marine | MNNKPKPIFNSFQEYIEAENMIFKTLQGDMETVTIGSN |
DelMOSpr2010_101472592 | 3300000116 | Marine | MTNKTKPIFDSFQEYIEAEDMIFKTLQGDMTVTIGSKDIE* |
DelMOWin2010_100115902 | 3300000117 | Marine | MTNKTKPIFDSFQEYIEAEDMIFKTLQSDMETVTIGYKDIE* |
DelMOWin2010_100350913 | 3300000117 | Marine | MTNKIKPIFDSFQEYIEAEDMVFKTLQSNMTVTIGSKDIE* |
JGI20160J14292_100395454 | 3300001349 | Pelagic Marine | MTQKLKPIFDSFQEYIEAEDMIFETLQDRVTIASKDKE* |
JGI24004J15324_100688212 | 3300001472 | Marine | MTNKTKPIFNSFQEYIEAEDMIFKTLQGDMETVTIGYKDIE* |
GOS2220_10218812 | 3300001936 | Marine | MTNKTKPIFDSFKEYIEAEDMVFKTLESDMETVTLES* |
GOS2250_10348191 | 3300001957 | Marine | MTNKIKPIFNSFQEYIEAEDMVFKTLQGNMETVTIGSKDIE* |
GOS2240_10062036 | 3300001961 | Marine | MNTLNKIFNSFQEYIESEDMIFKTLEDQIKSRTLGSNDIE* |
KVRMV2_1002874541 | 3300002231 | Marine Sediment | MTNKIKPIFDSFQEYIEAEDMVFKTLQSNMTVTIG |
KVRMV2_1004837763 | 3300002231 | Marine Sediment | MNTSSKIFNSFQEYMEAEDMIFKTLQGDMTVTIGSKDIE* |
FS900DNA_110086772 | 3300003542 | Diffuse Hydrothermal Flow Volcanic Vent | MTNKTKPIFDSFQEYMEAEDMIFKTLQGDMTVTIGSKDIE* |
Ga0073579_10111192 | 3300005239 | Marine | MNNKPKPIFNSFQEYIEAENMIFKTLQGDMETVTIGSKDIE* |
Ga0073579_118956618 | 3300005239 | Marine | MNTSSKIFDSFQEYIEAEDMIFKTLQGDMTVTIGSKDIE* |
Ga0070729_106670743 | 3300005589 | Marine Sediment | MKQKLKPIFDSFQEYIEAEDMIFETLQDRVTNGTKDIK* |
Ga0066835_101847754 | 3300005606 | Marine | MTNKIKPIFNSFQEYIEAEDMVFKTLQGNMETVTIGS |
Ga0066840_100846301 | 3300005608 | Marine | MTNKIKPIFNSFQEYIEAEDMVFKTLQGNMETVTIGTKDIE* |
Ga0076925_10875904 | 3300005748 | Marine | MTNKTKPIFDSFQEYIEAEDMIFKTLQGDMTVTIGS |
Ga0078893_107526971 | 3300005837 | Marine Surface Water | MTNKIKPIFNSFQEYIEAEDMVFKTLQGSIETVTIGSK |
Ga0075447_101273572 | 3300006191 | Marine | MKELENIKELFNSFQEYIEAENMVFKTLKDDIESGTIGS* |
Ga0099972_125789423 | 3300006467 | Marine | LKPIFDSFQEYIEAEDMIFETLQDRVTNGNKDIK* |
Ga0099972_136442381 | 3300006467 | Marine | MNISNKIFDSFQEYIEAENMVFKTLDVEIKSMTLGS |
Ga0070744_100023805 | 3300006484 | Estuarine | MTDKLKPIYDSFQEYIEAENMIFITLHESVTIASKDK* |
Ga0070744_100108425 | 3300006484 | Estuarine | MTKKIKPIFNSFQEYIEAEDMIFKTLQGNMETVTIGYKDIE* |
Ga0070744_102421192 | 3300006484 | Estuarine | MNTSSKIFDSFQEYIEAEDMIFKTLQGDMTVTIGYKDIE* |
Ga0098038_10733424 | 3300006735 | Marine | MKTKTNNIFDSFQEYIEAENMIFKTLDADIKSMTLESKDIE* |
