| Basic Information | |
|---|---|
| Family ID | F040629 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 161 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MNKYSIKIEINAEVEAFNEDDAKEYISDIFGIDDEIKSVKIINIKEK |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 9.27 % |
| % of genes near scaffold ends (potentially truncated) | 14.29 % |
| % of genes from short scaffolds (< 2000 bps) | 52.17 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (45.963 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (14.907 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.963 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (64.596 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.00% β-sheet: 0.00% Coil/Unstructured: 84.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF05257 | CHAP | 27.95 |
| PF02467 | Whib | 22.98 |
| PF00255 | GSHPx | 13.04 |
| PF13640 | 2OG-FeII_Oxy_3 | 4.97 |
| PF00085 | Thioredoxin | 3.73 |
| PF00106 | adh_short | 1.86 |
| PF07691 | PA14 | 1.24 |
| PF00082 | Peptidase_S8 | 1.24 |
| PF05099 | TerB | 0.62 |
| PF00166 | Cpn10 | 0.62 |
| PF09834 | DUF2061 | 0.62 |
| PF04886 | PT | 0.62 |
| PF12849 | PBP_like_2 | 0.62 |
| PF00296 | Bac_luciferase | 0.62 |
| PF02075 | RuvC | 0.62 |
| PF03796 | DnaB_C | 0.62 |
| PF01521 | Fe-S_biosyn | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 13.04 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.62 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 0.62 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.62 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.62 |
| COG3793 | Tellurite resistance protein TerB | Inorganic ion transport and metabolism [P] | 0.62 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.88 % |
| Unclassified | root | N/A | 21.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352004|2199913410 | Not Available | 2490 | Open in IMG/M |
| 3300000756|JGI12421J11937_10006023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 4774 | Open in IMG/M |
| 3300001255|B570J13889_100001 | Not Available | 72296 | Open in IMG/M |
| 3300001851|RCM31_10173549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1192 | Open in IMG/M |
| 3300001953|GOS2231_1007954 | All Organisms → cellular organisms → Bacteria | 1905 | Open in IMG/M |
| 3300002203|metazooDRAFT_1310006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
| 3300002447|JGI24768J34885_10185314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 704 | Open in IMG/M |
| 3300002835|B570J40625_100027392 | Not Available | 9179 | Open in IMG/M |
| 3300002835|B570J40625_100036930 | Not Available | 7419 | Open in IMG/M |
| 3300002835|B570J40625_100050333 | All Organisms → cellular organisms → Bacteria | 5947 | Open in IMG/M |
| 3300002835|B570J40625_100080095 | All Organisms → cellular organisms → Bacteria | 4231 | Open in IMG/M |
| 3300002835|B570J40625_100088751 | All Organisms → cellular organisms → Bacteria | 3920 | Open in IMG/M |
| 3300002835|B570J40625_100130573 | All Organisms → cellular organisms → Bacteria | 2945 | Open in IMG/M |
| 3300002835|B570J40625_100131303 | All Organisms → cellular organisms → Bacteria | 2933 | Open in IMG/M |
| 3300002835|B570J40625_100416623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1298 | Open in IMG/M |
| 3300002835|B570J40625_101261016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
| 3300003388|JGI25910J50241_10003143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 6002 | Open in IMG/M |
| 3300003413|JGI25922J50271_10005617 | All Organisms → cellular organisms → Bacteria | 3518 | Open in IMG/M |
| 3300003430|JGI25921J50272_10003029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5467 | Open in IMG/M |
| 3300003430|JGI25921J50272_10087758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300003493|JGI25923J51411_1028812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1081 | Open in IMG/M |
| 3300003497|JGI25925J51416_10013071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2483 | Open in IMG/M |
| 3300004054|Ga0063232_10198353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300004096|Ga0066177_10197366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 824 | Open in IMG/M |
| 3300004112|Ga0065166_10005188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 3213 | Open in IMG/M |
| 3300004112|Ga0065166_10283615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 673 | Open in IMG/M |
