| Basic Information | |
|---|---|
| Family ID | F040710 |
| Family Type | Metagenome |
| Number of Sequences | 161 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKYFGTVKSFDTIKGHGEIKPETGGDDLRFERSAISWDKD |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.03 % |
| % of genes near scaffold ends (potentially truncated) | 98.14 % |
| % of genes from short scaffolds (< 2000 bps) | 91.30 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.429 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (12.422 % of family members) |
| Environment Ontology (ENVO) | Unclassified (59.627 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (73.292 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.41% β-sheet: 25.00% Coil/Unstructured: 70.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF00313 | CSD | 8.07 |
| PF10276 | zf-CHCC | 1.86 |
| PF02910 | Succ_DH_flav_C | 1.86 |
| PF13426 | PAS_9 | 1.24 |
| PF02586 | SRAP | 1.24 |
| PF05433 | Rick_17kDa_Anti | 1.24 |
| PF13202 | EF-hand_5 | 0.62 |
| PF01266 | DAO | 0.62 |
| PF09351 | DUF1993 | 0.62 |
| PF12697 | Abhydrolase_6 | 0.62 |
| PF07883 | Cupin_2 | 0.62 |
| PF00691 | OmpA | 0.62 |
| PF01381 | HTH_3 | 0.62 |
| PF08448 | PAS_4 | 0.62 |
| PF09413 | DUF2007 | 0.62 |
| PF01467 | CTP_transf_like | 0.62 |
| PF01431 | Peptidase_M13 | 0.62 |
| PF11127 | DUF2892 | 0.62 |
| PF13545 | HTH_Crp_2 | 0.62 |
| PF03734 | YkuD | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 1.24 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.43 % |
| Unclassified | root | N/A | 28.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459020|G1P06HT02IU9MT | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 526 | Open in IMG/M |
| 3300000881|JGI10215J12807_1386569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 860 | Open in IMG/M |
| 3300001990|JGI24737J22298_10052831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1231 | Open in IMG/M |
| 3300001990|JGI24737J22298_10234667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 541 | Open in IMG/M |
| 3300002067|JGI24735J21928_10076739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 957 | Open in IMG/M |
| 3300002155|JGI24033J26618_1041453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 643 | Open in IMG/M |
| 3300002244|JGI24742J22300_10065186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220 | 673 | Open in IMG/M |
| 3300004114|Ga0062593_101127105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 817 | Open in IMG/M |
| 3300004114|Ga0062593_102854558 | Not Available | 552 | Open in IMG/M |
| 3300004153|Ga0063455_101312258 | Not Available | 552 | Open in IMG/M |
| 3300004463|Ga0063356_102813624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SM33 | 749 | Open in IMG/M |
| 3300004643|Ga0062591_100339983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1206 | Open in IMG/M |
| 3300005093|Ga0062594_102970346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300005093|Ga0062594_103384262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 501 | Open in IMG/M |
| 3300005290|Ga0065712_10250334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 948 | Open in IMG/M |
| 3300005290|Ga0065712_10803620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 511 | Open in IMG/M |
| 3300005293|Ga0065715_10780427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 586 | Open in IMG/M |
| 3300005327|Ga0070658_10568608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 981 | Open in IMG/M |
| 3300005327|Ga0070658_10831548 | Not Available | 802 | Open in IMG/M |
| 3300005327|Ga0070658_11739621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 539 | Open in IMG/M |
| 3300005329|Ga0070683_102252166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 523 | Open in IMG/M |
| 3300005330|Ga0070690_101127184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 623 | Open in IMG/M |
| 3300005339|Ga0070660_100520604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 990 | Open in IMG/M |
| 3300005344|Ga0070661_101043037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 680 | Open in IMG/M |
| 3300005347|Ga0070668_100473467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1080 | Open in IMG/M |
| 3300005347|Ga0070668_102118966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 519 | Open in IMG/M |
| 3300005366|Ga0070659_100053957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3165 | Open in IMG/M |