Ga0098058_10545712 | 3300006750 | Marine | MTNKTKPIFNSFQEYIEAEDMIFKTLQSDMETVTIGYKDIE* |
Ga0098048_11264003 | 3300006752 | Marine | MTKKTQPIFNSFQEYIEAENMIFKTLQGSMETVTI |
Ga0098048_11372024 | 3300006752 | Marine | MTNKIKPIFNSFQEYIEAEDMIFKTLQGDMETVTIGYKDIE* |
Ga0098054_10561994 | 3300006789 | Marine | MTKKTQPIFNSFQEYIEAENMIFKTLQDSMETVTIGSKDIE* |
Ga0070749_105944013 | 3300006802 | Aqueous | MTNKIKPIFNSFQEYIEAEDMVFKTLEGSIETVTIGSKDIE* |
Ga0098060_12279802 | 3300006921 | Marine | MKTKTNNIFDSFQEYIEAENMIFKTLDADIKSMTLESNDIE* |
Ga0070747_10504805 | 3300007276 | Aqueous | MNTSSKIFNSFQEYIEAENMVFKTLDVEIKSMTLGSKDIE* |
Ga0099851_11058263 | 3300007538 | Aqueous | MTNKIKPIFNSFQEYIEAEDMVFKTLQGSIETVTIGSKDIE* |
Ga0099847_10966894 | 3300007540 | Aqueous | MTNKTKPIFNSFQEYIEAEDMIFKTLQGNMETVTIGYKDIE* |
Ga0102863_10033219 | 3300007622 | Estuarine | MTNKTKPIFNSFQEYMEAENMIFKTLQGDMTVTIGSKDIE* |
Ga0105743_10070104 | 3300007958 | Estuary Water | MTNKTKPIFNSFQEYIEAENMIFKTLQGDMTVTIGSKDIE* |
Ga0110931_10391244 | 3300007963 | Marine | MNACDKIFNSFQEYIEAENMVFETLDVKIKSMTLGSKDIE* |
Ga0105745_11538782 | 3300007972 | Estuary Water | MTEKIKPIFNSFQEYMEAENMIFKILQGDMTVTIGSKDIE* |
Ga0105747_11554163 | 3300007974 | Estuary Water | MINKTKPIFNSFQEYMEAEDMIFKTLQGDMTVTIGSKDIE* |
Ga0105748_102018672 | 3300007992 | Estuary Water | MNTSSKIFDSFQEYIEAEDMIFKTLQGNMTVTIGSKDIE* |
Ga0115362_1000990791 | 3300008416 | Sediment | MNXXNKIFXSFXEYIEAENMVFKTLDVEIKSMTLGSKDIE |
Ga0115371_107893104 | 3300008470 | Sediment | MKELENIKELFNSFQEYIEAENMVFRTLKDDIESGTIGS* |
Ga0102810_10372232 | 3300009002 | Estuarine | MTNKTKPIFNSFQEYMEAEDMIFKTLQGDMTVTIGSKDIE* |
Ga0115552_14318941 | 3300009077 | Pelagic Marine | MTNKIKPIFDSFQEYIEAEDMVFKTLQGNMTVTIGSKDIE* |
Ga0102814_101818905 | 3300009079 | Estuarine | MTNKMKPIFNSFQEYMEAEDMIFKTLQGDMTVTIGSKDIE* |
Ga0118735_101264763 | 3300009136 | Marine Sediment | MTKKIKPIFNSFQEYIEAEDMIFKTLQGDMETVTIGYKGIE* |
Ga0115547_12657192 | 3300009426 | Pelagic Marine | MTDKIKPIFDSFQEYIEAEDMIFETLQDRVTNGTKDIK* |
Ga0114915_10918212 | 3300009428 | Deep Ocean | MKELENIKELFNSFQEYIEAENMVVKTLKDDIESGTIGS* |
Ga0115008_105788501 | 3300009436 | Marine | MTNKTKPIFDSFQEYMEAEDMIFKTLQGDMTVTIG |
Ga0115571_10659602 | 3300009495 | Pelagic Marine | MTDKLKPIFNSFQEYIESEDMIFTTLHENMTIASKDKE* |
