| Basic Information | |
|---|---|
| Family ID | F040657 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 161 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MPAETLEFLLLLSGWIVAFLLGRELQTGFRQWRLRTAEQRARRQD |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 76.40 % |
| % of genes near scaffold ends (potentially truncated) | 20.50 % |
| % of genes from short scaffolds (< 2000 bps) | 89.44 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.596 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.770 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.087 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.553 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.53% β-sheet: 0.00% Coil/Unstructured: 42.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF00171 | Aldedh | 13.66 |
| PF01344 | Kelch_1 | 10.56 |
| PF00459 | Inositol_P | 3.73 |
| PF04978 | DUF664 | 2.48 |
| PF13964 | Kelch_6 | 1.86 |
| PF01261 | AP_endonuc_2 | 1.24 |
| PF11645 | PDDEXK_5 | 1.24 |
| PF02012 | BNR | 0.62 |
| PF03880 | DbpA | 0.62 |
| PF14697 | Fer4_21 | 0.62 |
| PF13188 | PAS_8 | 0.62 |
| PF13474 | SnoaL_3 | 0.62 |
| PF01301 | Glyco_hydro_35 | 0.62 |
| PF06283 | ThuA | 0.62 |
| PF07646 | Kelch_2 | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 13.66 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 13.66 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 13.66 |
| COG0513 | Superfamily II DNA and RNA helicase | Replication, recombination and repair [L] | 1.86 |
| COG1874 | Beta-galactosidase GanA | Carbohydrate transport and metabolism [G] | 0.62 |
| COG3055 | N-acetylneuraminic acid mutarotase | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.84 % |
| Unclassified | root | N/A | 34.16 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_114129073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 543 | Open in IMG/M |
| 3300004081|Ga0063454_100803801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 727 | Open in IMG/M |
| 3300004157|Ga0062590_102576055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 540 | Open in IMG/M |
| 3300004463|Ga0063356_102789473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 752 | Open in IMG/M |
| 3300004463|Ga0063356_103989450 | Not Available | 635 | Open in IMG/M |
| 3300004479|Ga0062595_102531810 | Not Available | 512 | Open in IMG/M |
| 3300004633|Ga0066395_10364293 | Not Available | 806 | Open in IMG/M |
| 3300004633|Ga0066395_10674446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 612 | Open in IMG/M |
| 3300005167|Ga0066672_10840136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 574 | Open in IMG/M |
| 3300005174|Ga0066680_10850927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 545 | Open in IMG/M |
| 3300005176|Ga0066679_10511579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 783 | Open in IMG/M |
| 3300005177|Ga0066690_10210869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1295 | Open in IMG/M |
| 3300005177|Ga0066690_10366374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 977 | Open in IMG/M |
| 3300005179|Ga0066684_10302975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1062 | Open in IMG/M |
| 3300005179|Ga0066684_10580748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 752 | Open in IMG/M |
| 3300005180|Ga0066685_10792893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 642 | Open in IMG/M |
| 3300005353|Ga0070669_101174474 | Not Available | 662 | Open in IMG/M |
| 3300005435|Ga0070714_101601617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 636 | Open in IMG/M |
| 3300005437|Ga0070710_10692853 | Not Available | 718 | Open in IMG/M |
| 3300005445|Ga0070708_100226111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1755 | Open in IMG/M |
| 3300005447|Ga0066689_10023250 | All Organisms → cellular organisms → Bacteria | 3065 | Open in IMG/M |
| 3300005454|Ga0066687_10309101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 898 | Open in IMG/M |
| 3300005467|Ga0070706_100211319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1812 | Open in IMG/M |
| 3300005467|Ga0070706_102131751 | Not Available | 506 | Open in IMG/M |
| 3300005471|Ga0070698_100093755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2982 | Open in IMG/M |
| 3300005518|Ga0070699_100724774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 909 | Open in IMG/M |
| 3300005533|Ga0070734_10447636 | Not Available | 736 | Open in IMG/M |