| 3300005367|Ga0070667_101786255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 579 | Open in IMG/M |
| 3300005440|Ga0070705_101481893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Porphyrobacter → unclassified Porphyrobacter → Porphyrobacter sp. HL-46 | 568 | Open in IMG/M |
| 3300005535|Ga0070684_100381621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1298 | Open in IMG/M |
| 3300005542|Ga0070732_10465205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 765 | Open in IMG/M |
| 3300005548|Ga0070665_102111802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 568 | Open in IMG/M |
| 3300005563|Ga0068855_100452461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1401 | Open in IMG/M |
| 3300005577|Ga0068857_101592755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 637 | Open in IMG/M |
| 3300005614|Ga0068856_100410705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 1374 | Open in IMG/M |
| 3300005614|Ga0068856_100469083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1280 | Open in IMG/M |
| 3300005614|Ga0068856_101400429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 714 | Open in IMG/M |
| 3300005617|Ga0068859_100067846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 3602 | Open in IMG/M |
| 3300005617|Ga0068859_101203216 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300005718|Ga0068866_11375090 | Not Available | 515 | Open in IMG/M |
| 3300005834|Ga0068851_10021577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3127 | Open in IMG/M |
| 3300005841|Ga0068863_102386523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. LH128 | 538 | Open in IMG/M |
| 3300005842|Ga0068858_100965109 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 835 | Open in IMG/M |
| 3300006051|Ga0075364_10538091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 798 | Open in IMG/M |
| 3300006195|Ga0075366_10609172 | Not Available | 677 | Open in IMG/M |
| 3300006237|Ga0097621_102035616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 549 | Open in IMG/M |
| 3300006353|Ga0075370_10978791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
| 3300009093|Ga0105240_12742282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220 | 507 | Open in IMG/M |
| 3300009101|Ga0105247_11712601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 520 | Open in IMG/M |
| 3300009156|Ga0111538_13341023 | Not Available | 558 | Open in IMG/M |
| 3300009177|Ga0105248_12057787 | Not Available | 649 | Open in IMG/M |
| 3300009545|Ga0105237_12448062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
| 3300009551|Ga0105238_11344344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220 | 741 | Open in IMG/M |
| 3300010042|Ga0126314_10724084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 730 | Open in IMG/M |
| 3300010399|Ga0134127_10066722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3040 | Open in IMG/M |
| 3300010399|Ga0134127_12396569 | Not Available | 607 | Open in IMG/M |
| 3300011119|Ga0105246_11250030 | Not Available | 686 | Open in IMG/M |
| 3300011119|Ga0105246_11508230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 632 | Open in IMG/M |
| 3300012490|Ga0157322_1050695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 504 | Open in IMG/M |
| 3300012509|Ga0157334_1063910 | Not Available | 538 | Open in IMG/M |
| 3300012582|Ga0137358_11053391 | Not Available | 522 | Open in IMG/M |
| 3300012895|Ga0157309_10311501 | Not Available | 535 | Open in IMG/M |
| 3300012958|Ga0164299_11006021 | Not Available | 615 | Open in IMG/M |
| 3300012987|Ga0164307_11716944 | Not Available | 532 | Open in IMG/M |
| 3300013102|Ga0157371_10561508 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300013102|Ga0157371_10771697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 723 | Open in IMG/M |
| 3300013102|Ga0157371_11199542 | Not Available | 585 | Open in IMG/M |
| 3300013104|Ga0157370_10862329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 823 | Open in IMG/M |
| 3300013104|Ga0157370_12005273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220 | 519 | Open in IMG/M |
| 3300013105|Ga0157369_12463241 | Not Available | 527 | Open in IMG/M |
| 3300013296|Ga0157374_11908997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220 | 620 | Open in IMG/M |
| 3300013297|Ga0157378_10970572 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300013297|Ga0157378_11935694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 639 | Open in IMG/M |