Ga0115571_12052492 | 3300009495 | Pelagic Marine | MTKKLKPIFDSFQEYIEAEDMIFTTLQNEMESGTIGS* |
Ga0115568_103895004 | 3300009498 | Pelagic Marine | MTTKLKPIFDSFQEYIEAEDMIFKTLQDSVTHGSKDIE* |
Ga0115013_100566372 | 3300009550 | Marine | MKTKTSNIFDSFQEYIEAENMIFKTLDVEIKSMTLGSKDIE* |
Ga0115011_102872753 | 3300009593 | Marine | MKTKTNNIFDSFQEYIEAENMIFKTLDVEIKSMTLGSKDIE* |
Ga0115011_111391091 | 3300009593 | Marine | MTDKIKPIFDSFQEYIEAEDMIFETLQNRVTHGTKDIE* |
Ga0098049_10515023 | 3300010149 | Marine | MTKKTQPIFNSFQEYIEAENMIFKTLQGSMETVTIGSKDIE* |
Ga0098056_10606544 | 3300010150 | Marine | MTNKIKPIFNSFQEYIEAEDMIFKTLEGNMETVTIGYKDIE* |
Ga0098059_11076022 | 3300010153 | Marine | MKTKTNNIFDSFQEYIEAENMIFKTLDADIKSMTLGSKDIE* |
Ga0136651_102368812 | 3300010330 | Marine Hydrothermal Vent | MTKKTQPIFNSFQEYIEAENMIFKTLQGNMETVTIGSKDIE* |
Ga0118731_1086859822 | 3300010392 | Marine | MTKKLKPIFNSFQEYIEAEDMIFKTLQGNMETVTIGSKGIE* |
Ga0118731_1117563602 | 3300010392 | Marine | MTKKIKPIFDSFQEYIEAENMIFTTLQDDIESGTIGS* |
Ga0114922_110429324 | 3300011118 | Deep Subsurface | MNNKPKPIFNSFQEYMEAEDMIFKTLQGDMETVTIGSKGIE* |
Ga0151675_100067111 | 3300011254 | Marine | MTEKIKPIFDSFQEYMEAEDMIFKTLQGDMTVTIGSKDIE* |
Ga0163179_101787434 | 3300012953 | Seawater | MNTSSKIFNSFQEYIEAEDMIFKTLQGDMTVTIGSKDIE* |
Ga0164320_103534733 | 3300013098 | Marine Sediment | MTNKTKPIFNSFQEYIKAEDMIFKTLQGDMETVTIGYKDIE* |
Ga0164315_102198894 | 3300013099 | Marine Sediment | MTKKIKPIFNSFQEYIEAEDMIFKTLQGDMKTVTIGYKDIE* |
Ga0164313_104303606 | 3300013101 | Marine Sediment | MTKKTQPIFNSFQEYIEAEDMIFKTLQGDMKTVTIGYKDIE* |
Ga0164318_110146801 | 3300013103 | Marine Sediment | MTNKTKPIFNSFQEYIEAEDMIFKTLQGDMKTVTIGYKDIE |
Ga0164321_100950402 | 3300014903 | Marine Sediment | MTKKIEPIFNSFKEYIEAEEMIFKTLQGDIETVTLGS* |
Ga0181369_100098017 | 3300017708 | Marine | MTNKVKPIFNSFKEYIEAENMIFKTLSSRASVTIGSKNNKVKG |
Ga0181369_10748021 | 3300017708 | Marine | FKTFMTNKTKPIFDSFQEYIEAEDMVFKTLQGDMETVTIGAKDIE |
Ga0181387_10461734 | 3300017709 | Seawater | MNTSSKIFDSFQEYIEAEDMIFETLDVKIKSMTLGSKDIE |
Ga0181391_10370745 | 3300017713 | Seawater | MTAKIQPIFNSFQEYIEAEDMIFTTLQSDIESGTIGS |
Ga0181412_10272822 | 3300017714 | Seawater | MTAKIQPIFNSFQEYIEAEDMIFKTLQDSVTHGSKDIE |
Ga0181390_10206494 | 3300017719 | Seawater | MTKKIKPIFNSFQEYIEAEDMIFKTLQGDMKTVTVGYKDIE |