| 3300005534|Ga0070735_10114128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1692 | Open in IMG/M |
| 3300005537|Ga0070730_10045170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3218 | Open in IMG/M |
| 3300005537|Ga0070730_10047201 | All Organisms → cellular organisms → Bacteria | 3133 | Open in IMG/M |
| 3300005537|Ga0070730_10345278 | Not Available | 969 | Open in IMG/M |
| 3300005542|Ga0070732_10021063 | All Organisms → cellular organisms → Bacteria | 3671 | Open in IMG/M |
| 3300005554|Ga0066661_10286366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1016 | Open in IMG/M |
| 3300005559|Ga0066700_11116149 | Not Available | 515 | Open in IMG/M |
| 3300005561|Ga0066699_10944315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 600 | Open in IMG/M |
| 3300005575|Ga0066702_10263479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Aggregatilineales → Aggregatilineaceae → Aggregatilinea → Aggregatilinea lenta | 1051 | Open in IMG/M |
| 3300005598|Ga0066706_10047906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2868 | Open in IMG/M |
| 3300005614|Ga0068856_101104980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 810 | Open in IMG/M |
| 3300005764|Ga0066903_100020392 | All Organisms → cellular organisms → Bacteria | 7031 | Open in IMG/M |
| 3300005764|Ga0066903_100511196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2040 | Open in IMG/M |
| 3300005764|Ga0066903_101864544 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300005764|Ga0066903_102794751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 947 | Open in IMG/M |
| 3300005764|Ga0066903_107945734 | Not Available | 544 | Open in IMG/M |
| 3300006032|Ga0066696_10491697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 805 | Open in IMG/M |
| 3300006358|Ga0068871_100882001 | Not Available | 828 | Open in IMG/M |
| 3300006796|Ga0066665_10512042 | Not Available | 981 | Open in IMG/M |
| 3300006800|Ga0066660_10647042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 878 | Open in IMG/M |
| 3300006800|Ga0066660_11201423 | Not Available | 595 | Open in IMG/M |
| 3300006854|Ga0075425_101134516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 890 | Open in IMG/M |
| 3300006914|Ga0075436_100608950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 805 | Open in IMG/M |
| 3300009012|Ga0066710_100943335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1330 | Open in IMG/M |
| 3300009012|Ga0066710_101242323 | Not Available | 1155 | Open in IMG/M |
| 3300009012|Ga0066710_101598186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 999 | Open in IMG/M |
| 3300009012|Ga0066710_102084184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 835 | Open in IMG/M |
| 3300009088|Ga0099830_10821150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 767 | Open in IMG/M |
| 3300009089|Ga0099828_11480332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 599 | Open in IMG/M |
| 3300009090|Ga0099827_10763428 | Not Available | 836 | Open in IMG/M |
| 3300009090|Ga0099827_11874117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 523 | Open in IMG/M |
| 3300009094|Ga0111539_13442553 | Not Available | 508 | Open in IMG/M |
| 3300009098|Ga0105245_11931552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 643 | Open in IMG/M |
| 3300009098|Ga0105245_13288957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 500 | Open in IMG/M |
| 3300009100|Ga0075418_11635408 | Not Available | 700 | Open in IMG/M |
| 3300009101|Ga0105247_11542367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 543 | Open in IMG/M |
| 3300009137|Ga0066709_101155282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Aggregatilineales → Aggregatilineaceae → Aggregatilinea → Aggregatilinea lenta | 1139 | Open in IMG/M |
| 3300009137|Ga0066709_101266009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1083 | Open in IMG/M |
| 3300009137|Ga0066709_101409730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1012 | Open in IMG/M |
| 3300009137|Ga0066709_101674936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 904 | Open in IMG/M |
| 3300009137|Ga0066709_102191277 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 762 | Open in IMG/M |
| 3300009137|Ga0066709_103031836 | Not Available | 616 | Open in IMG/M |
| 3300009137|Ga0066709_103085096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 610 | Open in IMG/M |