| 3300013297|Ga0157378_12509527 | Not Available | 567 | Open in IMG/M |
| 3300013306|Ga0163162_10756166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1091 | Open in IMG/M |
| 3300014325|Ga0163163_11092653 | Not Available | 860 | Open in IMG/M |
| 3300014968|Ga0157379_10141853 | All Organisms → cellular organisms → Bacteria | 2166 | Open in IMG/M |
| 3300015371|Ga0132258_10202781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 4813 | Open in IMG/M |
| 3300015371|Ga0132258_10572101 | All Organisms → cellular organisms → Bacteria | 2834 | Open in IMG/M |
| 3300015372|Ga0132256_102000592 | Not Available | 686 | Open in IMG/M |
| 3300015373|Ga0132257_101660761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 818 | Open in IMG/M |
| 3300015373|Ga0132257_104621743 | Not Available | 501 | Open in IMG/M |
| 3300015374|Ga0132255_100064405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 4841 | Open in IMG/M |
| 3300015374|Ga0132255_101929103 | Not Available | 898 | Open in IMG/M |
| 3300015374|Ga0132255_104893111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 567 | Open in IMG/M |
| 3300018476|Ga0190274_11915106 | Not Available | 688 | Open in IMG/M |
| 3300021445|Ga0182009_10712330 | Not Available | 544 | Open in IMG/M |
| 3300025893|Ga0207682_10434814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 621 | Open in IMG/M |
| 3300025899|Ga0207642_11000926 | Not Available | 538 | Open in IMG/M |
| 3300025901|Ga0207688_10079025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1876 | Open in IMG/M |
| 3300025901|Ga0207688_10971537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 537 | Open in IMG/M |
| 3300025904|Ga0207647_10271745 | Not Available | 969 | Open in IMG/M |
| 3300025904|Ga0207647_10310936 | Not Available | 896 | Open in IMG/M |
| 3300025904|Ga0207647_10341374 | Not Available | 849 | Open in IMG/M |
| 3300025907|Ga0207645_11060472 | Not Available | 547 | Open in IMG/M |
| 3300025917|Ga0207660_11136574 | Not Available | 636 | Open in IMG/M |
| 3300025919|Ga0207657_11061857 | Not Available | 620 | Open in IMG/M |
| 3300025920|Ga0207649_10066562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2284 | Open in IMG/M |
| 3300025920|Ga0207649_10466601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 955 | Open in IMG/M |
| 3300025920|Ga0207649_10536142 | Not Available | 894 | Open in IMG/M |
| 3300025921|Ga0207652_10197492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1810 | Open in IMG/M |
| 3300025923|Ga0207681_11760017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 517 | Open in IMG/M |
| 3300025924|Ga0207694_11559541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 557 | Open in IMG/M |
| 3300025925|Ga0207650_10752575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 825 | Open in IMG/M |
| 3300025931|Ga0207644_10832125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 772 | Open in IMG/M |
| 3300025931|Ga0207644_11040796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas daechungensis | 687 | Open in IMG/M |
| 3300025932|Ga0207690_10226537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1433 | Open in IMG/M |
| 3300025932|Ga0207690_10333189 | Not Available | 1196 | Open in IMG/M |
| 3300025932|Ga0207690_10778645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220 | 790 | Open in IMG/M |
| 3300025932|Ga0207690_10859999 | Not Available | 751 | Open in IMG/M |
| 3300025941|Ga0207711_10550318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1076 | Open in IMG/M |
| 3300025942|Ga0207689_11081006 | Not Available | 676 | Open in IMG/M |
| 3300025944|Ga0207661_10071600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2833 | Open in IMG/M |
| 3300025945|Ga0207679_11311684 | Not Available | 664 | Open in IMG/M |
| 3300025945|Ga0207679_11691654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220 | 579 | Open in IMG/M |
| 3300025949|Ga0207667_10361129 | Not Available | 1481 | Open in IMG/M |
| 3300025949|Ga0207667_10564276 | Not Available | 1150 | Open in IMG/M |
| 3300025949|Ga0207667_11916336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 554 | Open in IMG/M |
| 3300025972|Ga0207668_10351420 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1233 | Open in IMG/M |
| 3300025981|Ga0207640_10850871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 794 | Open in IMG/M |