| 3300004125|Ga0066182_10117453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300004769|Ga0007748_11390699 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300004790|Ga0007758_10198572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 680 | Open in IMG/M |
| 3300004792|Ga0007761_11250746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300005517|Ga0070374_10104091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1480 | Open in IMG/M |
| 3300005527|Ga0068876_10010425 | Not Available | 6143 | Open in IMG/M |
| 3300005528|Ga0068872_10305160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
| 3300005583|Ga0049085_10116157 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300005758|Ga0078117_1019568 | All Organisms → cellular organisms → Bacteria | 6021 | Open in IMG/M |
| 3300005805|Ga0079957_1001193 | Not Available | 23902 | Open in IMG/M |
| 3300005805|Ga0079957_1025473 | All Organisms → cellular organisms → Bacteria | 4017 | Open in IMG/M |
| 3300005805|Ga0079957_1027070 | All Organisms → cellular organisms → Bacteria | 3866 | Open in IMG/M |
| 3300005805|Ga0079957_1032625 | All Organisms → cellular organisms → Bacteria | 3424 | Open in IMG/M |
| 3300005805|Ga0079957_1085868 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
| 3300006030|Ga0075470_10000002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 119810 | Open in IMG/M |
| 3300006484|Ga0070744_10002262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 5820 | Open in IMG/M |
| 3300006641|Ga0075471_10325044 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300006875|Ga0075473_10478598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 502 | Open in IMG/M |
| 3300007171|Ga0102977_1089434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1203 | Open in IMG/M |
| 3300007171|Ga0102977_1144686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1553 | Open in IMG/M |
| 3300007363|Ga0075458_10148132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 726 | Open in IMG/M |
| 3300007541|Ga0099848_1124955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 969 | Open in IMG/M |
| 3300007545|Ga0102873_1148731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
| 3300007603|Ga0102921_1053635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1478 | Open in IMG/M |
| 3300007647|Ga0102855_1190767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300007861|Ga0105736_1018858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1246 | Open in IMG/M |
| 3300008110|Ga0114343_1018494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3144 | Open in IMG/M |
| 3300008116|Ga0114350_1011531 | All Organisms → cellular organisms → Bacteria | 6577 | Open in IMG/M |
| 3300008116|Ga0114350_1045751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1623 | Open in IMG/M |
| 3300008120|Ga0114355_1089683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1241 | Open in IMG/M |
| 3300009059|Ga0102830_1058319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1163 | Open in IMG/M |
| 3300009152|Ga0114980_10006488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 7710 | Open in IMG/M |
| 3300009155|Ga0114968_10345734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 822 | Open in IMG/M |
| 3300009159|Ga0114978_10236432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1140 | Open in IMG/M |
| 3300009419|Ga0114982_1017749 | All Organisms → cellular organisms → Bacteria | 2395 | Open in IMG/M |
| 3300010354|Ga0129333_10001820 | Not Available | 19585 | Open in IMG/M |
| 3300010354|Ga0129333_10016113 | Not Available | 7106 | Open in IMG/M |
| 3300010354|Ga0129333_10022033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6050 | Open in IMG/M |
| 3300010354|Ga0129333_10073376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 3178 | Open in IMG/M |
| 3300010354|Ga0129333_10146406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2169 | Open in IMG/M |
| 3300010354|Ga0129333_10249205 | All Organisms → Viruses → Predicted Viral | 1601 | Open in IMG/M |
| 3300010354|Ga0129333_10271291 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber | 1524 | Open in IMG/M |
| 3300010354|Ga0129333_10385365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1243 | Open in IMG/M |
| 3300010354|Ga0129333_10988777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
| 3300010354|Ga0129333_11630979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300010354|Ga0129333_11671750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300010965|Ga0138308_111262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 5347 | Open in IMG/M |