| 3300009147|Ga0114129_10328630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2031 | Open in IMG/M |
| 3300009147|Ga0114129_12131355 | Not Available | 676 | Open in IMG/M |
| 3300009177|Ga0105248_10570299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1277 | Open in IMG/M |
| 3300010036|Ga0126305_10656369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 708 | Open in IMG/M |
| 3300010037|Ga0126304_10582902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
| 3300010038|Ga0126315_10274729 | Not Available | 1034 | Open in IMG/M |
| 3300010046|Ga0126384_12194334 | Not Available | 531 | Open in IMG/M |
| 3300010152|Ga0126318_10920438 | Not Available | 605 | Open in IMG/M |
| 3300010152|Ga0126318_10987100 | Not Available | 709 | Open in IMG/M |
| 3300010154|Ga0127503_11316978 | Not Available | 561 | Open in IMG/M |
| 3300010166|Ga0126306_11677873 | Not Available | 530 | Open in IMG/M |
| 3300010336|Ga0134071_10782506 | All Organisms → cellular organisms → Bacteria → PVC group | 509 | Open in IMG/M |
| 3300010358|Ga0126370_12213434 | Not Available | 542 | Open in IMG/M |
| 3300010359|Ga0126376_12514667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 563 | Open in IMG/M |
| 3300010359|Ga0126376_12645736 | Not Available | 550 | Open in IMG/M |
| 3300010361|Ga0126378_11185504 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 862 | Open in IMG/M |
| 3300010362|Ga0126377_10288380 | Not Available | 1613 | Open in IMG/M |
| 3300010366|Ga0126379_11295567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 835 | Open in IMG/M |
| 3300010371|Ga0134125_12895179 | Not Available | 521 | Open in IMG/M |
| 3300010376|Ga0126381_104273928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 553 | Open in IMG/M |
| 3300010398|Ga0126383_12382231 | Not Available | 614 | Open in IMG/M |
| 3300011269|Ga0137392_11179289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 624 | Open in IMG/M |
| 3300011270|Ga0137391_10109499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2395 | Open in IMG/M |
| 3300012019|Ga0120139_1204731 | Not Available | 524 | Open in IMG/M |
| 3300012096|Ga0137389_10361724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1236 | Open in IMG/M |
| 3300012096|Ga0137389_11508900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 568 | Open in IMG/M |
| 3300012199|Ga0137383_10426330 | Not Available | 972 | Open in IMG/M |
| 3300012199|Ga0137383_11207527 | Not Available | 543 | Open in IMG/M |
| 3300012204|Ga0137374_10043372 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4731 | Open in IMG/M |
| 3300012204|Ga0137374_10172797 | All Organisms → cellular organisms → Bacteria | 1897 | Open in IMG/M |
| 3300012207|Ga0137381_11118051 | Not Available | 678 | Open in IMG/M |
| 3300012208|Ga0137376_10892017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 764 | Open in IMG/M |
| 3300012209|Ga0137379_10175921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2052 | Open in IMG/M |
| 3300012209|Ga0137379_10440213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1212 | Open in IMG/M |
| 3300012209|Ga0137379_11596208 | Not Available | 551 | Open in IMG/M |
| 3300012211|Ga0137377_11390971 | Not Available | 630 | Open in IMG/M |
| 3300012212|Ga0150985_111534693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1150 | Open in IMG/M |
| 3300012212|Ga0150985_111667792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 543 | Open in IMG/M |
| 3300012212|Ga0150985_119163915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 512 | Open in IMG/M |
| 3300012212|Ga0150985_120357861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 849 | Open in IMG/M |
| 3300012212|Ga0150985_122603359 | Not Available | 653 | Open in IMG/M |
| 3300012350|Ga0137372_11082612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 552 | Open in IMG/M |
| 3300012358|Ga0137368_10265059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1180 | Open in IMG/M |
| 3300012359|Ga0137385_11567565 | Not Available | 523 | Open in IMG/M |
| 3300012363|Ga0137390_10622818 | Not Available | 1045 | Open in IMG/M |
| 3300012469|Ga0150984_109946580 | Not Available | 564 | Open in IMG/M |
| 3300012469|Ga0150984_112038810 | Not Available | 1864 | Open in IMG/M |
| 3300012469|Ga0150984_122834215 | All Organisms → cellular organisms → Bacteria | 2643 | Open in IMG/M |
| 3300012927|Ga0137416_11587888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 595 | Open in IMG/M |