Ga0181373_10663262 | 3300017721 | Marine | MTNKIKPIFNSFQEYIEAENMIFTTLQDDIESGTIGS |
Ga0181388_11249611 | 3300017724 | Seawater | FNSFKEYIEAENMIFKTLSGNVSVTIGSKNNKVKG |
Ga0181381_10234752 | 3300017726 | Seawater | MTNKVKPIFNSFKEYIEAENMIFKTLSGNVSVTIGSKNNKVKG |
Ga0187222_11308112 | 3300017734 | Seawater | MTKKIKPIYNSFQEYIEAEDMIFKTLQGDMTVTIGSKDIE |
Ga0181421_10416931 | 3300017741 | Seawater | MTKKTQPIFNSFQEYIEAENMIFKTLQGNMETVTIGSKDIESL |
Ga0181421_10860111 | 3300017741 | Seawater | LMTKKIKPIFNSFQEYIEAEDMIFKTLQGNMETVTIGYKDIE |
Ga0181389_10839274 | 3300017746 | Seawater | MTKKLKPIFDSFQEYIEAEDMIFTTLQNDMESGTIGYKDIE |
Ga0181393_10537644 | 3300017748 | Seawater | MNTSSKIFNSFQEYIESEDMIFKTLQGDMTVTIGSKDIE |
Ga0181382_10495196 | 3300017756 | Seawater | MTKKIEPIFNSFQEYIEAEEMIFKTLQGDMETVTLGS |
Ga0181382_10607371 | 3300017756 | Seawater | IKPIFDSFQEYMEAEDMIFKTLQGDMTVTIGSQDIE |
Ga0181422_10657641 | 3300017762 | Seawater | MTKKTQPIFNSFQEYIEAENMIFKTLQGSMETVTIGYKVIE |
Ga0181413_11329801 | 3300017765 | Seawater | MTEKIKPIFDSFQEYMEAEDMIFKTSQGDQTVTIRSKDIE |
Ga0181430_10460896 | 3300017772 | Seawater | MTKKTQPIFNSFQEYIEAENMIFKTLQGNMETVTIGS |
Ga0181430_10577573 | 3300017772 | Seawater | KKPMTKKTQPIFNSFQEYIEAENMIFKTLQGNMETVTIGSKDIE |
Ga0181386_11570852 | 3300017773 | Seawater | MKTKTNNIFDSFQEYIEAENMVFETLDVKIKSMTLGSKDIE |
Ga0181394_11576811 | 3300017776 | Seawater | AKIQPIFNSFQEYIEAEDMIFTTLQSDIESGTIGS |
Ga0181423_10854641 | 3300017781 | Seawater | MTNKIKPIFDSFQEYIEAEDMIFKTLQGDMETVTIGSNDIE |
Ga0181380_12850022 | 3300017782 | Seawater | MTNKTKPIFNSFQEYIEAEDMIFKTLQGDMETVTIGYKDIE |
Ga0181379_11466105 | 3300017783 | Seawater | MINKTKPIFNSFQEYMEAEDMIFKTLQGDMTVTIGSKDIE |
Ga0181424_101080943 | 3300017786 | Seawater | MTKKTQPIFNSFQEYIEAENMIFKTLQGNMETATIGSKDIE |
Ga0193979_10054672 | 3300019704 | Sediment | MTNKTKPIFNSFQEYIEAENMVFKTLDVEIKSMTLGSKDIE |
Ga0193989_10386421 | 3300019707 | Sediment | MTNKTKPIFNSFQEYIEAENMVFKTLQGNMETVTIGSKDIE |
Ga0194020_10606022 | 3300019741 | Sediment | MTQKLKPIFDSFQEYIEAEDMIFKTLQGDMTVTIGSKDIE |
Ga0206131_101895151 | 3300020185 | Seawater | MNTSSKIFDSFQEYIEAEDMIFKTLQGDMTVTIGSKDIE |
Ga0206130_101580052 | 3300020187 | Seawater | MTNKTKPIFDSFQEYIEAEDMIFKTLQGNMTVTIGSKDIE |
Ga0211526_10030842 | 3300020264 | Marine | MTNKIKPIFNSFQEYIEAEDMVFKTLQGNIETVTIGSKDIE |
