| Basic Information | |
|---|---|
| Family ID | F040555 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 161 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MTSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVG |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 22.36 % |
| % of genes near scaffold ends (potentially truncated) | 99.38 % |
| % of genes from short scaffolds (< 2000 bps) | 83.85 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.379 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.845 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.068 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.764 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.59% β-sheet: 0.00% Coil/Unstructured: 55.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF00990 | GGDEF | 24.22 |
| PF05231 | MASE1 | 19.25 |
| PF10609 | ParA | 8.07 |
| PF01850 | PIN | 4.35 |
| PF14219 | DUF4328 | 2.48 |
| PF13614 | AAA_31 | 1.24 |
| PF07228 | SpoIIE | 1.24 |
| PF01676 | Metalloenzyme | 0.62 |
| PF00069 | Pkinase | 0.62 |
| PF13424 | TPR_12 | 0.62 |
| PF14534 | DUF4440 | 0.62 |
| PF07676 | PD40 | 0.62 |
| PF00753 | Lactamase_B | 0.62 |
| PF02368 | Big_2 | 0.62 |
| PF13546 | DDE_5 | 0.62 |
| PF00072 | Response_reg | 0.62 |
| PF01546 | Peptidase_M20 | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 19.25 |
| COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 19.25 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 19.25 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.38 % |
| Unclassified | root | N/A | 0.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002557|JGI25381J37097_1005168 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2282 | Open in IMG/M |
| 3300002558|JGI25385J37094_10036359 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300002558|JGI25385J37094_10076255 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300002561|JGI25384J37096_10040106 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1815 | Open in IMG/M |
| 3300002562|JGI25382J37095_10025993 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2289 | Open in IMG/M |
| 3300002562|JGI25382J37095_10055832 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300002908|JGI25382J43887_10478613 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 527 | Open in IMG/M |
| 3300002912|JGI25386J43895_10107244 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300002916|JGI25389J43894_1064154 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300003993|Ga0055468_10214266 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 596 | Open in IMG/M |
| 3300005167|Ga0066672_10504710 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300005167|Ga0066672_10766979 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005167|Ga0066672_10768658 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 609 | Open in IMG/M |
| 3300005171|Ga0066677_10474823 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 717 | Open in IMG/M |
| 3300005172|Ga0066683_10395658 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 854 | Open in IMG/M |
| 3300005172|Ga0066683_10904701 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 505 | Open in IMG/M |
| 3300005176|Ga0066679_10138550 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1514 | Open in IMG/M |
| 3300005176|Ga0066679_10938178 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 543 | Open in IMG/M |
| 3300005177|Ga0066690_10087360 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
| 3300005177|Ga0066690_10144869 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
| 3300005177|Ga0066690_10385963 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300005177|Ga0066690_10466479 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 853 | Open in IMG/M |
| 3300005181|Ga0066678_10379213 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 936 | Open in IMG/M |
| 3300005440|Ga0070705_100635111 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300005445|Ga0070708_102199158 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005450|Ga0066682_10521655 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 752 | Open in IMG/M |
| 3300005450|Ga0066682_10635906 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300005518|Ga0070699_101077533 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 737 | Open in IMG/M |
| 3300005552|Ga0066701_10001993 | All Organisms → cellular organisms → Bacteria | 7390 | Open in IMG/M |
| 3300005554|Ga0066661_10388679 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300005555|Ga0066692_10558481 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 723 | Open in IMG/M |
| 3300005586|Ga0066691_10097067 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300005586|Ga0066691_10400741 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 815 | Open in IMG/M |