| 3300011268|Ga0151620_1001026 | Not Available | 10779 | Open in IMG/M |
| 3300012017|Ga0153801_1003142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 3204 | Open in IMG/M |
| 3300012352|Ga0157138_1052624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300012665|Ga0157210_1003223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 3824 | Open in IMG/M |
| 3300012667|Ga0157208_10004043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2501 | Open in IMG/M |
| 3300012667|Ga0157208_10030849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
| 3300012968|Ga0129337_1316390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2702 | Open in IMG/M |
| 3300012970|Ga0129338_1172746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1109 | Open in IMG/M |
| 3300013087|Ga0163212_1026831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2038 | Open in IMG/M |
| 3300013087|Ga0163212_1160519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
| 3300013092|Ga0163199_1026302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2846 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10051970 | All Organisms → cellular organisms → Bacteria | 3248 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10705808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10080411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2568 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10234159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1223 | Open in IMG/M |
| 3300013372|Ga0177922_10535867 | Not Available | 568 | Open in IMG/M |
| 3300013372|Ga0177922_11272147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 823 | Open in IMG/M |
| 3300017788|Ga0169931_10125494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2375 | Open in IMG/M |
| 3300020048|Ga0207193_1043086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 4892 | Open in IMG/M |
| 3300020048|Ga0207193_1555675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
| 3300020074|Ga0194113_10116537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2294 | Open in IMG/M |
| 3300020141|Ga0211732_1061301 | Not Available | 44174 | Open in IMG/M |
| 3300020183|Ga0194115_10165063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1135 | Open in IMG/M |
| 3300020494|Ga0208326_100044 | All Organisms → cellular organisms → Bacteria | 6712 | Open in IMG/M |
| 3300020498|Ga0208050_1000109 | Not Available | 19457 | Open in IMG/M |
| 3300020498|Ga0208050_1008199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1220 | Open in IMG/M |
| 3300020498|Ga0208050_1008287 | Not Available | 1211 | Open in IMG/M |
| 3300020498|Ga0208050_1010979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1013 | Open in IMG/M |
| 3300020524|Ga0208858_1002422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3405 | Open in IMG/M |
| 3300020529|Ga0208233_1000046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21361 | Open in IMG/M |
| 3300020570|Ga0208465_1000637 | Not Available | 8965 | Open in IMG/M |
| 3300021952|Ga0213921_1061297 | Not Available | 537 | Open in IMG/M |
| 3300021961|Ga0222714_10008157 | Not Available | 9408 | Open in IMG/M |
| 3300021961|Ga0222714_10172758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1273 | Open in IMG/M |
| 3300021961|Ga0222714_10236174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
| 3300021962|Ga0222713_10022200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 5297 | Open in IMG/M |
| 3300021963|Ga0222712_10604840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 632 | Open in IMG/M |
| 3300021963|Ga0222712_10712050 | Not Available | 564 | Open in IMG/M |
| 3300022553|Ga0212124_10266182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
| 3300022752|Ga0214917_10005478 | Not Available | 13548 | Open in IMG/M |
| 3300022752|Ga0214917_10025908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4585 | Open in IMG/M |
| 3300023184|Ga0214919_10000488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 67721 | Open in IMG/M |
| 3300023184|Ga0214919_10005984 | Not Available | 16919 | Open in IMG/M |
| 3300024289|Ga0255147_1022448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1315 | Open in IMG/M |
| 3300024343|Ga0244777_10076538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2151 | Open in IMG/M |
| 3300024348|Ga0244776_10001136 | Not Available | 29084 | Open in IMG/M |