Ga0211653_105188091 | 3300020421 | Marine | ACDKIFNSFQEYIEAENMVFETLDVKIKSMTLGSKDIE |
Ga0211521_100506374 | 3300020428 | Marine | MNTSSKIFNSFQEYIEAENMIFKTLQGDMNVTIGSEDIE |
Ga0211521_105065802 | 3300020428 | Marine | MNTSSKIFDSFQEYIEAEDMIFKTLQDSVTNGTKDIE |
Ga0211576_102561395 | 3300020438 | Marine | MTKKLEPIFNSFQEYIEAENMIFETLEPRVTHGSKDIE |
Ga0211576_104507451 | 3300020438 | Marine | MTNKTKPIFNSFQEYIEAEDMIFKTLQGNMETVTIGYKDIE |
Ga0211577_104513972 | 3300020469 | Marine | MTEKIKPIFDSFQEYMEAEDMIFKTLQGDMTVTIGSKDIE |
Ga0206683_105953722 | 3300021087 | Seawater | MTNKMKPIFNSFQEYMEAEDMIFKTLQGDMTVTIGSKDIE |
Ga0206682_100268727 | 3300021185 | Seawater | MTKKTQPIFNSFQEYIEAENMIFKTLQGSMETVTIGSKDIE |
Ga0213867_10149685 | 3300021335 | Seawater | MTQKLKPIFDSFQEYIEAEDMIFETLQDRVTNGTKDIK |
Ga0213867_11130652 | 3300021335 | Seawater | MTNKTKPIFDSFQEYIEAEDMIFKTLQSDMETVTIGYKDIE |
Ga0213859_102281262 | 3300021364 | Seawater | KKTIIKIQRTFKKLMTNKIKPIFNSFQEYIEAEDMVFKTLQGSIETVTIGSKDIE |
Ga0190359_10893442 | 3300021471 | Hydrothermal Vent Microbial Mat | MTKKTQPIFNSFQEYIEAENMIFKTLQGNMETVTIGSKDIE |
Ga0212030_10632012 | 3300022053 | Aqueous | MTNKTKPIFNSFQEYIQAEDMIFKTLQGNMETVTIGYKDIE |
Ga0212025_10700572 | 3300022057 | Aqueous | KTKPIFNSFQEYIEAENMVFKTLQGNMETVTIGSKDIE |
Ga0212023_10373093 | 3300022061 | Aqueous | MTQKLKPIFDSFQEYIEAEDMIFETLQDRVTNGNKDIK |
Ga0212021_10699492 | 3300022068 | Aqueous | MTNKIKPIFNSFQEYIEAEDMVFKTLEGSIETVTIGSKDIE |
Ga0196903_10014486 | 3300022169 | Aqueous | MNNKPKPIFNSFQEYIEAENMIFKTLQGDMETVTIGSKDIE |
(restricted) Ga0233432_100378814 | 3300023109 | Seawater | MTNKIKPIFNSFQEYIEAEDMIFKTLQGGIKTVTIGSKDIE |
(restricted) Ga0233412_100923164 | 3300023210 | Seawater | MTTKLKPIFNSFQEYIEAENMIFETLEPRVTHGSKDIE |
Ga0228602_10074682 | 3300024188 | Seawater | MTNKIQPIFNSFQEYIEAEDMIFKTLQDSVTHGSKDIE |
(restricted) Ga0233444_100487763 | 3300024264 | Seawater | MTKKIKPIFNSFQEYIEAEDMIFKTLQGNMETVTIGYKDIE |
(restricted) Ga0233444_102244334 | 3300024264 | Seawater | MTNKTKPIFNSFQEYIEAEDMIFKTLQGNMKTVTIGYKDIE |
Ga0244775_100002724 | 3300024346 | Estuarine | MTDKLKPIYDSFQEYIEAENMIFITLHESVTIASKDK |
(restricted) Ga0255046_103753451 | 3300024519 | Seawater | MTKKIKPIFNSFQEYIEAEDMIFKTLQGNIETVTIGYKDIE |
Ga0207879_1041352 | 3300025026 | Marine | MTNKTKPIFNSFQEYMEAEDMIFKTLQGDMTVTIGSKDIE |