| 3300005598|Ga0066706_10241297 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 1404 | Open in IMG/M |
| 3300005873|Ga0075287_1028852 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300006032|Ga0066696_10848875 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 582 | Open in IMG/M |
| 3300006034|Ga0066656_10110720 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
| 3300006034|Ga0066656_10605981 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300006794|Ga0066658_10404518 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 740 | Open in IMG/M |
| 3300006796|Ga0066665_11310059 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 556 | Open in IMG/M |
| 3300006797|Ga0066659_10440364 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300006804|Ga0079221_10111183 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300006804|Ga0079221_10224102 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300006845|Ga0075421_100555704 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1356 | Open in IMG/M |
| 3300006847|Ga0075431_101228039 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 712 | Open in IMG/M |
| 3300006903|Ga0075426_11036027 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 621 | Open in IMG/M |
| 3300006903|Ga0075426_11572889 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300006954|Ga0079219_10319067 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 976 | Open in IMG/M |
| 3300006954|Ga0079219_10590286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
| 3300007258|Ga0099793_10067430 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300009012|Ga0066710_100527749 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
| 3300009012|Ga0066710_101716832 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 954 | Open in IMG/M |
| 3300009012|Ga0066710_102228151 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300009012|Ga0066710_102828412 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 685 | Open in IMG/M |
| 3300009038|Ga0099829_10199367 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300009038|Ga0099829_10773105 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300009089|Ga0099828_10124123 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2259 | Open in IMG/M |
| 3300009100|Ga0075418_13054381 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 510 | Open in IMG/M |
| 3300009137|Ga0066709_100122511 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3253 | Open in IMG/M |
| 3300009137|Ga0066709_100809600 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1358 | Open in IMG/M |
| 3300010301|Ga0134070_10122403 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 919 | Open in IMG/M |
| 3300010304|Ga0134088_10508279 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 594 | Open in IMG/M |
| 3300010323|Ga0134086_10107529 | Not Available | 990 | Open in IMG/M |
| 3300010326|Ga0134065_10231133 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 682 | Open in IMG/M |
| 3300010329|Ga0134111_10083197 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300010337|Ga0134062_10001151 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 8852 | Open in IMG/M |
| 3300010337|Ga0134062_10027213 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2229 | Open in IMG/M |
| 3300010397|Ga0134124_10919059 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 882 | Open in IMG/M |
| 3300010403|Ga0134123_10263025 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1508 | Open in IMG/M |
| 3300011270|Ga0137391_10964504 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 695 | Open in IMG/M |
| 3300012189|Ga0137388_11138349 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300012189|Ga0137388_11625277 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 581 | Open in IMG/M |
| 3300012189|Ga0137388_11737077 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300012199|Ga0137383_10886110 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 651 | Open in IMG/M |
| 3300012201|Ga0137365_10025619 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4554 | Open in IMG/M |
| 3300012205|Ga0137362_11116446 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300012206|Ga0137380_10119773 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2405 | Open in IMG/M |
| 3300012206|Ga0137380_10633783 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300012208|Ga0137376_10008686 | All Organisms → cellular organisms → Bacteria | 7093 | Open in IMG/M |
| 3300012208|Ga0137376_10607710 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300012210|Ga0137378_10012399 | All Organisms → cellular organisms → Bacteria | 7391 | Open in IMG/M |
| 3300012211|Ga0137377_10923356 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300012285|Ga0137370_10245871 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1059 | Open in IMG/M |