| 3300024351|Ga0255141_1040597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
| 3300024484|Ga0256332_1077098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 712 | Open in IMG/M |
| 3300024513|Ga0255144_1024362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1044 | Open in IMG/M |
| 3300024543|Ga0256348_1069321 | Not Available | 595 | Open in IMG/M |
| 3300024572|Ga0255268_1150868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300024573|Ga0256337_1022956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1557 | Open in IMG/M |
| 3300025307|Ga0208566_1106463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
| 3300027563|Ga0209552_1138596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300027586|Ga0208966_1000003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 113953 | Open in IMG/M |
| 3300027656|Ga0209357_1057684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1192 | Open in IMG/M |
| 3300027710|Ga0209599_10013754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2395 | Open in IMG/M |
| 3300027733|Ga0209297_1098118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1258 | Open in IMG/M |
| 3300027756|Ga0209444_10289803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300027769|Ga0209770_10006481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 5494 | Open in IMG/M |
| 3300027769|Ga0209770_10189496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
| 3300027782|Ga0209500_10223952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
| 3300027793|Ga0209972_10349567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300027797|Ga0209107_10000474 | Not Available | 23387 | Open in IMG/M |
| 3300027805|Ga0209229_10265862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 761 | Open in IMG/M |
| 3300027836|Ga0209230_10008942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 4458 | Open in IMG/M |
| 3300027836|Ga0209230_10741581 | Not Available | 538 | Open in IMG/M |
| 3300028112|Ga0256335_1181728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 546 | Open in IMG/M |
| 3300031857|Ga0315909_10000120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 100927 | Open in IMG/M |
| 3300031857|Ga0315909_10821995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300031951|Ga0315904_10861592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 737 | Open in IMG/M |
| 3300032092|Ga0315905_10882845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
| 3300033816|Ga0334980_0159164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 920 | Open in IMG/M |
| 3300034013|Ga0334991_0002132 | Not Available | 16389 | Open in IMG/M |
| 3300034023|Ga0335021_0064726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2183 | Open in IMG/M |
| 3300034066|Ga0335019_0659780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 605 | Open in IMG/M |
| 3300034107|Ga0335037_0259426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 949 | Open in IMG/M |
| 3300034283|Ga0335007_0621019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 12.42% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 6.83% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.97% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.35% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.35% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.73% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.11% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 3.11% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 2.48% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.86% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.86% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.24% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.24% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.24% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.24% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.24% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.24% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.62% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.62% |
| Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.62% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.62% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.62% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001255 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300001953 | Marine microbial communities from Key West, Florida, USA - GS015 | Environmental | Open in IMG/M |