Ga0208667_10110244 | 3300025070 | Marine | MTNKIKPIFNSFQEYIEAEDMIFKTLQGDMETVTIGYKDIE |
Ga0208667_10556832 | 3300025070 | Marine | MTNKTKPIFNSFQEYIEAEDMIFKTLQSDMETVTIGYKDIE |
Ga0208669_10955491 | 3300025099 | Marine | MKTKTNNIFDSFQEYIEAENMIFKTLDADIKSMTLGSKDIE |
Ga0208013_10807232 | 3300025103 | Marine | MTNKIKPIFNSFQEYIEAEDMIFKTLEGNMETVTIGYKDIE |
Ga0209348_10113593 | 3300025127 | Marine | MTNKIKPIFNSFQEYIEAEDMVFKTLQGNMETVTIGTKDIE |
Ga0209232_10673234 | 3300025132 | Marine | MKTKTNNIFDSFQEYIEAEDMIFKTLDADIKSMTLGSKDIE |
Ga0209645_10251844 | 3300025151 | Marine | MTNKIKPIFNSFQEYIEAENMVFKTLQGNMETVTIGSKDIE |
Ga0209645_10318573 | 3300025151 | Marine | MKTKTNNIFDSFQEYIEAENMIFKTLDAKIKSMTLGSKDIE |
Ga0209716_100502210 | 3300025626 | Pelagic Marine | MTQKLKPIFDSFQEYIEAEDMIFETLQDRVTIASKDKE |
Ga0209716_10070217 | 3300025626 | Pelagic Marine | MTNKTKPIFDSFQEYMEAEDMIFKTLQGDMTVTIGSKDIE |
Ga0209715_10475633 | 3300025699 | Pelagic Marine | MNNKPKPIFNSFQEYMEAEDMIFKTLQGDMETVTIGSKGIE |
Ga0209193_10714932 | 3300025816 | Pelagic Marine | MTNKIKPIFDSFQEYIEAEDMVFKTLQSNMTVTIGSKDIE |
Ga0209603_10105506 | 3300025849 | Pelagic Marine | MTKKLKPIFDSFQEYIEAEDMIFTTLQNEMESGTIGS |
Ga0247591_11045751 | 3300026434 | Seawater | PIFNSFQEYIEAENMIFKTLQGSMETVTIGSKDIE |
Ga0247587_10453372 | 3300026504 | Seawater | MTKKIKPIFNSFQEYIEAEDMIFKTLQGDMETVTIGYKDIE |
Ga0208306_10403212 | 3300027214 | Estuarine | MTNKTKPIFNSFQEYMEAENMIFKTLQGDMTVTIGSKDIE |
Ga0209692_104589062 | 3300027828 | Marine Sediment | MKQKLKPIFDSFQEYIEAEDMIFETLQDRVTNGTKDIK |
Ga0209092_105296362 | 3300027833 | Marine | MTNKTKPIFNSFQEYIEAEDMIFKTLQGDMTVTIGSKDIE |
Ga0209404_104190313 | 3300027906 | Marine | MKTKTNNIFDSFQEYIEAENMIFKTLDVEIKSMTLGSKDIE |
Ga0256382_11239834 | 3300028022 | Seawater | MTTKLKPIFDSFQEYIEAEDMIFKTLQDSVTNGTKDIE |
Ga0315322_1000338420 | 3300031766 | Seawater | MTKKLKPIFDSFQEYIEAEDMIFTTLQNDMESGTIGS |
Ga0315322_107514561 | 3300031766 | Seawater | MTKKTQPIFNSFQEYIEAENMIFKTLQGSMETVTIGSKDI |
Ga0315320_106154402 | 3300031851 | Seawater | MTNKTKPIFNSFQEYIEAENMIFKTLQGNMETVTIGSKDIE |
Ga0315321_105027462 | 3300032088 | Seawater | MTNKTKPIFNSFQEYMEAEDMIFKTLQGDMTVTIGYKDIE |
Ga0316207_103625192 | 3300032212 | Microbial Mat | MTNKIKPIFDSFQEYIEAEDMIFKTLQGNMETVTIGSNDIE |
Ga0316202_102512033 | 3300032277 | Microbial Mat | MTKKLEPIFNSFQEYIEAEDMIFETLQDRVTNGTKDIK |
⦗Top⦘ |