| 3300012927|Ga0137416_11622778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 589 | Open in IMG/M |
| 3300012944|Ga0137410_11438691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 600 | Open in IMG/M |
| 3300012971|Ga0126369_11321738 | Not Available | 811 | Open in IMG/M |
| 3300012971|Ga0126369_13065717 | Not Available | 547 | Open in IMG/M |
| 3300013297|Ga0157378_11706726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 677 | Open in IMG/M |
| 3300013308|Ga0157375_11385341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 828 | Open in IMG/M |
| 3300013768|Ga0120155_1083195 | Not Available | 907 | Open in IMG/M |
| 3300013770|Ga0120123_1091068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 688 | Open in IMG/M |
| 3300013831|Ga0120126_1032623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 578 | Open in IMG/M |
| 3300014325|Ga0163163_11247254 | Not Available | 806 | Open in IMG/M |
| 3300015371|Ga0132258_10439878 | All Organisms → cellular organisms → Bacteria | 3248 | Open in IMG/M |
| 3300015373|Ga0132257_103200186 | Not Available | 596 | Open in IMG/M |
| 3300018468|Ga0066662_10057609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2520 | Open in IMG/M |
| 3300018468|Ga0066662_10345000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1277 | Open in IMG/M |
| 3300018468|Ga0066662_12267180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 570 | Open in IMG/M |
| 3300018482|Ga0066669_11786352 | Not Available | 568 | Open in IMG/M |
| 3300021358|Ga0213873_10086671 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300021362|Ga0213882_10052007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1620 | Open in IMG/M |
| 3300021362|Ga0213882_10201030 | Not Available | 822 | Open in IMG/M |
| 3300021384|Ga0213876_10198656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctQNx1 | 1066 | Open in IMG/M |
| 3300021384|Ga0213876_10335271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 804 | Open in IMG/M |
| 3300021384|Ga0213876_10635094 | Not Available | 568 | Open in IMG/M |
| 3300021560|Ga0126371_11254905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 876 | Open in IMG/M |
| 3300025910|Ga0207684_10450710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1105 | Open in IMG/M |
| 3300025910|Ga0207684_11324228 | Not Available | 592 | Open in IMG/M |
| 3300025910|Ga0207684_11586049 | Not Available | 530 | Open in IMG/M |
| 3300025922|Ga0207646_10579147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1008 | Open in IMG/M |
| 3300025922|Ga0207646_11469574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 591 | Open in IMG/M |
| 3300025928|Ga0207700_11428112 | Not Available | 615 | Open in IMG/M |
| 3300025941|Ga0207711_10398907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1278 | Open in IMG/M |
| 3300026078|Ga0207702_10735068 | Not Available | 974 | Open in IMG/M |
| 3300026548|Ga0209161_10210536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1062 | Open in IMG/M |
| 3300027748|Ga0209689_1046008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2477 | Open in IMG/M |
| 3300027857|Ga0209166_10036719 | All Organisms → cellular organisms → Bacteria | 2941 | Open in IMG/M |
| 3300027857|Ga0209166_10372788 | Not Available | 744 | Open in IMG/M |
| 3300027857|Ga0209166_10611306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 553 | Open in IMG/M |
| 3300027882|Ga0209590_10208956 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1236 | Open in IMG/M |
| 3300027986|Ga0209168_10162798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1127 | Open in IMG/M |
| 3300028536|Ga0137415_10209031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1769 | Open in IMG/M |
| 3300031962|Ga0307479_11204554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 721 | Open in IMG/M |
| 3300032261|Ga0306920_102822442 | Not Available | 661 | Open in IMG/M |