| 3300002203 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAR 2013 | Environmental | Open in IMG/M |
| 3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004790 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020494 | Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020524 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020529 | Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020537 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300024484 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300024543 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025307 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028112 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2200098867 | 2199352004 | Freshwater | MNKYSIKIEITAVIEAFNEDDARDYVNEIFGTDEEVQSVKIASIKEKK |
| JGI12421J11937_100060234 | 3300000756 | Freshwater And Sediment | MDKYSIKLEVLAEVDAFSEADAREYISDIFNVDDEIKNVKVVKISKNS* |
| B570J13889_10000167 | 3300001255 | Freshwater | VNTYIVKIEVLASVDAFSEADAKDYISDIFNVDDEIKSVKIIKIAKSS* |
| RCM31_101735494 | 3300001851 | Marine Plankton | MNIYNIKIEIDIEVEAFNEIDAREYVSEIFGTDEEVKRVKVLTVNEK* |
| GOS2231_10079543 | 3300001953 | Marine | MNKYSVQLEVSIEIDAFDENDAKDYVCDIFGTDDEIQSVKVISLKEKK* |
| metazooDRAFT_13100062 | 3300002203 | Lake | MNKYTIKLEVIAEVEAFDSDDAKDYITDIFGTDDEIKSIKIISIKEK* |
| JGI24768J34885_101853144 | 3300002447 | Freshwater And Sediment | TMNNYSIKLEVSAEVEAFSAEDARDYISDIFNXDDEIKSVKIXKISQX* |
| B570J40625_1000273926 | 3300002835 | Freshwater | MNKYSIKIEITAVIEAFNEDDARDYVNEIFGTDEEVQSVKIVSVKEKR* |
| B570J40625_10003693018 | 3300002835 | Freshwater | MNKYTVKLEVVAEVEAFDEDDAKDYITDIFGTDDEIKSIKITSIKEK* |
| B570J40625_1000503332 | 3300002835 | Freshwater | MNKYLIKLEISAEVEAFDENDAKEYISDIFGTDDEVKSVKISSIRVKGEKK* |
| B570J40625_1000800958 | 3300002835 | Freshwater | MNKYLIKLVIAAEVEAFDENDARDYISDIFGIDDEVRKVNIESVKLIKEKK* |
| B570J40625_1000887512 | 3300002835 | Freshwater | MNKYLIKLEISAEVEAFDENDAKEYISDIFGTDDEVKSVRISSIRVKGEKK* |
| B570J40625_1001305737 | 3300002835 | Freshwater | MKKYSIKIEIDAVVEAFSSEDAKEYISDIFGVDEEIVSVKIKKIEER* |
| B570J40625_1001313032 | 3300002835 | Freshwater | MNKYSIKIEITAVIEAFNEDDARDYVNEIFGTDEEVQSVKIASIKEKK* |
| B570J40625_1004166235 | 3300002835 | Freshwater | MNKYSIKLEINAEVEAFSEDDAREYISDIFGTDEEIKSVKVVNIKEK* |
| B570J40625_1012610162 | 3300002835 | Freshwater | MKKYSIKIEIDAVVEAFSPEDAKEYVSDIFGTDEEIISVKIKKIEEK* |
| JGI25910J50241_1000314315 | 3300003388 | Freshwater Lake | MEIKAEVEAFNEEDAREYISDIFGIDEEIKSIKVISIQKKS* |
| JGI25922J50271_100056178 | 3300003413 | Freshwater Lake | MNKYLIKLEISAEVEAFDENDAKEYISDVFGTDDEVKSVKISSIKIKGDKK* |
| JGI25921J50272_100030294 | 3300003430 | Freshwater Lake | MXKYSXKIEITAEVEAFDEEDAKEYVSDIFGVDDEVKSVKILTVKQKS* |
| JGI25921J50272_100877582 | 3300003430 | Freshwater Lake | MDKYTIKLEISAEVDAFSEADAKEYISDIFNVDDEIKSVKVIKVSKK* |
| JGI25923J51411_10288121 | 3300003493 | Freshwater Lake | YLIKLEISAEVEAFDENDAKEYISDVFGTDDEVKSVKIASIKIKGDKK* |
| JGI25925J51416_100130711 | 3300003497 | Freshwater Lake | LEISAEVEAFDENDAKEYISDVFGTDDEVKSVKIASIKIKGDKK* |
| Ga0063232_101983533 | 3300004054 | Freshwater Lake | MNNYSIKLEVSAEVEAFSAEDARDYISDIFNIDDEIKSVKIIKISQK* |
| Ga0066177_101950031 | 3300004096 | Freshwater Lake | MNKYSSKIEITAVIEAFNEDDARDYVNEIFGTDEEVQSVKIVSVKEKR* |
| Ga0066177_101973662 | 3300004096 | Freshwater Lake | IKLEISAEVEAFDENDAKEYISDVFGTDDEVKSVKIASIKIKGDKK* |
| Ga0065166_100051889 | 3300004112 | Freshwater Lake | MNKYSIKIEITAEVEAFDEEDAKEYVSDIFGVDDEVKSVKILTVKQKS* |
| Ga0065166_102836152 | 3300004112 | Freshwater Lake | MDKYSIKLEVLAEVDAFSEADAREYISDIFNVDDEIKAVKVIKISKNS* |
| Ga0066182_101174532 | 3300004125 | Freshwater Lake | MDKYSIKLEVLAEVEAFSEADAREYISDIFNIDDEIKGVKVIKVTKNS* |
| Ga0007748_113906992 | 3300004769 | Freshwater Lake | MNKYLIKLEISAEVEAFDENDAKEYISDVFGTDDEVKSVKIASIKIKGDKK* |
| Ga0007758_101985722 | 3300004790 | Freshwater Lake | KYLIKLEISAEVEAFDENDAKEYISDVFGTDDEVKSVKIASIKIKGDKK* |
| Ga0007761_112507462 | 3300004792 | Freshwater Lake | MDKYSIKLEVLAEVEAFSEADAREYISDIFNIDDEIKNVKVIKVTKNS* |
| Ga0070374_101040912 | 3300005517 | Freshwater Lake | MDKYSIKLEVLAEVEAFSEADAREYISDIFNIDDEIKSVKVIKVTKNS* |
| Ga0068876_100104256 | 3300005527 | Freshwater Lake | MNQYSVKIEVLATVDAFSEDDAKDYISDIFNVDDEIKSVKIIKVSKNS* |
| Ga0068872_103051602 | 3300005528 | Freshwater Lake | MNKYTIKLEVVAEVEAFDSDDAKDYITDIFGTDDEIKSIKITSIKEK* |