| 3300025986|Ga0207658_12153914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 506 | Open in IMG/M |
| 3300026067|Ga0207678_10316684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1342 | Open in IMG/M |
| 3300026067|Ga0207678_10647699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 928 | Open in IMG/M |
| 3300026067|Ga0207678_11031357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 728 | Open in IMG/M |
| 3300026067|Ga0207678_11558075 | Not Available | 582 | Open in IMG/M |
| 3300026078|Ga0207702_11027512 | Not Available | 818 | Open in IMG/M |
| 3300026078|Ga0207702_11222645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220 | 745 | Open in IMG/M |
| 3300026078|Ga0207702_12209237 | Not Available | 539 | Open in IMG/M |
| 3300026088|Ga0207641_10420992 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300026116|Ga0207674_10139313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2386 | Open in IMG/M |
| 3300026121|Ga0207683_10107013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2501 | Open in IMG/M |
| 3300026121|Ga0207683_10817968 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 865 | Open in IMG/M |
| 3300027718|Ga0209795_10152757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220 | 651 | Open in IMG/M |
| 3300028381|Ga0268264_10528950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1154 | Open in IMG/M |
| 3300028587|Ga0247828_10365542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 819 | Open in IMG/M |
| 3300028590|Ga0247823_11369074 | Not Available | 530 | Open in IMG/M |
| 3300028596|Ga0247821_10444641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 816 | Open in IMG/M |
| 3300028597|Ga0247820_10299112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1053 | Open in IMG/M |
| 3300031562|Ga0310886_10015179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 2947 | Open in IMG/M |
| 3300031562|Ga0310886_10371957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 836 | Open in IMG/M |
| 3300031824|Ga0307413_10233471 | Not Available | 1352 | Open in IMG/M |
| 3300031824|Ga0307413_10316989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1189 | Open in IMG/M |
| 3300031852|Ga0307410_10338533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1198 | Open in IMG/M |
| 3300031852|Ga0307410_11769379 | Not Available | 548 | Open in IMG/M |
| 3300031854|Ga0310904_10414527 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300031901|Ga0307406_11027933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 708 | Open in IMG/M |
| 3300031903|Ga0307407_10496868 | Not Available | 893 | Open in IMG/M |
| 3300031911|Ga0307412_11480680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 616 | Open in IMG/M |
| 3300031938|Ga0308175_102242300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 612 | Open in IMG/M |
| 3300031944|Ga0310884_10731984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 600 | Open in IMG/M |
| 3300031995|Ga0307409_101768583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 647 | Open in IMG/M |
| 3300032004|Ga0307414_11523860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 622 | Open in IMG/M |
| 3300032005|Ga0307411_10265324 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300032075|Ga0310890_10093558 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1863 | Open in IMG/M |
| 3300032075|Ga0310890_11108671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 641 | Open in IMG/M |
| 3300032122|Ga0310895_10264832 | Not Available | 800 | Open in IMG/M |
| 3300032126|Ga0307415_101160617 | Not Available | 726 | Open in IMG/M |
| 3300032126|Ga0307415_102233043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 536 | Open in IMG/M |
| 3300032179|Ga0310889_10000012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 26420 | Open in IMG/M |
| 3300032211|Ga0310896_10235565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220 | 919 | Open in IMG/M |