| 3300034384|Ga0372946_0080242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1509 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.45% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 6.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.35% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.73% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.11% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.48% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.48% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.86% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.86% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.24% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 1.24% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.24% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.24% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.62% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.62% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300013831 | Permafrost microbial communities from Nunavut, Canada - A21_5cm_6M | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1141290732 | 3300000956 | Soil | MPVETLEFMLLLSGWVVAFLLGRELQTGFRQWRLRTAEQRARNED* |
| Ga0063454_1008038014 | 3300004081 | Soil | PEKLPPMPVETLEFLLLLSGWVVAFLLGRELQTGFRQWRLHSATQRAASREDQRS* |
| Ga0062590_1025760553 | 3300004157 | Soil | MPLETLEFVLLLSGWVVAFLLGRELQNGFRQWRLRTVEQRARNDD* |
| Ga0063356_1027894731 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MELSMPVETVQFALLLGGWIVAFLLGKELQTGFRLWRAKTAEQRARDE* |
| Ga0063356_1039894502 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPVETLEFILLLSGWVVAFLLGRELQVGFRQWRVRVAEQRTRRE* |
| Ga0062595_1025318102 | 3300004479 | Soil | MPLETLEFVLLLSGWVVAFLLGRELQNGFRQWRLRTVEQRAR |
| Ga0066395_103642932 | 3300004633 | Tropical Forest Soil | MSVETLEFFLLLIGWVVAFLLGRELQSGYRQWRLKAAEQRAT |
| Ga0066395_106744462 | 3300004633 | Tropical Forest Soil | MSVETVEFVLLLSGWVVAFLLGRELQTGFRQWRLRAAEQRTRRQD* |
| Ga0066672_108401362 | 3300005167 | Soil | MPLMSPETLEFLLLLSGWIVAFLLGRELQIGFRQWRLRTADQRTRRPD* |
| Ga0066680_108509271 | 3300005174 | Soil | MSPETLEFLLLLSGWIVAFLLGRELQIGFRQWRLRTAEQRTRRPD* |
| Ga0066679_105115792 | 3300005176 | Soil | MSVETLEFLLLLSGWIVAFLLGRELQTGFRQWRMRTSDQRARRHD* |
| Ga0066690_102108693 | 3300005177 | Soil | MSSETLEFILLLSGWIVTFLLGRELLTGIRQVRLRLAEQRARRED* |
| Ga0066690_103663742 | 3300005177 | Soil | MSPETLEFLLLLSGWIVAFLLGRELQIGFRQWRLRTADQRTRRPD* |
| Ga0066684_103029752 | 3300005179 | Soil | MSVETLEFLLLLSGWIVAFLLGRELQTGFRQWRMRTSDERARRQD* |
| Ga0066684_105807482 | 3300005179 | Soil | MPAETLEFLLLLSGWIVAFLLGRELQAGFRQWRLRAAEQRTRRPD* |
| Ga0066685_107928933 | 3300005180 | Soil | LEFLLLLSGWVVAFLLGRELQIGFHQWRVRTAEQRPPRKDR* |
| Ga0070669_1011744742 | 3300005353 | Switchgrass Rhizosphere | MPVETLEFVLLLSGWVVAFLLGRELQIGFRQWRLRTAEQRARNDD* |
| Ga0070714_1016016171 | 3300005435 | Agricultural Soil | MSVETLEFLLLLGGWIVAFLLGRELQTGYRQWRLRVAEERTRRDA* |
| Ga0070710_106928532 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFETVEFLLLLSGWVVAFLLGRELQTGFRQWRLRAAEQRAETRRD* |
| Ga0070708_1002261112 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAETLEFLLLLSGWVVAFLLGRELQTGFRLWRLRTAEQRARSRQD* |
| Ga0066689_100232508 | 3300005447 | Soil | MPLMSPETLEFLLLLSSWIVAFLLGRELQIGFRQWRLRTAEQRTRRPD* |
| Ga0066687_103091014 | 3300005454 | Soil | LEKPLMSPETLEFLLLLSGWIVTFLLGRELLTGIRQVRMRLAEQRARRED* |
| Ga0070706_1002113192 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVETLEFLLLLSGWIVAFLLGRELQTGYRQWRLKVAEQRAPRDD* |
| Ga0070706_1021317512 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVETLEFLLLLSGWVVAFLLGRELQIGFREWRLRAAEQRTRRQD* |
| Ga0070698_1000937556 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAETLEFLLLLSGWIVAFLLGRELQTGFRQWRLRTAEQRTRRQD* |
| Ga0070699_1007247742 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAETLEFLLLLSGWVVAFLLGRELQTGFRQWRLKTAEQRARSRRD* |
| Ga0070734_104476361 | 3300005533 | Surface Soil | MSFETLEFMLLLSGWVIVFLLGRELQTGFRQWRLKTAEQRAVTRRD* |
| Ga0070735_101141282 | 3300005534 | Surface Soil | MSVETLEFLLLLSGWIVAFLLGRELQTGYRLWRLRGAEQRTQRNDVRR* |
| Ga0070730_100451702 | 3300005537 | Surface Soil | MPAETLEFLLLLSGWIVAFLLGRELQTGFRQWRLKTAEQRTRRQD* |
| Ga0070730_100472011 | 3300005537 | Surface Soil | MSVETLEFLLLLGGWIVAFLLGRELQTGYRLWRLRVAEERIRRDS* |
| Ga0070730_103452783 | 3300005537 | Surface Soil | MPTETLEFLLLLGGWVVAFLLGRELQTGFRLWRVRTAEQRRKDR* |
| Ga0070732_100210632 | 3300005542 | Surface Soil | MSVETLEFLLLLSGWIVAFLLGRELQTGYRLWRLRGAEQRSPRRDT* |
| Ga0066661_102863661 | 3300005554 | Soil | PETLEFLLLLSGWIVAFLLGRELQIGFRQWRLRTAEQRTRRPD* |
| Ga0066700_111161492 | 3300005559 | Soil | MPTETLEFVLLLTGWVVAFLLGRELQTGFRQWRMKTAEQRARRDN* |
| Ga0066699_109443151 | 3300005561 | Soil | MSLETLEFLLLLSGWIVAFLLGRELQTGFRQWRLRTV |
| Ga0066702_102634792 | 3300005575 | Soil | MSPETLEFLLLLSGWIVTFLLGRELLTGIGQVRLRLAEQRARRED* |
| Ga0066706_100479067 | 3300005598 | Soil | MPLMSPETLEFLLLLSGWIVAFLLGRELQIGFRQWRLRTAEQRTRRPD* |