| Ga0049085_101161572 | 3300005583 | Freshwater Lentic | VNKYSISIAITAEVEAFDENDAMDYISDIFGIDDEIKSVKIVRIVKK* |
| Ga0078117_10195687 | 3300005758 | Lake Water | MNKYSIKLEINAEVEAFSEDDAKEYISDIFGIDDEIKSVKIVNIKKNS* |
| Ga0079957_100119341 | 3300005805 | Lake | MNKYKVQLEVLLEVEAFDSEDAKDYVNDIFGIDEEVKSIKIVNIKEK* |
| Ga0079957_10254734 | 3300005805 | Lake | MNKYTVKLEVLAEVEAFDEDDARDYINDIFGTDDEIRSIKIVNLKEKQEKS* |
| Ga0079957_10270708 | 3300005805 | Lake | MNKYTIKIEVTADIEAFDEDDAKDYIGDIFGIDEEIKSVKIINVKEK* |
| Ga0079957_10326257 | 3300005805 | Lake | MNKYTVKLEVVAEVEAFDADDAKDYITDIFGTDDEIKSIKITSIKEK* |
| Ga0079957_10858684 | 3300005805 | Lake | MNIYSIKLEINAEVEAFNEEDAREYISDIFGIDEEIKSVKVINIKEK* |
| Ga0075470_1000000281 | 3300006030 | Aqueous | MNKYSIKIEINAEVEAFSEDDAKEYVSDIFGIDDEIKSVKIVKIKEK* |
| Ga0070744_1000226215 | 3300006484 | Estuarine | MDKYSIKLEVLAEVDAFSEADAREYISDIFNVDDEIKSVKVLKISKNS* |
| Ga0070744_101609362 | 3300006484 | Estuarine | MNKYSIKIEISAVIEAFNEDDARDYVNEIFGTDEEVQSVKIVSVKEKR* |
| Ga0075471_103250442 | 3300006641 | Aqueous | MNKYTVQLEVLLEVEAFDADDARDYVNDIFGTDDEIKSIKVIKLKEK* |
| Ga0075473_104785982 | 3300006875 | Aqueous | MMNKYTVQLEVLLEVEAFDADDAKDYVNDIFGTDDEIKSIKVIKIKEK* |
| Ga0102977_10894342 | 3300007171 | Freshwater Lake | MNKYSVKLEVSAEVEAFDEDDARDYLNDIFGTDDEIKSIKIISLKEK* |
| Ga0102977_11446865 | 3300007171 | Freshwater Lake | MNKYTIKLEIVAEVEAFDSDDAKDYITDIFGTDDEIKSIKIVSVKEK* |
| Ga0075458_101481322 | 3300007363 | Aqueous | MNNYNIKLEISADVEAFSAEDARDYISDIFNIDDEIKSVKIVKISQK* |
| Ga0099848_11249554 | 3300007541 | Aqueous | MNTYSINLEINAEIDAFSEDDAKEYISDIFGIDDEIKSVKIISIKEK* |
| Ga0102873_11487313 | 3300007545 | Estuarine | MDKYSIKLEVLAEVDAFSEADAREYISDIFNVDDEIKSVKLLKISKNS* |
| Ga0102921_10536354 | 3300007603 | Estuarine | MDKYSIKLEVLAEVDAFSEADAREYISDIFNVDDEIKSVK |
| Ga0102855_11907672 | 3300007647 | Estuarine | MDKYSIKLEVLAEVDAFSEADAREYISDIFNVDDEIKKVSIVNIKEK* |
| Ga0105736_10188584 | 3300007861 | Estuary Water | MDKYSIKLEVLAEVDAFSEADAREYISDIFNVDDEIKAVKVI |
| Ga0114343_10184942 | 3300008110 | Freshwater, Plankton | MNNYSIKLEVNAEVQAFNEEDAVDYISDIFGIDDEIKSVKVVSVKEK* |
| Ga0114350_101153118 | 3300008116 | Freshwater, Plankton | MNKFSVKLEILAEVEAFDEDDARDYINDIFGTDDEVKSIKIISLAKK* |
| Ga0114350_10457515 | 3300008116 | Freshwater, Plankton | MNKYTVKLEVMAEVEAFDEDDAKDYITDIFGTDDEIKSIKITSIKEK* |
| Ga0114355_10896832 | 3300008120 | Freshwater, Plankton | MNKYSIKLEVMASIEAFNENDARDYIADIFGTDDEIKSIKIVSIKENS* |
| Ga0102830_10583193 | 3300009059 | Estuarine | FDENDAKEYISDVFGTDDEVKSVKISSIKIKGDKK* |
| Ga0114980_100064884 | 3300009152 | Freshwater Lake | MDKYTIKLEILAEVEAFSEADAKEYISDIFNVDDEIKSVKVIKVTKNS* |
| Ga0114968_103457344 | 3300009155 | Freshwater Lake | KLEVLAEVEAFSEADAREYISDIFNIDDEIKGVKVIKVTKNS* |
| Ga0114978_102364321 | 3300009159 | Freshwater Lake | MNKYLIKLEISAEVEAFDEDDARDYVNEIFGTDDEVKSVKIVLVKIKSKNS* |
| Ga0114979_101609663 | 3300009180 | Freshwater Lake | MNKYSIKIEIAAVIEAFNEDDAKDYVNEIFGTDEEVQSVKIVSVKEKR* |
| Ga0114982_10177495 | 3300009419 | Deep Subsurface | MNKYTISIEIKAEVLAFDEADAREYVSDIFGVDEEVLSVKIVSVKKK* |
| Ga0129333_1000182041 | 3300010354 | Freshwater To Marine Saline Gradient | MNKYTVKLEVIAEVEAFDEDDAKDYITDIFGTDDEIKSIKITSIKEK* |
| Ga0129333_1001611317 | 3300010354 | Freshwater To Marine Saline Gradient | MNKYSVKLEIITEIEAFDEDDARDYISDIFGIDEEIKAVNLIQIKRVGKK* |
| Ga0129333_100220339 | 3300010354 | Freshwater To Marine Saline Gradient | MNKYSIKLEISAEVEAFNEEDAREYISDIFGIDEEIKLVKIINVKEK* |
| Ga0129333_100733766 | 3300010354 | Freshwater To Marine Saline Gradient | MNKYSIKIEINAEVEAFNEDDAKEYISDIFGIDDEIKSVKIINIKEK* |
| Ga0129333_101464062 | 3300010354 | Freshwater To Marine Saline Gradient | MNKYIIRLEINAEIDAFNEDDAKEYISDIFGIDDEIKSVKIISVKGKDN* |
| Ga0129333_102492056 | 3300010354 | Freshwater To Marine Saline Gradient | MNKYSIKLEVMASIEAFNEDDARDYIADIFGTDDEIKSIKIVNIKENS* |
| Ga0129333_102712914 | 3300010354 | Freshwater To Marine Saline Gradient | MNKYTIKLEIVAEVEAFDSDDAKDYITDIFGTDDEIKSIKIISIKEK* |
| Ga0129333_103853652 | 3300010354 | Freshwater To Marine Saline Gradient | MNKYSIKLEINADVEAFNEDDAKEYISDIFGTDDEIKSIKIISVKKNS* |
| Ga0129333_109887772 | 3300010354 | Freshwater To Marine Saline Gradient | MNKYIIKLEVVAEIEAFDSDDARDYIADIFGIDDEIKSIKITSIKEK* |
| Ga0129333_116309791 | 3300010354 | Freshwater To Marine Saline Gradient | MNKYTIKLEVVAEIEAFDLDDAKDYITDIFGIDDEIRSIKITSIKEK* |
| Ga0129333_116717502 | 3300010354 | Freshwater To Marine Saline Gradient | MNKYTIKIEINAEVDAFSEDDAKEYISDIFGIDEEIKSVKIINVKEK* |