| 3300012349|Ga0137387_10278136 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300012351|Ga0137386_10105473 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
| 3300012351|Ga0137386_10744617 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 704 | Open in IMG/M |
| 3300012351|Ga0137386_11306798 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 502 | Open in IMG/M |
| 3300012357|Ga0137384_10031989 | All Organisms → cellular organisms → Bacteria | 4326 | Open in IMG/M |
| 3300012359|Ga0137385_11146883 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 638 | Open in IMG/M |
| 3300012360|Ga0137375_11308191 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 546 | Open in IMG/M |
| 3300012362|Ga0137361_10353227 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300012362|Ga0137361_11396190 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300012372|Ga0134037_1088751 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300012376|Ga0134032_1113812 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300012407|Ga0134050_1080890 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 602 | Open in IMG/M |
| 3300012918|Ga0137396_10014743 | All Organisms → cellular organisms → Bacteria | 4888 | Open in IMG/M |
| 3300012922|Ga0137394_10118666 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2237 | Open in IMG/M |
| 3300012922|Ga0137394_11291049 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 593 | Open in IMG/M |
| 3300012925|Ga0137419_10012534 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4659 | Open in IMG/M |
| 3300012927|Ga0137416_11250529 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 670 | Open in IMG/M |
| 3300012929|Ga0137404_11049129 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300012944|Ga0137410_10000790 | All Organisms → cellular organisms → Bacteria | 21713 | Open in IMG/M |
| 3300012944|Ga0137410_11715862 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 553 | Open in IMG/M |
| 3300012972|Ga0134077_10235930 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 754 | Open in IMG/M |
| 3300012976|Ga0134076_10568630 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300014154|Ga0134075_10269430 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 738 | Open in IMG/M |
| 3300014166|Ga0134079_10135528 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 978 | Open in IMG/M |
| 3300014166|Ga0134079_10135529 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 978 | Open in IMG/M |
| 3300014166|Ga0134079_10195086 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300015241|Ga0137418_11308906 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 505 | Open in IMG/M |
| 3300015245|Ga0137409_10101860 | All Organisms → cellular organisms → Bacteria | 2663 | Open in IMG/M |
| 3300017656|Ga0134112_10091380 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300017657|Ga0134074_1039717 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1583 | Open in IMG/M |
| 3300018071|Ga0184618_10071798 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1307 | Open in IMG/M |
| 3300018433|Ga0066667_10624890 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300018433|Ga0066667_11021410 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 714 | Open in IMG/M |
| 3300018482|Ga0066669_10217839 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1479 | Open in IMG/M |
| 3300019866|Ga0193756_1053883 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 543 | Open in IMG/M |
| 3300021046|Ga0215015_10527517 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 775 | Open in IMG/M |
| 3300021081|Ga0210379_10134164 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1046 | Open in IMG/M |
| 3300025885|Ga0207653_10248295 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300025905|Ga0207685_10361309 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300025922|Ga0207646_10841035 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 816 | Open in IMG/M |
| 3300025939|Ga0207665_10747175 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 771 | Open in IMG/M |
| 3300026277|Ga0209350_1018865 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2143 | Open in IMG/M |
| 3300026277|Ga0209350_1131067 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 564 | Open in IMG/M |
| 3300026277|Ga0209350_1150685 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 524 | Open in IMG/M |
| 3300026296|Ga0209235_1194562 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 721 | Open in IMG/M |
| 3300026300|Ga0209027_1001329 | All Organisms → cellular organisms → Bacteria | 9290 | Open in IMG/M |
| 3300026307|Ga0209469_1130444 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300026308|Ga0209265_1002043 | All Organisms → cellular organisms → Bacteria | 6103 | Open in IMG/M |