| 3300033412|Ga0310810_11092452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220 | 665 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 12.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 12.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.70% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 7.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.21% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.11% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.86% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.62% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.62% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.62% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.62% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.62% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459020 | Litter degradation NP2 | Engineered | Open in IMG/M |
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
| 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Host-Associated | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Host-Associated | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2NP_01993880 | 2170459020 | Switchgrass, Maize And Mischanthus Litter | VPGKELIMKLFGTVKSFDTIKGQGEITPEAGGDPIHFEKSAISWDKNV |
| JGI10215J12807_13865693 | 3300000881 | Soil | MKYFGTVKSFDTIKGLGEIKPEAGGDMLRFERSAFSWENDSVPTVGQR |
| JGI24737J22298_100528313 | 3300001990 | Corn Rhizosphere | MKYFGTVKSFDTIRGHGEIKQEAGGNDLPFETSAIQWDKNVAPTVGQRL |
| JGI24737J22298_102346671 | 3300001990 | Corn Rhizosphere | MKLFGTVQSFDTIKGQGEIKPEVGSDLIHFEKSAIGWEKDRLP |
| JGI24735J21928_100767392 | 3300002067 | Corn Rhizosphere | MRQFWLMPGKELIMKLFGTVQSFDTIKGHGEIKPEVGSDLIGFEKSAIAWDKDRLP |
| JGI24033J26618_10414531 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLFGTVQSFDTTKGHGEIKPEVGADLIRFEKSAIAWDKNV |
| JGI24742J22300_100651861 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYFGTVKSFDTIKGHGEIKQEAGGNDLPFETSAIQWDKNVAPT |
| Ga0062593_1011271051 | 3300004114 | Soil | MKYFGTVKSFDNEQGHGMIKPETAGDELRFERSAISWGKENP |
| Ga0062593_1028545582 | 3300004114 | Soil | MKLFGTVKSFDSVQGHGEITPEVGTDLIRFDKSAIAWDKATPPT |
| Ga0063455_1013122582 | 3300004153 | Soil | MKLFGTVQSFDTIKGAGEIKPEVGSDLIRFHKSAIAWAKDRLPT |
| Ga0063356_1028136242 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKYFGTVTSYDPVKGNGELKQEVGGTDLPFEKTAFQWDKDVAPSIGQ |
| Ga0062591_1003399831 | 3300004643 | Soil | MKYFGTVKSFDDDKGVGSLKPETGGDDLYFERSAIKFDMPSV |
| Ga0062594_1029703462 | 3300005093 | Soil | MKYFGTVSSFDTIKGHGEIKPETGGDPLRFERAAVSWAENAAPTV |
| Ga0062594_1033842622 | 3300005093 | Soil | MKYFGTVKSFDIDKGIGSLKPETGGDDLYFERNAISWDAPKSL |
| Ga0065712_102503343 | 3300005290 | Miscanthus Rhizosphere | MKYFGTVKSFDTIKGLGEIKPEAGGDMLRFERSAFSWENDTVPTVG |
| Ga0065712_108036202 | 3300005290 | Miscanthus Rhizosphere | MKLFGTVQSFDTIKGQGEIKPEVGSELIHFEKSAIGWEKDRLPTV |
| Ga0065715_107804271 | 3300005293 | Miscanthus Rhizosphere | MKYFGTVKSFDADKGIGSLKPETGGDDLYFERSAIKFDMPSVPS |
| Ga0070658_105686081 | 3300005327 | Corn Rhizosphere | MKYFGTVKSFDTIKGHGEIKQEAGGNDLRFETSAIMWDKNVAPVIGQRLSYDVGQSPERH |
| Ga0070658_108315481 | 3300005327 | Corn Rhizosphere | MKYFGTVNSFDTGKGHGEIKPETGGDMLRFERSAFSWENNAVP |
| Ga0070658_117396212 | 3300005327 | Corn Rhizosphere | MKYFGTVKSFDTVAGHGEIKPETGGNDLRFETAAIMWDKNIAPVIGQRLSYDV |
| Ga0070683_1022521661 | 3300005329 | Corn Rhizosphere | MKLFGTVQSFDTIRGHGEIKPELSNDVIRFERSAIAWDKDRLPTVGQRL |
| Ga0070690_1011271841 | 3300005330 | Switchgrass Rhizosphere | MKYFGTVKSFDTIKGHGEIKPETGGDDLRFERSAISWDKDALPTV |
| Ga0070660_1005206041 | 3300005339 | Corn Rhizosphere | MKYFGTVNSFDTGKGHGEIKPETGGDMLRFERSAFSWENNAV |
| Ga0070661_1010430372 | 3300005344 | Corn Rhizosphere | MKLFGTVKSFDTISGNGEIKPEAGGDPLRFEKKAISWGTHSPPTVG |
| Ga0070668_1004734671 | 3300005347 | Switchgrass Rhizosphere | MKYFGTVMAFDVDLGLGSIKPETGGDELRFERSAISWDAPK |
| Ga0070668_1021189661 | 3300005347 | Switchgrass Rhizosphere | MKYFGTVKSFDTIKGHGEIKPETGGDDLRFERSAISWDKDTLPTVGQR |
| Ga0070659_1000539571 | 3300005366 | Corn Rhizosphere | MKYFGTVKTFDSATGRGEIKQETGGDDLRFEKSAISWGDKSPP |
| Ga0070667_1017862551 | 3300005367 | Switchgrass Rhizosphere | MPILARAGKEPTMKLFGTVQSFDTIKGNGEIKPEVGSDLIRFHKSAIA |
| Ga0070705_1014818931 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYFGTVKSFDTTKGHGEIKPETGGNDLGFEKSSIQWDKNIAPPSASA* |
| Ga0070684_1003816214 | 3300005535 | Corn Rhizosphere | MKYFGTVSSFDAGNGHGEIKPETGGDMLRFERSAFSWENNA |
| Ga0070732_104652051 | 3300005542 | Surface Soil | MKLFGTVQSFDTIKGQGEIKPEVGSDLIHFEKSAITDKSRLPTVGQRLSY |
| Ga0070665_1021118022 | 3300005548 | Switchgrass Rhizosphere | MKLFGTVKSFDSVQGHGQITPEAGGELIRFDKSAIAW |
| Ga0068855_1004524611 | 3300005563 | Corn Rhizosphere | MKLFGTVQSFDTIKGHGEIKPEVGSDLIRFEKSAIAWGKDR |
| Ga0068857_1015927552 | 3300005577 | Corn Rhizosphere | MKYFGTVKSFDTIKGHGEIKQEAGGNDLRFETSAIQWDRNV |