| Ga0138308_11126215 | 3300010965 | Lake Chemocline | MDKYSIKLEVLAEVDAFSEADAREYISDIFNVDDEIKAVKVLKISKNS* |
| Ga0151620_10010267 | 3300011268 | Freshwater | MNKYLIKLVISAEVEAFDENDARDYISDIFGIDDEVRKVNIESVKLIKEKK* |
| Ga0151620_10584533 | 3300011268 | Freshwater | MNKYSIKIEIAAVIEAFNEDDARDYVNEIFGTDEEVQSVKIVSVKEKR* |
| Ga0151620_11389751 | 3300011268 | Freshwater | IEISALIEAFNEDDARDYVNEIFGTDDEVQSVKIVSVKEKR* |
| Ga0153801_10031422 | 3300012017 | Freshwater | MNKYLIKLEISAEVEAFDENDAKEYISDVFGTDDEVKSVKIASIKIKGDKR* |
| Ga0157138_10526241 | 3300012352 | Freshwater | MNNYSIKLEVSAEVEAFSAEDARDYISDIFNIDDEIKSVKIVKISQN* |
| Ga0157210_10032234 | 3300012665 | Freshwater | MNNYSIKLEISAEVEAFSAEDARDYISDIFNVDDEIKSVKIIKISQK* |
| Ga0157208_100040439 | 3300012667 | Freshwater | MNNYSIKLEVSAEVEAFSAEDARDYILDIFNIDDEIKSVKIIKISQK* |
| Ga0157208_100308492 | 3300012667 | Freshwater | MDKYTVSIEVTAEVRAFDETDARDYVSDIFGVDDEIKDVKIVRIEKN* |
| Ga0129337_13163903 | 3300012968 | Aqueous | MNKYSVKLEIITEIEAFDEDDARDYISDIFGIDEEIKAVNMIQIKRVGKK* |
| Ga0129338_11727465 | 3300012970 | Aqueous | IKLEVMASIEAFNEDDARDYIADIFGTDDEIKSIKIVNIKENS* |
| Ga0163212_10268313 | 3300013087 | Freshwater | MNKYIVKLEVTAEIEAFDSDDAKDYITDIFGIDDEIRSIKIISIKEK* |
| Ga0163212_11605191 | 3300013087 | Freshwater | MNKYTVKLEVMAEIEAFDSDDAQDYITDIFGIDDEIKSIK |
| Ga0163199_10263023 | 3300013092 | Freshwater | MNTYVIKLEVQAQVEAFSEEDAREYISDIFGTDEEIVSVKIKSLSQK* |
| (restricted) Ga0172367_100519707 | 3300013126 | Freshwater | MNKYSVKLEVLVEVEAFDEGDARDYINDIFGTDDEVKSIKIISLKEK* |
| (restricted) Ga0172367_107058082 | 3300013126 | Freshwater | MNKYSVKLEVLAEVDAFDEDDARDYVNDIFGTDDEIKTVKIVSLKEK* |
| (restricted) Ga0172373_100804112 | 3300013131 | Freshwater | MNKYTVKLEVTAEIEAFDSDDAKDYITDIFGIDDEIKSIKIISIKEK* |
| (restricted) Ga0172373_102341594 | 3300013131 | Freshwater | MNKYTVKLEVVAEIEAFDSDDAKDYITDIFGIDDEIKSIKITNIKEK* |
| Ga0170791_135920303 | 3300013295 | Freshwater | MNKYSIKIEIAAVIEAFNEDDARDYVNEIFGTDEEVQSVKIASIKEKK* |
| Ga0177922_105358672 | 3300013372 | Freshwater | MNKYLIKLEISAEVEAFDENDAKEYISDIFGIDDEVRKVSVQSIKLIKEKK* |
| Ga0177922_112721473 | 3300013372 | Freshwater | MDTYLIKMEIKAEVEAFNEEDAREYISDIFGIDEEIKSIKVISIQKKS* |
| Ga0169931_101254945 | 3300017788 | Freshwater | MNKYTIKLEVVAEIEAFDSDDAKDYITDIFGIDDEIKSIKIISIKEK |
| Ga0207193_104308612 | 3300020048 | Freshwater Lake Sediment | MNKYSIKIEITAEVEAFDEEDAREYVSDIFGVDDEVKSVKILTVKQKS |
| Ga0207193_15556752 | 3300020048 | Freshwater Lake Sediment | MDKYSIKLEVLAEVEAFSEADAREYISDIFNIDDEIKSVKVIKVTKNS |
| Ga0194113_101165377 | 3300020074 | Freshwater Lake | MNKYIVKLEVTAEIEAFDSDDAKDYITDIFGIDDEIKSIKIINIKEK |
| Ga0211732_106130146 | 3300020141 | Freshwater | MNKYTISIEIKAEVLAFDEADARDYVSDIFGVDEEVLSVKIVSVKKK |
| Ga0194115_101650632 | 3300020183 | Freshwater Lake | MKKYTVKLEVLAEVDAFDEDDARDYVNDIFGTDDEIKTVKIVSLKEK |
| Ga0208326_1000444 | 3300020494 | Freshwater | MNKYLIKLVIAAEVEAFDENDARDYISDIFGIDDEVRKVNIESVKLIKEKK |
| Ga0208050_100010951 | 3300020498 | Freshwater | VNTYIVKIEVLASVDAFSEADAKDYISDIFNVDDEIKSVKIIKIAKSS |
| Ga0208050_10081992 | 3300020498 | Freshwater | MNKYLIKLEISAEVEAFDENDAKEYISDIFGTDDEVKSVRISSIRVKGEKK |
| Ga0208050_10082872 | 3300020498 | Freshwater | MKKYSIKIEIDAVVEAFSSEDAKEYISDIFGVDEEIVSVKIKKIEER |
| Ga0208050_10109792 | 3300020498 | Freshwater | MNKYLIKLEISAEVEAFDENDAKEYISDVFGTDDEVKSVKISSIKIKGDKK |
| Ga0208858_10024222 | 3300020524 | Freshwater | MNKYLIKLEISAEVEAFDENDAKEYISDIFGTDDEVKSVKISSIRVKGEKK |
| Ga0208233_10000466 | 3300020529 | Freshwater | MNKYSIKIEITAVIEAFNEDDARDYVNEIFGTDEEVQSVKIVSVKEKR |
| Ga0208722_10485862 | 3300020537 | Freshwater | MNKYSINIEITAVIEAFNEDDARDYVNEIFGTDEEVQSVKIVSVKEKR |
| Ga0208465_10006372 | 3300020570 | Freshwater | MNKYTVKLEVVAEVEAFDEDDAKDYITDIFGTDDEIKSIKITSIKEK |
| Ga0213921_10612971 | 3300021952 | Freshwater | MNNYNIKLEISADVEAFSAEDARDYISDIFNIDDEIKSVKIVKISQK |
| Ga0222714_1000815717 | 3300021961 | Estuarine Water | MNKYLIKLVISAEVEAFDENDARDYISDIFGIDDEVRKVNIESVKLIKEKK |
| Ga0222714_101727582 | 3300021961 | Estuarine Water | MNKYLIKLEISAEVEAFDENDAKEYISDVFGTDDEVKSVKIASIKIKGDKK |
| Ga0222714_102361741 | 3300021961 | Estuarine Water | MNKYLIKLVISAEVEAFDENDARDYISDIFGIDDEVRKVNIESVKL |
| Ga0222713_1002220013 | 3300021962 | Estuarine Water | LIKLVISAEVEAFDENDARDYISDIFGIDDEVRKVNIESVKLIKEKK |
| Ga0222712_101606602 | 3300021963 | Estuarine Water | MNKYSIKIEITAVIEAFNEDDAKDYVNEIFGTDEEVQSVKIVSVKEKR |
| Ga0222712_106048402 | 3300021963 | Estuarine Water | MNRYIIKLEVLAEIEAFDENDAKEYISDIFGTDDEVKSVKISSIKIKGDKK |