| Ga0068856_1011049804 | 3300005614 | Corn Rhizosphere | MPTETLQFLLLLGGWVVAFLLGRELQTGFRLWRLRTAEQRRKDR* |
| Ga0066903_1000203924 | 3300005764 | Tropical Forest Soil | MSPETLEFLLLLSGWIVVFLLGRELQTGIRQWRLRLAEQRARRQD* |
| Ga0066903_1005111962 | 3300005764 | Tropical Forest Soil | MSVETLEFLLLLSGWVVAFLLGRELQTGYRLWRLKTAEQRARRDS* |
| Ga0066903_1018645442 | 3300005764 | Tropical Forest Soil | MSVETLEFFLLLIGWVVAFLLGRELQSGYRQWRLKAAEQRATTRRD* |
| Ga0066903_1027947512 | 3300005764 | Tropical Forest Soil | MSVETLEFLLLLSGWIVAFLLGRELQAGYRLWRVRIDEQRPPRRDR* |
| Ga0066903_1079457342 | 3300005764 | Tropical Forest Soil | MPVETIEFLLLLSGWVVAFLLGKELQTGFRIWRTRAAEERSTDRDQAPKI* |
| Ga0066696_104916973 | 3300006032 | Soil | MSPETLEFLLLLSGWIVTFLLSRELLTGIRQVRMRLAEQRARRED* |
| Ga0068871_1008820012 | 3300006358 | Miscanthus Rhizosphere | MPVETLEFVLLLSGWVIAFLLGRELQTAFRQWRLRTAEQRARTDD* |
| Ga0066665_105120424 | 3300006796 | Soil | DDLEMPLMSPETLEFLLLLSGWIVAFLLGRELQIGFRQWRLRTAEQRTRRPD* |
| Ga0066660_106470423 | 3300006800 | Soil | MSLETLEFLLLLSGWIVAFLLGRELQTGFRQWRLRTVEQRPRRED* |
| Ga0066660_112014231 | 3300006800 | Soil | LLSGWIVAFLLGRELQTGFRQWRLRAAEQRTRRPD* |
| Ga0075425_1011345161 | 3300006854 | Populus Rhizosphere | MSPETLEFLLLLSGWIVAFMLGRELQIGFRQWRLRAAEQRTRRQD* |
| Ga0075436_1006089504 | 3300006914 | Populus Rhizosphere | RCRLMSVETLEFLLLLSGWIVAFLLGRELQTGYRQWRMKTAEQRADQRPHRQD* |
| Ga0066710_1009433352 | 3300009012 | Grasslands Soil | MPAETLEFLLLLSGWVVAFLLGRELQTGFRQWRLRTAEQRARSRQD |
| Ga0066710_1012423232 | 3300009012 | Grasslands Soil | MEVPLVSVETLEFLLLLSGWIVAFLLGRELQTGYRQWRIKVAEQQTDQRPNRRD |
| Ga0066710_1015981862 | 3300009012 | Grasslands Soil | MPAETLEFLLLLSGWIVAFLLGRELQAGFRQWRLRAAEQRTRRPD |
| Ga0066710_1020841842 | 3300009012 | Grasslands Soil | MSPETLEFLLLLSGWIVAFLLGRELQIGFRQWRLRTA |
| Ga0099830_108211502 | 3300009088 | Vadose Zone Soil | MPAETLEFLLLLSGWIVAFLLGRELQTGFRQWRLRTAEQRARRQD* |
| Ga0099828_114803322 | 3300009089 | Vadose Zone Soil | MPAETLEFLLLLSGWIVAFLLGRELQTGFRQWRLRTAEQRSRRQD* |
| Ga0099827_107634282 | 3300009090 | Vadose Zone Soil | MPAETLEFLLLLSGWVVAFLLGRELQTGFRQWRLRLAEQRARSRQD* |
| Ga0099827_118741172 | 3300009090 | Vadose Zone Soil | MPAETLEFLLLLSGWIVAFLLGRELQTGFRLWRLRTAEQRARSRQD* |
| Ga0111539_134425531 | 3300009094 | Populus Rhizosphere | MPVETLEFVLLLSGWVVAFLLGRELQSGFRQWRLRTAEQRARIDD* |
| Ga0105245_119315522 | 3300009098 | Miscanthus Rhizosphere | MPVETLEFLLLLSGWIVAFLLGRELQTGFRLWRLRTAEQRVRRED* |
| Ga0105245_132889573 | 3300009098 | Miscanthus Rhizosphere | MPIELLEFVLLLTGWVVAFLLGRELQTGFREWRLRTAEQNQPNKER* |
| Ga0075418_116354082 | 3300009100 | Populus Rhizosphere | MMPVETLEFVLLLSGWVVAFLLGRELQSGFRQWRLRTAEQRARIDD* |
| Ga0105247_115423671 | 3300009101 | Switchgrass Rhizosphere | MPTETLEFLLLLGGWVVAFLLGRELQTGFRQWRLRTADQRRKDR* |
| Ga0066709_1011552821 | 3300009137 | Grasslands Soil | MQVETLEFLLLLSGWVVAFWLGRELQIGFRQWRLRGGEQRTRGPD* |
| Ga0066709_1012660091 | 3300009137 | Grasslands Soil | MPVETLEFLLLLSGWIVAFLLGRELQTGFRLWRLRTAEQRSRRQD* |
| Ga0066709_1014097301 | 3300009137 | Grasslands Soil | LMSPETLEFLLLLSGWIVAFLLGRELQIGFRQWRLRTAEQRTRRPD* |
| Ga0066709_1016749362 | 3300009137 | Grasslands Soil | MPAETLEFLLLLSGWVVAFLLGRELQTGFRQWRLRTAEQRARSRQD* |
| Ga0066709_1021912772 | 3300009137 | Grasslands Soil | MSPETLEFVLLLSGWVVAFLLGRELQTGFRQWRLRTAEQRARRQD* |
| Ga0066709_1030318361 | 3300009137 | Grasslands Soil | MSPETLEFLLLLSGWIVTFLLSRELLTGIRQVRMRLAEQ |
| Ga0066709_1030850964 | 3300009137 | Grasslands Soil | MPAETLEFLLLFSGWIVAFLLGRELQAGFRQWRLRAAEQRTRRPD* |
| Ga0114129_103286306 | 3300009147 | Populus Rhizosphere | MMPVETLEFVLLLSGWVVAFLLGRELQTGFRQWRMRTAEQRARTED* |
| Ga0114129_121313552 | 3300009147 | Populus Rhizosphere | MSVETLEFVLLLSGWVVAFLLGRELQTGFRQWRLRTAEQRTRRPE* |
| Ga0105248_105702992 | 3300009177 | Switchgrass Rhizosphere | MSTMPVETLEFVLLLSGWVIAFLLGRELQTAFRQWRLRTAEQRARTDD* |
| Ga0126305_106563692 | 3300010036 | Serpentine Soil | MPPETLEFVLLLSGWIVAFLLGRELQVGFRRWRMRAAEQRTRRDD* |
| Ga0126304_105829021 | 3300010037 | Serpentine Soil | MPPETLEFVLLLSGWIVAFLLGRELQVGFRKWRMRAAEQRARRERRLRLG* |
| Ga0126315_102747291 | 3300010038 | Serpentine Soil | MSVETVEFVLLLSGWVVAFLLGRELQTGFRQWRLRAAEQRSRRPD* |
| Ga0126384_121943343 | 3300010046 | Tropical Forest Soil | MPVETLEFLLLLSGWVVAFLLGRELQSGFRQWRLRVVDQRARRED* |
| Ga0126318_109204382 | 3300010152 | Soil | MPVETIEFLLLLSGWIVAFLLGKELQTGFRVWRTRAAEQRADRER* |
| Ga0126318_109871003 | 3300010152 | Soil | MSVETLEFLLLLSGWIVAFLLGRELQTGYRLWRLRGAEQRASSRRDG* |