| Ga0068856_1004107051 | 3300005614 | Corn Rhizosphere | MKYFGTVKSFDTVAGHGEIKPETGGNDLRFETAAIMWDKNIAP |
| Ga0068856_1004690831 | 3300005614 | Corn Rhizosphere | MKYFGTIKSFDTIKGHGEIKQETGGNDLRFETSAIMWDKN |
| Ga0068856_1014004291 | 3300005614 | Corn Rhizosphere | MKYFGTVSSFDAGNGHGEIKPETGGDMLRFERSAFSWENNAVPTVGQRLSYDV |
| Ga0068859_1000678461 | 3300005617 | Switchgrass Rhizosphere | MKYFGTVKSFDTGKGHGEIKPETGGDMLRFERSAFSWENNAVPTVGQRLSYD |
| Ga0068859_1012032162 | 3300005617 | Switchgrass Rhizosphere | MKYFGTVNSFDTGKGHGEIKPETGGDMLRFERSAFSWENNAVPT |
| Ga0068866_113750901 | 3300005718 | Miscanthus Rhizosphere | MKYFGTIKSFDTTKGHGEIKQEAGGNDLPFEKSAIAWAKNIVPTLGQRLSYDVGTGTDRQ |
| Ga0068851_100215773 | 3300005834 | Corn Rhizosphere | MKLFGTVQSFDTIKGHGEIKPEVGSDLIGFEKSAIAWDKDRLPTVGQR |
| Ga0068863_1023865231 | 3300005841 | Switchgrass Rhizosphere | MKYFGTVKSFDPDKGLGTLKPETGGDDLYFERSAISWDAPKDIT |
| Ga0068858_1009651093 | 3300005842 | Switchgrass Rhizosphere | MKLFGTVKSFDSAQGHGQITPEAGGELIRFDQSAIATWDKATPPTVGQR |
| Ga0075364_105380912 | 3300006051 | Populus Endosphere | MKYFGTVKSFDTDKGIGALKPETGGDDLKFERNAISW |
| Ga0075366_106091721 | 3300006195 | Populus Endosphere | MKYFGTVSSFDTDKGQGEIKPETDSPMLGFERSAFSWENDAVPT |
| Ga0097621_1020356161 | 3300006237 | Miscanthus Rhizosphere | MKYFGTVKSFDTIQGHGEIKPEAGGDMLRFERSAFSW |
| Ga0075370_109787911 | 3300006353 | Populus Endosphere | MKYFGTVKSFDTTKGHGEIKPETGGNDLGFEKSSIQWDKN |
| Ga0105240_127422821 | 3300009093 | Corn Rhizosphere | MKYFGTVSSFDAGNGHGEIKPETGGDMLRFERSAFSWENN |
| Ga0105247_117126012 | 3300009101 | Switchgrass Rhizosphere | MKYFGTIKSFDVTQGRGEIKPETGGNDLPFEKSAIQWDKNVDPTVGQRLSYDVGQT |
| Ga0111538_133410231 | 3300009156 | Populus Rhizosphere | MKYFGTVKSFDTIKGHGEIKPEAGGDMLSFGRSAFSWENDSVPTVGQ |
| Ga0105248_120577871 | 3300009177 | Switchgrass Rhizosphere | VPILALPTKELTMKYFGTVNSFDTGKGHGEIKPETGGDMLRFERSAFSWENNAVP |
| Ga0105237_124480622 | 3300009545 | Corn Rhizosphere | VPGKELTMKYFGTVKSFDTTKGHGEIKPETGGNDLGFEKSSIQWDKNIAPTV |
| Ga0105238_113443443 | 3300009551 | Corn Rhizosphere | MKYFGTVKSFDTIKGHGEIKQEAGGNDLPFETSAI |
| Ga0126314_107240841 | 3300010042 | Serpentine Soil | MKLFGTVKSFDTIKGHGEIKPEVGTDLIRFEKSAISWEKDKL |
| Ga0134127_100667226 | 3300010399 | Terrestrial Soil | MKYFGTVKSFDTALGVGEIKQEVGGDDLRFEKAAISWGNENPPTV |
| Ga0134127_123965691 | 3300010399 | Terrestrial Soil | MKYFGTVKTFDPDKGLGSLKPETGGDDLYFERSAIS* |
| Ga0105246_112500302 | 3300011119 | Miscanthus Rhizosphere | MKYFGTIKSFDTVEGRGEIKQEAGGNDLHFSKSAIAWGKEIAPVVGQRLSYDVGTDTD |
| Ga0105246_115082302 | 3300011119 | Miscanthus Rhizosphere | MKYFGTVKSFDSVKGFGELKQEAGGDDLRFEKSAISWDKN |
| Ga0157322_10506952 | 3300012490 | Arabidopsis Rhizosphere | VPIKELTMKYFGTVKSFDSVKGFGELKQEAGGDDLRFEKSAISWDKNVAP |
| Ga0157334_10639103 | 3300012509 | Soil | MKLFGTVKSFDTIQGHGEITPEVGSVPIRFEKKAISWGT |
| Ga0137358_110533912 | 3300012582 | Vadose Zone Soil | MKYFGTVKSFDGALGHGEIKQETGGDDLRFDKAAIS |
| Ga0157309_103115012 | 3300012895 | Soil | MKYFGTVKSFDSATGHGEIKQEAGGDMLPFDRSAFTWDKDVVPTVGQ |
| Ga0164299_110060211 | 3300012958 | Soil | MKDFGTVKSVDSAQGFGEIKQEAGGDDLRFEKSAISW |
| Ga0164307_117169442 | 3300012987 | Soil | MKLFGTIKSFDSVQGSGEIKPEATGEIVRFDKSAISWG |
| Ga0157371_105615081 | 3300013102 | Corn Rhizosphere | MKYFGTVKSFDTIKGHGEIKQEAGGNDLRFETSAIMWDKNVAPVI |
| Ga0157371_107716971 | 3300013102 | Corn Rhizosphere | MKYFGTIKSFDTIKGHGEIKPETGGNDLRFETSAIMWDKNIAPV |
| Ga0157371_111995421 | 3300013102 | Corn Rhizosphere | MKYFGTVKTFDPDKGLGSLKPETGGDDLYFERSAISWDAPKDITV |
| Ga0157370_108623291 | 3300013104 | Corn Rhizosphere | MKYFGTVKSFDTIKGHGEIKQEAGGNDLPFETSAIQWDKNVAPTVGQRLSY |
| Ga0157370_120052732 | 3300013104 | Corn Rhizosphere | MKYFGTVSSFDAGNGHGEIKPETGGDMLRFERSAFSWENNAVPTVG |
| Ga0157369_124632411 | 3300013105 | Corn Rhizosphere | MKYVGTVKSFDTVKGLGEIKQEAGGDDLRFEKSAIEWDQTVAPTVGQRLSYNR |
| Ga0157374_119089972 | 3300013296 | Miscanthus Rhizosphere | MKYFGTVKSFDTTKGHGEIKPETGGNDLGFEKSSIQWDKNIAPTVGQRLSYD |
| Ga0157378_109705721 | 3300013297 | Miscanthus Rhizosphere | MKYFGTVESFDTGKGHGEIKPETGGDLLSFGRSAFTWANDAVPTIGQRLSYDVGT |
| Ga0157378_119356942 | 3300013297 | Miscanthus Rhizosphere | MKYFGTVKSFDTIKGQGEIKPETGGDDLYFERSAIAWEKHNIPTVGQRLSYD |
| Ga0157378_125095272 | 3300013297 | Miscanthus Rhizosphere | MKYFGTVKSFDSVQGFGEIKQEAGGDDLRFEKSAISWDKNVAPTP |
| Ga0163162_107561662 | 3300013306 | Switchgrass Rhizosphere | VPEKELIMKLFGTVKSFDTIKGHGEITPEVGSVVLPFAKSAIGWEKDRLPTVGQRLL* |