| Ga0222712_107120502 | 3300021963 | Estuarine Water | MKKYSIKLEISVEVEAFDEEDAKEYVSDIFGVDDEVKSVKILTVKQKS |
| Ga0212124_102661821 | 3300022553 | Freshwater | MNTYVIKLEVQAQVEAFSEEDAREYISDIFGTDEEIVSVKIKSLSQK |
| Ga0214917_100054786 | 3300022752 | Freshwater | MNVYKAKLEVEIEINAFNEDDAKDYINDIFGTDDEIKNIKIINVKEK |
| Ga0214917_100259087 | 3300022752 | Freshwater | MNRYSIKLEITAEIEAFSETDAREYISDIFGTDEEIKSVKVISIKEK |
| Ga0214919_1000048837 | 3300023184 | Freshwater | VNKYSISIAITAEVEAFDENDAMDYISDIFGIDDEIKSVKIVRIVKK |
| Ga0214919_1000598440 | 3300023184 | Freshwater | MNKYSINLEIKVEVEAFNLEDAKEYINDIFNIDDEIKSVSILKIKDISK |
| Ga0255147_10224483 | 3300024289 | Freshwater | MNKYSIKLEINAEVEAFSEDDAKEYIADIFGIDEEIKSVKIVNIKEK |
| Ga0244777_100765383 | 3300024343 | Estuarine | MDKYSIKLEVLAEVDAFSEADAREYISDIFNVDDEIKSVKVLKISKNS |
| Ga0244775_107928582 | 3300024346 | Estuarine | MNKYSIKIEISAVIEAFNEDDARDYVNEIFGTDEEVQSVKIVSVKEKR |
| Ga0244776_1000113630 | 3300024348 | Estuarine | MDKYSIKLEVLAEVDAFSEADAREYISDIFNVDDEIKAVKVIKISKNS |
| Ga0255141_10405972 | 3300024351 | Freshwater | MNKYSIKIEINAEVEAFSEDDAKEYVSDIFGIDDEIKSVKIVKIKEK |
| Ga0256332_10770983 | 3300024484 | Freshwater | EINAEVEAFSEDDAKEYIADIFGIDEEIKSVKIVNIKEK |
| Ga0255144_10243622 | 3300024513 | Freshwater | MNKYSIKIEINAEVVAFSEDDAKEYVSDIFGIDDEIKSVKIVKIKEK |
| Ga0256348_10693212 | 3300024543 | Freshwater | MKKYEVKLEVMAEIEAFDEDDAKDYISDIFGVDYEIKFIKILNIKEK |
| Ga0255268_11508682 | 3300024572 | Freshwater | MNKYSIKLEINAEIEAFDEDDARDYVSDIFGIDDEIKSVKILNIKEK |
| Ga0256337_10229561 | 3300024573 | Freshwater | NKYSIKIEINAEVEAFSEDDAKEYVSDIFGIDDEIKSVKIVKIKEK |
| Ga0208566_11064632 | 3300025307 | Freshwater | MNTYVIKLEVQAQVEAFSEEDAREYISDIFGTDEEIVSVKIKSLS |
| Ga0209552_11385963 | 3300027563 | Freshwater Lake | MDKYSIKLEVLAEVEAFSEADAREYISDIFNIDDEIKNVKVIKVTKNS |
| Ga0208966_100000367 | 3300027586 | Freshwater Lentic | MEIKAEVEAFNEEDAREYISDIFGIDEEIKSIKVISIQKKS |
| Ga0209357_10576843 | 3300027656 | Freshwater Lake | YLIKLEISAEVEAFDENDAKEYISDVFGTDDEVKSVKIASIKIKGDKK |
| Ga0209599_100137545 | 3300027710 | Deep Subsurface | MNKYTISIEIKAEVLAFDEADAREYVSDIFGVDEEVLSVKIVSVKKK |
| Ga0209297_10981184 | 3300027733 | Freshwater Lake | MDKYTIKLEILAEVEAFSEADAKEYISDIFNVDDEIKSVKVIKVTKNS |
| Ga0209444_102898031 | 3300027756 | Freshwater Lake | MDKYSIKLEVLAEVEAFSEADAREYISDIFNIDDEIKGVKVIKVTKNS |
| Ga0209770_100064812 | 3300027769 | Freshwater Lake | MNKYSIKIEITAEVEAFDEEDAKEYVSDIFGVDDEVKSVKILTVKQKS |
| Ga0209770_101894961 | 3300027769 | Freshwater Lake | MDKYTIKLEISAEVDAFSEADAKEYISDIFNVDDEIKSV |
| Ga0209500_102239521 | 3300027782 | Freshwater Lake | MNKYLIKLEISAEVEAFDEDDARDYVNEIFGTDDEVKSVKIVLVKIKSKNS |
| Ga0209972_103495672 | 3300027793 | Freshwater Lake | MNKYTIKLEVVAEVEAFDSDDAKDYITDIFGTDDEIKSIKITSIKEK |
| Ga0209107_1000047455 | 3300027797 | Freshwater And Sediment | MDKYSIKLEVLAEVDAFSEADAREYISDIFNVDDEIKNVKVVKISKNS |
| Ga0209229_102658621 | 3300027805 | Freshwater And Sediment | IMDKYRIKLEVLAEVDAFSEADAREYISDIFNVDDEIKSVKIIKVSKNS |
| Ga0209230_100089427 | 3300027836 | Freshwater And Sediment | MNNYSIKLEVSAEVEAFSAEDARDYISDIFNIDDEIKSVKIVKISQN |
| Ga0209230_107415812 | 3300027836 | Freshwater And Sediment | MNNYSIKLEVSAEVEAFSAEDARDYISDIFNIDDEIKSVKIIKISQK |
| Ga0256335_11817282 | 3300028112 | Freshwater | KYSIKIEINAEVEAFSEDDAKEYVSDIFGIDDEIKSVKIVKIKQK |
| Ga0315909_10000120131 | 3300031857 | Freshwater | MNKFSVKLEILAEVEAFDEDDARDYINDIFGTDDEVKSIKIISLAKK |
| Ga0315909_108219952 | 3300031857 | Freshwater | MNKYSIKLEVMASIEAFNENDARDYIADIFGTDDEIKSIKIVSIKENS |
| Ga0315904_108615923 | 3300031951 | Freshwater | MNKYSIKLEINADVEAFNEDDAKEYISDIFGTDDEIKSIKIISVKKNS |
| Ga0315905_108828452 | 3300032092 | Freshwater | MNNYTIKLEVSAEVQAFSAEDARDYISDIFNIDDEIKSVKIIKISQK |
| Ga0334980_0159164_593_736 | 3300033816 | Freshwater | MNQYSVKIEVLASVDAFSEDDAKDYISDIFNVDDEIKSVKIIKISKN |
| Ga0334991_0002132_8895_9041 | 3300034013 | Freshwater | MNKYLIKLEISVEVEAFDEEDAKEYVSDIFGVDDEVKSVKILTVKQKS |
| Ga0335021_0064726_434_577 | 3300034023 | Freshwater | MNKYSIKLEISAEVEAFNEEDAREYISDIFGIDEEIKLVKIINVKEK |
| Ga0335019_0659780_286_441 | 3300034066 | Freshwater | MNKYSIKIEILAEVEAFDENDAKEYISDIFGTDDEVKSVKIASIKIKGEKK |
| Ga0335037_0259426_817_948 | 3300034107 | Freshwater | EISAEVEAFDENDAKEYISDVFGTDDEVKSVKIASIKIKGDKK |
| Ga0335063_0059165_285_431 | 3300034111 | Freshwater | MNKYSVKIEISAVIEALNEDDARDYVNEIFGTDEEVQSVKIVSVKEKR |
| Ga0335007_0621019_382_528 | 3300034283 | Freshwater | MNQYSVKIEVLASVDAFSEDDAKDYISDIFNVDDEIKSVKIIKISKNS |
| ⦗Top⦘ |