| Ga0127503_113169781 | 3300010154 | Soil | LEFLLLLSGWVVAFLLGRELQSGFRQWRLHVATQRAARREDQGS* |
| Ga0126306_116778732 | 3300010166 | Serpentine Soil | MPLETLEFILLLSGWIVAFLLGRELQMGFRQWRLARAEQRTRRND* |
| Ga0134071_107825061 | 3300010336 | Grasslands Soil | MSVETLEFLLLLSGWIVAFLLGRELQTGYRLWRVRTAEQQTDQRPNRRD* |
| Ga0126370_122134342 | 3300010358 | Tropical Forest Soil | MPVETLEFLLLLSGWVVAFLLGRELQTGFRQWRLRTVEQRVRREE* |
| Ga0126376_125146671 | 3300010359 | Tropical Forest Soil | MPVETLEFLLLLSGWVVAFLLGRELQTGFRQWRMRTADQRARRED* |
| Ga0126376_126457361 | 3300010359 | Tropical Forest Soil | MSVETLEFFLLLVGWVIAFLLGRELQSGYRQWRLKVAEQRVTTRRDR* |
| Ga0126378_111855042 | 3300010361 | Tropical Forest Soil | MHMSVETVEFVLLLGGWVVAFLLGRELQTGFRQWRMRTAEQRTRRQD* |
| Ga0126377_102883801 | 3300010362 | Tropical Forest Soil | MSVETLEFFLLLIGWVVAFLLGRELQSGYRQWRLKAAEQRATTR |
| Ga0126379_112955672 | 3300010366 | Tropical Forest Soil | MSVETFEFVLLLSGWIVIFLLGRELRTGYVQWRIYQADQRARRDD* |
| Ga0134125_128951791 | 3300010371 | Terrestrial Soil | MPVETLEFVLLLTGWVVAFLLGRELQTGFRQWRLRTAEQRARIDD* |
| Ga0126381_1042739283 | 3300010376 | Tropical Forest Soil | MSVETLEFFLLLGGWVVAFLLGRELQSGYRRWRLKAAEQRAITRRDR* |
| Ga0126383_123822312 | 3300010398 | Tropical Forest Soil | MTVETLEFLLLLSGWIVAFLLGSELQTGYRQWRLKTA |
| Ga0137392_111792891 | 3300011269 | Vadose Zone Soil | MPAETLEFLLLLSGWVVAFLLGRELQTGYRLWRLRTAEQRARSRQD* |
| Ga0137391_101094992 | 3300011270 | Vadose Zone Soil | MPAETLEFLLLLSGWVVAFLLGRELQTGFRLWRLKTAEQRARSRQD* |
| Ga0120139_12047313 | 3300012019 | Permafrost | LEFLLLLGGWVVAFLLGRELQTGFREWRLRTAEQRRKDR* |
| Ga0137389_103617242 | 3300012096 | Vadose Zone Soil | MPAETLEFLLLLSGWIVAFLLGRELQTGFRQWRLRTAEQRTRRPD* |
| Ga0137389_115089001 | 3300012096 | Vadose Zone Soil | ETRRLPLMPAATLEFLLLLSGWIVAFLLGRELQTGFRLWRLRTAEQRARSRQD* |
| Ga0137383_104263302 | 3300012199 | Vadose Zone Soil | MPVETLEFLLLLSGWVVAFLLGRELQTGFHQWRVRTAEQRPPRKDR* |
| Ga0137383_112075272 | 3300012199 | Vadose Zone Soil | MPAETLEFLLLLSGWVVAFLLGRELQTGFRLWRLKTAEQRARSRPD* |
| Ga0137374_100433722 | 3300012204 | Vadose Zone Soil | MSESVLMSPETLEFVLLLSGWVVAFLLGRELQTGFRQWRLRTAEQRARRQD* |
| Ga0137374_101727973 | 3300012204 | Vadose Zone Soil | MMPVETLEFVLLLSGWVVAFLLGRELQTGFRQWRMRTAEQRARTDD* |
| Ga0137381_111180514 | 3300012207 | Vadose Zone Soil | LMPVETLEFLLLLSGWVVAFLLGRELQIGFREWRLRAAEQRTRRPD* |
| Ga0137376_108920172 | 3300012208 | Vadose Zone Soil | MPAETLEFLLLLSGWVVAFLLGRELQTGFRLWRLRTAEQRARSRTD* |
| Ga0137379_101759212 | 3300012209 | Vadose Zone Soil | MSVETLEFLLLLSGWIVAFLLGRELQTGYRQWRLRTAEQRARQED* |
| Ga0137379_104402132 | 3300012209 | Vadose Zone Soil | MPVETLEFLLLLSGWVVAFLLGRELQIGFRQWRLRAAEQRTRRPD* |
| Ga0137379_115962081 | 3300012209 | Vadose Zone Soil | MPIETLEFLLLLSGWVVAFLLGRELQIGFREWRLRAAEQ |
| Ga0137377_113909711 | 3300012211 | Vadose Zone Soil | MPVETLEFVLLLSGWVVAFLLGRELQIGFREWRLRAAEQRTRRQD* |
| Ga0150985_1115346931 | 3300012212 | Avena Fatua Rhizosphere | MPVETLEFLLLLSGWVVAFLLGRELQTGFRQWRLHSATQRAASREDQRS* |
| Ga0150985_1116677923 | 3300012212 | Avena Fatua Rhizosphere | METLEFVLLLGGWVVAFLMGRELQTGFRQWRLRTVEQRINRHD* |
| Ga0150985_1191639153 | 3300012212 | Avena Fatua Rhizosphere | MSVETLEFLLLLSGWIVAFLLGRELQSGYRLWRLKTAEERPRRDS* |
| Ga0150985_1203578612 | 3300012212 | Avena Fatua Rhizosphere | MPVETLEFLLLLSGWVVAFLLGRELQTGYRQWRQIRAAATQRAPQRED* |
| Ga0150985_1226033592 | 3300012212 | Avena Fatua Rhizosphere | MSVETLEFVLLLGGWVVAFLLGRELQTGFRLWRLRAADQRTTRRPD |
| Ga0137372_110826123 | 3300012350 | Vadose Zone Soil | ETLEFVLLLSGWVVAFLLGRELQTGFRQWRMRTAEQRARTDD* |
| Ga0137368_102650593 | 3300012358 | Vadose Zone Soil | MARPSIGVLMMPVETLEFVLLLSGWVVAFLLGRELQTGFRQWRMRTAEQRARTDD* |
| Ga0137385_115675651 | 3300012359 | Vadose Zone Soil | LRDAPNDLEKPLISPEILEFLLLLSGWVVAFLLGRELQTGVRQWRLRLAEQRARRED* |
| Ga0137390_106228182 | 3300012363 | Vadose Zone Soil | MPVETLEFLLLLSGWVVAFLLGRELQIGFREWRLRAAGQRTRRPD* |
| Ga0150984_1099465803 | 3300012469 | Avena Fatua Rhizosphere | METLEFVLLLSGWVVAFLMGRELQSGFRQWRLRTAEQRARGDD* |
| Ga0150984_1120388101 | 3300012469 | Avena Fatua Rhizosphere | LEFVLLLGGWVVAFLMGRELQTGFRQWRLRTVEQRINRQD* |
| Ga0150984_1228342151 | 3300012469 | Avena Fatua Rhizosphere | MPVETLEFLLLLSGWVVAFLLGRELQTGFRQWRLHSAIQRAASREDQRS* |
| Ga0137416_115878881 | 3300012927 | Vadose Zone Soil | MPAETLEFLLLLSGWVVAFLLGRELQTGFRLWRLRLA |
| Ga0137416_116227781 | 3300012927 | Vadose Zone Soil | MPAETLEFLLLLSGWVVAFLLGRELQTGYRLWRLRLAEQRARSRQD* |