| Ga0163163_110926532 | 3300014325 | Switchgrass Rhizosphere | MKYFGTVKSFDTVKGFGEIKQEAGGDDLRFEKAAISWGNETPPTVG |
| Ga0157379_101418531 | 3300014968 | Switchgrass Rhizosphere | MKYFGTVKSFDTIKGHGEIKPETGGDDLRFERSAISWDKD |
| Ga0132258_102027811 | 3300015371 | Arabidopsis Rhizosphere | MKYFGTVKSFDTIKGLGEIKPETGGDMLRFESSAFSWEDKSVPMVGQRLSYDVG |
| Ga0132258_105721016 | 3300015371 | Arabidopsis Rhizosphere | MKYFGTVKSFDTAKGLGEIKPETGGDMLRFESSAFSWEDKSVPMVGQRLSYDVG |
| Ga0132256_1020005921 | 3300015372 | Arabidopsis Rhizosphere | MNLFGSVQSFDTIKGHGEIKPEVGSDIIRFEKSAIA |
| Ga0132257_1016607611 | 3300015373 | Arabidopsis Rhizosphere | VSIKELTMRLFGTVKSFDTIKGHGEIKPEVAGDVIRFEKSAISWDKN |
| Ga0132257_1046217431 | 3300015373 | Arabidopsis Rhizosphere | MKYFGTVKSFDTAKGLGEIKQEAGGDDLHFDKAAISWGNDNPPT |
| Ga0132255_10006440513 | 3300015374 | Arabidopsis Rhizosphere | MKYFGTVKSFDTALGHGEIKQEAGGDDLRFDKAAISWG |
| Ga0132255_1019291033 | 3300015374 | Arabidopsis Rhizosphere | MKFFGTVKSFDTIKGLGEIKPEAGGDMLRFERSAFSWEND |
| Ga0132255_1048931111 | 3300015374 | Arabidopsis Rhizosphere | MKEFTMKYFGTVKSFDTIKGLGEINPEVSGNAIRFETSAIMWDKNVAPTIGQRLSYD |
| Ga0190274_119151061 | 3300018476 | Soil | MKYFGTVKSFDTDKGLGSLTPETGGDDLNFERSAI |
| Ga0182009_107123301 | 3300021445 | Soil | MKYFGTVKSFDTLKGHGEIKQEAGGNDLPFETSAIRWDKTVAPVVGQRLSYDVGAH |
| Ga0207682_104348141 | 3300025893 | Miscanthus Rhizosphere | MKLFGTVQSFDTIKGHGEIKPEVGNDTIRFERSAIAWG |
| Ga0207642_110009261 | 3300025899 | Miscanthus Rhizosphere | MKLFGTIKSFDSVKGFGEITPEATGETVRFEKSAIAW |
| Ga0207688_100790251 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYFGSVKSFDAIKGLGELTPETGGDPLRFERSAFLWNDNSD |
| Ga0207688_109715371 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLFGTVKSFDTIKGHGEIKPEVGSDILPFAKSAIAWDKDR |
| Ga0207647_102717452 | 3300025904 | Corn Rhizosphere | MKYFGTVKSFDSALGHGEIKQEAGGDDLRFDKAAISWGNEKPP |
| Ga0207647_103109361 | 3300025904 | Corn Rhizosphere | MKYFGTVKTFDSATGRGEIKQETGGDDLRFEKSAISWGDKSPPTVGQRL |
| Ga0207647_103413742 | 3300025904 | Corn Rhizosphere | MKFFGTVKSFDTVKGFGEIKQEAGGDDLRFEKAAISWGNET |
| Ga0207645_110604722 | 3300025907 | Miscanthus Rhizosphere | MKYFGTVKSFDTIKGLGEIKPETGGDMLGFERSAF |
| Ga0207660_111365742 | 3300025917 | Corn Rhizosphere | MKYFGTVKSFDTIKGHGEIEQEAGGNDLRFETSAIMWDKNVA |
| Ga0207657_110618572 | 3300025919 | Corn Rhizosphere | MKFFGTVKSFDTVKGFGEIKQEAGGDDLRFEKAAISWGN |
| Ga0207649_100665625 | 3300025920 | Corn Rhizosphere | MKYFGTVSSFDAGNGHGEIKPETGGDMLRFERSAFSWENNAVP |
| Ga0207649_104666014 | 3300025920 | Corn Rhizosphere | MKYFGTVKSFDTVKGHGEIKQEAGGNDLRFETSAIMWDKNVA |
| Ga0207649_105361423 | 3300025920 | Corn Rhizosphere | MKYFGTVKSFDTIKGLGEIKPEAGGDMLRFERSAFS |
| Ga0207652_101974924 | 3300025921 | Corn Rhizosphere | MKYFGTVKSFDTIKGHGEIIQEAGGNDLRFETSAIQWDKNVAPTVG |
| Ga0207681_117600171 | 3300025923 | Switchgrass Rhizosphere | VKYFGTVKSFDTIKGLGEINPEVSGNAIRFETSAIMWDKNVAPTIGQRLSYDVGTNNDR |
| Ga0207694_115595411 | 3300025924 | Corn Rhizosphere | MKLFGTVQSFDTIKGHGEIKPEVGSDLIGFEKSAIAWDKDRL |
| Ga0207650_107525751 | 3300025925 | Switchgrass Rhizosphere | MRLFGTVKSFDTIKGHGEIKPEVAGDVIRFEKSAISWDKNVVP |
| Ga0207644_108321251 | 3300025931 | Switchgrass Rhizosphere | MKYFGTVKSFDLSTGHGEIKQEAGGNDLRFEKSAIAWDKNIHPTVGQRLSYDVGTSTGR |
| Ga0207644_110407963 | 3300025931 | Switchgrass Rhizosphere | MKLFGTVQSFDTIKGHGEIKPEVGNDLIRFEKSAIGWEKD |
| Ga0207690_102265371 | 3300025932 | Corn Rhizosphere | MKYFGTVKSFDPVKGFGEIKQEAGGDDLRFEKAAI |
| Ga0207690_103331892 | 3300025932 | Corn Rhizosphere | MKYFGTVKTFDSATGRGEIKQETGGDDLRFEKSAISWGDKSPPTVG |
| Ga0207690_107786451 | 3300025932 | Corn Rhizosphere | MKYFGTVKSFDTIKGHGEIKQEAGGNDLPFETSAIQWDKNV |
| Ga0207690_108599993 | 3300025932 | Corn Rhizosphere | MKYFGTVKSFDTIKGLGEIKPEAGGDMLRFERSAFSW |
| Ga0207711_105503184 | 3300025941 | Switchgrass Rhizosphere | MKYFGTVKSFDTGKGHGEIKPETGGDMLRFERSAFSWENNAVPTVGQRLSY |
| Ga0207689_110810062 | 3300025942 | Miscanthus Rhizosphere | MKYFGTVKSFDPDKGLGTLKPETGGDDLYFERSAISWDAP |
| Ga0207661_100716001 | 3300025944 | Corn Rhizosphere | MKYFGTVKSFDSALGHGEIKQEAGGDDLRFDKAAISWGNEN |
| Ga0207679_113116842 | 3300025945 | Corn Rhizosphere | MKYFGTVNSFDTGKGHGEIKPETGGDMLRFERSAFSWE |
| Ga0207679_116916541 | 3300025945 | Corn Rhizosphere | MKYFGTVSSFDTNKGHGEIKPETGGDMLRFERGAFSPENKAVPTVGQRLSY |
| Ga0207667_103611293 | 3300025949 | Corn Rhizosphere | MKYFGTVKSFDTVAGHGEIKPETGGNDLRFETAAIMWD |
| Ga0207667_105642762 | 3300025949 | Corn Rhizosphere | MKYFGTVKSFDTVKGFGEIKQEAGGDDLRFDKAAISWGNDSPPTVG |