| Ga0137410_114386911 | 3300012944 | Vadose Zone Soil | RYLEPPPLPALGRFPLIPAETLEFLLLLSGWVVAFLLGRELQTGFRLWRLKTAEQRARSRQD* |
| Ga0126369_113217382 | 3300012971 | Tropical Forest Soil | MSVETLEFLLLLSGWVVAFLLGRELQAGYRMWRLKTAEQRARRDS* |
| Ga0126369_130657171 | 3300012971 | Tropical Forest Soil | MSVETLEFLLLLSGWIVAFLLGRELQTGYRRWRLRVAEQRMTRRDR* |
| Ga0157378_117067262 | 3300013297 | Miscanthus Rhizosphere | MPIEILEFVLLLTGWVVAFLLGRELQTGFREWRLRTAEQNQPNKER* |
| Ga0157375_113853412 | 3300013308 | Miscanthus Rhizosphere | MPVETLEFVLLLSGWVVAFLLGRELQTGFRQWRLRTAEQRARIDD* |
| Ga0120155_10831953 | 3300013768 | Permafrost | MPIETLEFLLLLGGWVVAFLLGRELQIGFCLWRVSTAEQRRR* |
| Ga0120123_10910684 | 3300013770 | Permafrost | LLGGWVVAFLLGRELQTGFRQWRLRTAEQRLPRKDR* |
| Ga0120126_10326231 | 3300013831 | Permafrost | MPTETLEFLLLLGGWVVAFLLGRELQTGFREWRLRTAEQRRKDR* |
| Ga0163163_112472542 | 3300014325 | Switchgrass Rhizosphere | MSVETVEFMLLLGGWVVAFLLGRELQTGYRQWRLRTAEQRARNDQ* |
| Ga0132258_104398784 | 3300015371 | Arabidopsis Rhizosphere | MARLPASEKLAMSMETLEFVLLLSGWVVAFLLGRELQNGFRQWRMRTAEQRARNDD* |
| Ga0132257_1032001863 | 3300015373 | Arabidopsis Rhizosphere | MPTETVEFLLLLSGWVVAFLLGRELQSGFRQWRLRGAEQRINPRRDS* |
| Ga0066662_100576097 | 3300018468 | Grasslands Soil | MPFETIEFLLLLSGWVVAFLLGKELQTGFRQWRTRAAEERIPRDEA |
| Ga0066662_103450002 | 3300018468 | Grasslands Soil | MSPETLEFLLLLSGWIVTFLLSRELLTGIRQVRMRLAEQRARRED |
| Ga0066662_122671801 | 3300018468 | Grasslands Soil | MSPETLEFLLLLSGWIVAFLLGRELQIGFRQWRLRTADQRTRRPD |
| Ga0066669_117863521 | 3300018482 | Grasslands Soil | MPAETLEFLLLLSGWVVAFLLGRELQTGFRLWRLKTAEQRARSRQD |
| Ga0213873_100866712 | 3300021358 | Rhizosphere | MPTDMLEFVLLLSGWVVAFLLGRELQTGFRLWRLKTAEQRTRRQD |
| Ga0213882_100520074 | 3300021362 | Exposed Rock | MPVETVEFFLLLSGWIVAFLLGLELQTGYRQWRLRGAEQRIETRRD |
| Ga0213882_102010302 | 3300021362 | Exposed Rock | MSVDTLEFLLLLSGWIVAFLLGRELQTGYRLWRLRAAEQRPRRDS |
| Ga0213876_101986561 | 3300021384 | Plant Roots | MPTETMEFVLLLTGWVVAFLLGRELQTGFRQWRLRTAEQRARRDD |
| Ga0213876_103352711 | 3300021384 | Plant Roots | EFVLLLSGWVVAFLLGRELQTGFRLWRLKTAEQRTRRQD |
| Ga0213876_106350942 | 3300021384 | Plant Roots | MSFETLEFMLLLSGWVTVFLLGRELQTGFRQWRLKAAEQRAVTRRD |
| Ga0126371_112549052 | 3300021560 | Tropical Forest Soil | MSVETVEFVLLLSGWVVAFLLGRELQTGFRQWRLRAAEQRTRRQD |
| Ga0207684_104507101 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVETLEFLLLLSGWIVAFLLGRELQTGYRQWRLKVAEQRAPRDD |
| Ga0207684_113242282 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAETLEFLLLLSGWVVAFLLGRELQTGFRLWRLRTAEQRARSRQD |
| Ga0207684_115860492 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVETLEFLLLLSGWVVAFLLGRELQIGFREWRLRAAEQRTRRQD |
| Ga0207646_105791475 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLLSGWVVAFLLGRELQTGFRLWRLRTAEQRARSRQD |
| Ga0207646_114695742 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVETLEFLLLLSGWVVAFLLGRELQTGFHQWRVRTAEQRPPRKDR |
| Ga0207700_114281122 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFETVEFLLLLSGWVVAFLLGRELQTGFRQWRLRAAEQRAETRRD |
| Ga0207711_103989072 | 3300025941 | Switchgrass Rhizosphere | MPVETLEFVLLLSGWVIAFLLGRELQTAFRQGRLRTAEQRARTDD |
| Ga0207702_107350683 | 3300026078 | Corn Rhizosphere | MPTETLQFLLLLGGWVVAFLLGRELQTGFRLWRLRTAEQRRKDR |
| Ga0209161_102105362 | 3300026548 | Soil | MPLMSPETLEFLLLLSGWIVAFLLGRELQIGFRQWRLRTAEQRTRRPD |
| Ga0209689_10460087 | 3300027748 | Soil | MPLMSPETLEFLLLLSGWIVAFLLGRELQIGFRQWRLRTADQRTRRPD |
| Ga0209166_100367198 | 3300027857 | Surface Soil | MSVETLEFLLLLGGWIVAFLLGRELQTGYRLWRLRVAEERIRRDS |
| Ga0209166_103727881 | 3300027857 | Surface Soil | MPTETLEFLLLLGGWVVAFLLGRELQTGFRLWRVRTAEQ |
| Ga0209166_106113063 | 3300027857 | Surface Soil | MPVETLEFLLLLGGWIVAFLLGRELQTGYRQWRLRTAEQRARRQD |
| Ga0209590_102089562 | 3300027882 | Vadose Zone Soil | MPAETLEFLLLLSGWVVAFLLGRELQTGFRQWRLRLAEQRARSRQD |
| Ga0209168_101627982 | 3300027986 | Surface Soil | MSVETLEFLLLLSGWIVAFLLGRELQTGYRLWRLRGAEQRTQRNDVRR |
| Ga0137415_102090312 | 3300028536 | Vadose Zone Soil | MPAETLEFLLLLSGWVVAFLLGRELQTGFRLWRLRLAEQRARGRQD |
| Ga0307479_112045544 | 3300031962 | Hardwood Forest Soil | RIPRLYSPALMSVETLEFLLLLSGWIVAFLLGRELQTGYRLWRLRTAEQRARRQD |
| Ga0306920_1028224422 | 3300032261 | Soil | MSVETLEFLLLLSGWIVAFLLGRELQTGYRLWRLRVAEQRTPRRDR |
| Ga0372946_0080242_436_573 | 3300034384 | Soil | MPVETLQFLLLLSGWVVAFLLGRELQTGFREWRLRTAEQRARRPE |
| ⦗Top⦘ |