| Ga0207667_119163361 | 3300025949 | Corn Rhizosphere | MKYFGTVKSFDTIKGHGEIKQEAGGNDLRFETSAIMWDKNVAPVIG |
| Ga0207668_103514204 | 3300025972 | Switchgrass Rhizosphere | MKYFGTVMAFDVDLGLGSIKPETGGDELRFERSAISWDAPKAP |
| Ga0207640_108508711 | 3300025981 | Corn Rhizosphere | MKYFGTVKSFDTIKGHGEIKQEAGGNDLPSETSAIQW |
| Ga0207658_121539142 | 3300025986 | Switchgrass Rhizosphere | MKYFGTVKSFDTIRGHGEIKQEAGGNDLPFETSAIQWDKNVAPTVGQ |
| Ga0207678_103166844 | 3300026067 | Corn Rhizosphere | MKYVGTVKSFDTIKGLGEITQEAGGDDLRFDKSAIQWDQNVAPTV |
| Ga0207678_106476993 | 3300026067 | Corn Rhizosphere | MKYVGTVKSFDTVKGLGEITQEAGGDDLRFDKSAIQWDQNVAPTV |
| Ga0207678_110313571 | 3300026067 | Corn Rhizosphere | MKLFGTVKSFDSVQGHGQITPEAGGDLIRFDKSAIAWDKKTDPT |
| Ga0207678_115580752 | 3300026067 | Corn Rhizosphere | MKYFGTVKSFDTIKGLGEIKPETGGDMLRFESSAFSWEDKSVPMVGQRLSY |
| Ga0207702_110275121 | 3300026078 | Corn Rhizosphere | MKYFGTVKSFDPIKGYGEIKQEAGGDDLRFDKAAISWGNEN |
| Ga0207702_112226453 | 3300026078 | Corn Rhizosphere | MKYFGTVSSFDAGNGHGEIKPETGGDMLRFERSAFSWENNAVPTVGQR |
| Ga0207702_122092371 | 3300026078 | Corn Rhizosphere | MKYFGTIKSFDVTQGRGEIKPETGGNDLPFEKSAIQWDKNVDPTVGQ |
| Ga0207641_104209921 | 3300026088 | Switchgrass Rhizosphere | MKLFGTVKSFDSAQGHGQITPEAGGELIRFDQSAIASWDKATPPTVGQR |
| Ga0207674_101393131 | 3300026116 | Corn Rhizosphere | MKYFGTVKSFDTIQGHGEIKPEAGGDMLRFERSAFSWEK |
| Ga0207683_101070131 | 3300026121 | Miscanthus Rhizosphere | MKYFGTVKSFDTIRGHGEIKQEAGGNDLPFETSAIQWDKNVAPTVGQRLSY |
| Ga0207683_108179682 | 3300026121 | Miscanthus Rhizosphere | MKYFGTVKSFDTTKGHGQIKQETGGNDLGFEKSSIL |
| Ga0209795_101527571 | 3300027718 | Agave | MKYFGTVKSFDPELGHGEIKQEAGGDDLRFDKAAIAWDQSVVPTQGQRISYD |
| Ga0268264_105289502 | 3300028381 | Switchgrass Rhizosphere | MKYFGTVKSFDPDKGLGTLKPETGGDDLYFERSAISWDAPKDIP |
| Ga0247828_103655421 | 3300028587 | Soil | MKLFGTVQSFDTIKGHGEIKPEVGNDLIRFEKSAIGWDKD |
| Ga0247823_113690741 | 3300028590 | Soil | MKYFGTVKTFDNAQGVGEITPETGGSMLRFERSAFAWESDAVPTIG |
| Ga0247821_104446411 | 3300028596 | Soil | MKYFGTVKSFDPDKGLGTLKPETGGDDLYFERSAISWDAPKD |
| Ga0247820_102991124 | 3300028597 | Soil | MKYFGTVKSFDPATGHGEIKQEAGGDMLRFDRSAFSWAKDVVPTIG |
| Ga0310886_100151791 | 3300031562 | Soil | MKYFGTVKSFDPATGHGEIKQEAGGDMLPFDRSAFTWDKDVVPTVGQRLSYDK |
| Ga0310886_103719572 | 3300031562 | Soil | MKLFGTVHSFDTIKGRGEIKPEVGSDLIRFEKSAIAWDK |
| Ga0307413_102334712 | 3300031824 | Rhizosphere | MKYFGTVKSFDTVQGHGEITQEAGGDDLRFEKSAISW |
| Ga0307413_103169891 | 3300031824 | Rhizosphere | MKHFGTVKSFDHTVGSGLITPETGGPDLRFERSAFSWETG |
| Ga0307410_103385332 | 3300031852 | Rhizosphere | MKYFGTVKSFDTIKGLGEIKPETGGDMLGFERSAFSWD |
| Ga0307410_117693792 | 3300031852 | Rhizosphere | MKYFGTVTSYDTIKGHGELKQEAGGNDLPFEKSAFQW |
| Ga0310904_104145271 | 3300031854 | Soil | MKNFGTVKTFDVAQGHGQIKPEAGGDLLRFDRAAFSWPKDIVPTIGQ |
| Ga0307406_110279332 | 3300031901 | Rhizosphere | MKYFGTVKSFDAIKGQGEIKPESGGDPIHFEKSAISWDKNVLPTVGQ |
| Ga0307407_104968681 | 3300031903 | Rhizosphere | MKYFGTVKSFDTVQGHGEITQEAGGDDLRFEKSAISWDKDI |
| Ga0307412_114806801 | 3300031911 | Rhizosphere | MKLFGTVQSFDTIKGHGEIKPEVGNDLIRFSKSAIGWEKDRLPTVGQR |
| Ga0308175_1022423001 | 3300031938 | Soil | MKYFGTVKSFDTIKGHGEIKPEVAGNDISFETKAIMWDKNVAPTIGQRLSYDV |
| Ga0310884_107319841 | 3300031944 | Soil | MKLFGTVQSFDTIKGHGEIKPEVGSDLIRFEKSAIGWEKD |
| Ga0307409_1017685831 | 3300031995 | Rhizosphere | MKLFGTVKSFDSVKGHGEITPEAGGELIRFDKSAIAWDKATPPTVGQ |
| Ga0307414_115238602 | 3300032004 | Rhizosphere | MKLFGTVKSFDSVKGHGEITPEAGGELIRFDKSAIAWDKAVPP |
| Ga0307411_102653244 | 3300032005 | Rhizosphere | MKLFGTVQSFDTIKGQGEIKPEVGSDLIHFEKSAIKWD |
| Ga0310890_100935581 | 3300032075 | Soil | MKYFGTVKSFDTDKGIGALKPETGGDDLKFERNAISWDAPKSPNVG |
| Ga0310890_111086712 | 3300032075 | Soil | MKLFGTVKSFDSAQGHGQITPEGGGDVIRFDKSAI |
| Ga0310895_102648321 | 3300032122 | Soil | MKYFGTVKSFDVTQARGEIKQETGGNDLPFEKSAIQWDQNVDPTIGQRLSYDVGQTS |
| Ga0307415_1011606172 | 3300032126 | Rhizosphere | MKHFGTVKSYDSVKGLGEISPEVGSDLIRFDKSAINWDKKTDPTI |
| Ga0307415_1022330432 | 3300032126 | Rhizosphere | MKLFGTVQSFDTIKGHGEIKPEVGSDLIRFEKSAIAW |
| Ga0310889_1000001231 | 3300032179 | Soil | MKYFGTVKSFDTIKGLGEIKPEAGGDMLRFERSAFSWDNDSVPTVGQR |
| Ga0310896_102355652 | 3300032211 | Soil | MKYFGTVSSFDTIKGHGEIKPETGGDPLRFERAAVSWAENAAPTVGQRL |
| Ga0310810_110924521 | 3300033412 | Soil | MKYFGTVSSFDTNKGHGEIKPETGGDMLRFERGAFSPENKAV |
| ⦗Top⦘ |