| 3300026312|Ga0209153_1190806 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 729 | Open in IMG/M |
| 3300026343|Ga0209159_1029427 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2954 | Open in IMG/M |
| 3300026343|Ga0209159_1122390 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1094 | Open in IMG/M |
| 3300026527|Ga0209059_1098882 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300026536|Ga0209058_1121473 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300026537|Ga0209157_1094588 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1433 | Open in IMG/M |
| 3300026538|Ga0209056_10005936 | All Organisms → cellular organisms → Bacteria | 12676 | Open in IMG/M |
| 3300026538|Ga0209056_10056770 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3457 | Open in IMG/M |
| 3300026540|Ga0209376_1281282 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 679 | Open in IMG/M |
| 3300026547|Ga0209156_10211675 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 920 | Open in IMG/M |
| 3300027273|Ga0209886_1004306 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1961 | Open in IMG/M |
| 3300027643|Ga0209076_1145916 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 663 | Open in IMG/M |
| 3300027775|Ga0209177_10148114 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300027775|Ga0209177_10166333 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300027882|Ga0209590_10163519 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1388 | Open in IMG/M |
| 3300027909|Ga0209382_10766912 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1030 | Open in IMG/M |
| 3300028536|Ga0137415_10096467 | All Organisms → cellular organisms → Bacteria | 2810 | Open in IMG/M |
| 3300028711|Ga0307293_10042271 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1403 | Open in IMG/M |
| 3300028784|Ga0307282_10034375 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2206 | Open in IMG/M |
| 3300028814|Ga0307302_10475952 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 619 | Open in IMG/M |
| 3300028884|Ga0307308_10314268 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300031720|Ga0307469_10001365 | All Organisms → cellular organisms → Bacteria | 9341 | Open in IMG/M |
| 3300031753|Ga0307477_10756987 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 647 | Open in IMG/M |
| 3300031962|Ga0307479_10212344 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1906 | Open in IMG/M |
| 3300031965|Ga0326597_12132709 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 514 | Open in IMG/M |
| 3300032174|Ga0307470_11720908 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300032180|Ga0307471_100303861 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
| 3300032180|Ga0307471_103066214 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300033500|Ga0326730_1108726 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 515 | Open in IMG/M |
| 3300033805|Ga0314864_0032425 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1141 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 23.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 14.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 11.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.35% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.73% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.73% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.73% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.24% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.62% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.62% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.62% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.62% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.62% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.62% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012372 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25381J37097_10051683 | 3300002557 | Grasslands Soil | MTTVARTPGSLTVGPLRPVILRLAVPAVAMMACHFSFNLID |
| JGI25385J37094_100363593 | 3300002558 | Grasslands Soil | MTTAARPEGALTVGPLRPVILRLATPAVAMMACHFSFNVIDSLWVGRLIG |
| JGI25385J37094_100762551 | 3300002558 | Grasslands Soil | VTTLARPAGTLTVGPLRPVILRLAAPAVAMMACHFCFNLIDSIWVGRLIG |
| JGI25384J37096_100401061 | 3300002561 | Grasslands Soil | MASTTRTPGALTVGPLQPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIG |
| JGI25382J37095_100259934 | 3300002562 | Grasslands Soil | MTSTTRPPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIGP |
| JGI25382J37095_100558323 | 3300002562 | Grasslands Soil | VTTLARPAGTLTVGPLRPVILRLAAPAVAMMACHFCFNLIDSIWVGR |
| JGI25382J43887_104786131 | 3300002908 | Grasslands Soil | VTTLARPAGTLTVGPLRPVILRLAAPAVAMMACHFCFNLID |
| JGI25386J43895_101072441 | 3300002912 | Grasslands Soil | MTSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWV |
| JGI25389J43894_10641542 | 3300002916 | Grasslands Soil | MISTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVG |
| Ga0055468_102142662 | 3300003993 | Natural And Restored Wetlands | VTTAEVSQPRTAGVLTTGPLRPVILRLALPAVAMMACHFTFGVIDAMWVGRI |
| Ga0066672_105047102 | 3300005167 | Soil | MTTVARTPGSLTVGPLRPVILRLAVPAVAMMACHFSFNLIDSIWVGRLIGAAAL |
| Ga0066672_107669791 | 3300005167 | Soil | MISTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLID |
| Ga0066672_107686582 | 3300005167 | Soil | MTSVTRAPGSLTVGPLRPVILQLAAPAVAMMACHFCFNLID |
| Ga0066677_104748231 | 3300005171 | Soil | MSSVTRAPGSLTVGPLRPVILQLAAPAVAMMACHFCFNLID |
| Ga0066683_103956582 | 3300005172 | Soil | VTTLARPAGTLTVGPLRPVILRLAAPAVAMMACHFCFNLIDSIW |
| Ga0066683_109047011 | 3300005172 | Soil | VTTLVRPAGTLTVGPLRPVILRLAAPAVAMMACHFCFNLIDSIW |
| Ga0066679_101385503 | 3300005176 | Soil | MTSVTRAPGSLTVGPLRPVILQLAAPAVAMMACHFCFNLIDSIWV |
| Ga0066679_109381781 | 3300005176 | Soil | MTSVTRTPGSLTVGPLRPVILQLAAPAVAMMACHFCFNLIDSIWV |
| Ga0066690_100873601 | 3300005177 | Soil | VTTTTRLTGALTVGPLRPVILRLAAPAVAMMACHFCFNLIDSIWVGRLIG |
| Ga0066690_101448692 | 3300005177 | Soil | MTSTSRTPGALTVGPLRPVILNLAAPAVAMMACHFCFNLIDA |
| Ga0066690_103859633 | 3300005177 | Soil | MTSATRVPGSLTVGPLRPVILQLAAPAVAMMACHFCFNLIDSIWVGRLIGPA |
| Ga0066690_104664792 | 3300005177 | Soil | MTSATRVPGSLTIGPLRPVILQLAAPAVAMMACHFCFNLIDSIWVGRLIGPA |
| Ga0066678_103792131 | 3300005181 | Soil | VTTTTRLTGALTVGPLRPVILRLAAPAVAMMACHFCFNLIDAIWVGR |
| Ga0070705_1006351111 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MISTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAMWVGHL |
| Ga0070708_1021991582 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MISTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAMWVGHLIG |
| Ga0066682_105216551 | 3300005450 | Soil | MTSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIGPAALAAVSTA |
| Ga0066682_106359062 | 3300005450 | Soil | MTTVARTPGSLTVGPLRPVILRLAAPAVAMMACHFCFNLID |
| Ga0070699_1010775331 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VTTLARPAGTLTVGPLRPVILRLAAPAVAMMACHFCFNLIDS |
| Ga0066701_100019931 | 3300005552 | Soil | MTTVARTPGSLTVGPLRPVILRLAAPAVAMMACHFCFNLIDSIWVGRLIGPAA |
| Ga0066661_103886793 | 3300005554 | Soil | MATVARPAGSLTVGPLRPVILRLAVPAVAMMACHFCFNLI |
| Ga0066692_105584811 | 3300005555 | Soil | VTTVAGPAGVLTVGPLRSAVLRLAVPAVAMMACHFCFNLI |
| Ga0066691_100970672 | 3300005586 | Soil | MTSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIGPAALA |
| Ga0066691_104007412 | 3300005586 | Soil | VTTLVRPVGTLTVGPLRPVILRLAAPAVAMMACHFCFNLIDSIWVGR |
| Ga0066706_102412972 | 3300005598 | Soil | MTTLARPPGTLTVGPLRPVILRLAAPAVAMMACHFC |
| Ga0075287_10288522 | 3300005873 | Rice Paddy Soil | MTTVARQPGSLTIGPLRPVILKLAAPAVAMMACHFCFNLIDSIWVGHL |
| Ga0066696_108488752 | 3300006032 | Soil | MTSVTRAPGSLTVGPLRPVILQLAAPAVAMMACHF |
| Ga0066656_101107203 | 3300006034 | Soil | MTSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLI |
| Ga0066656_106059812 | 3300006034 | Soil | MTSTSRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIGPAALA |
| Ga0066658_104045181 | 3300006794 | Soil | VTTLARPAGPLTVGPLRPVILRLAAPAVAMMACHF |
| Ga0066665_113100592 | 3300006796 | Soil | MTTAARPEGALTVGPLRPVILRLATPAVAMMACHFS |
| Ga0066659_104403643 | 3300006797 | Soil | MATVARPAGSLTVGPLRPVILRLAVPAVAMMACHFCFNLIDAIWVGRLIGPAALAAVS |
| Ga0079221_101111831 | 3300006804 | Agricultural Soil | MTSIAGTPPSPPGSLTVGPLRPVILKLATPAVAMMACHFCFNLIDA |
| Ga0079221_102241022 | 3300006804 | Agricultural Soil | MTSVAGTPPSPPGSLTVGPLRPVILKLATPAVAMMACHFCFNLIDA |
| Ga0075421_1005557041 | 3300006845 | Populus Rhizosphere | VTTATAGALTVGPLRPVVLKLAAPAVAMMACHFSFNLIDSIWV |
| Ga0075431_1012280392 | 3300006847 | Populus Rhizosphere | VTPRAASSLTEGPLRPVILRLALPAVGMMACHFTFNLIDMLWVGRLIGPA |
| Ga0075426_110360272 | 3300006903 | Populus Rhizosphere | MTSVTRAPGSLTVGPLRPVILRLAAPAVAMMACHFCF |
| Ga0075426_115728892 | 3300006903 | Populus Rhizosphere | MTTVARTPGSLTVGPLRPVILRLALPAVAMMACHFC |
| Ga0079219_103190671 | 3300006954 | Agricultural Soil | MTAAAGGAPGVLTRGPLRPVILRLALPAVAMMACHFTFGLI |
| Ga0079219_105902861 | 3300006954 | Agricultural Soil | MTSVVRTPGSLTVGPLRPVILKLAAPAVAMMACHFTFNLIDAIWVGRLIGPAAL |
| Ga0099793_100674301 | 3300007258 | Vadose Zone Soil | MMSTTRPPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAI |
| Ga0066710_1005277494 | 3300009012 | Grasslands Soil | MATVARPAGSLTVGPLRPVILRLAVPAVAMMACHFCFNLIDAIWVGRLIG |
| Ga0066710_1017168321 | 3300009012 | Grasslands Soil | VTTTARSAGARTVGPRRPVILRLGAPAVAMMACHFR |
| Ga0066710_1022281512 | 3300009012 | Grasslands Soil | MTSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIG |
| Ga0066710_1028284121 | 3300009012 | Grasslands Soil | VTTLARPAGTLTVGPLRPVILRLAAPAVAMMACHFCFNLIDSIWVGRLIGP |
| Ga0099829_101993671 | 3300009038 | Vadose Zone Soil | MMSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIGPAALAA |
| Ga0099829_107731052 | 3300009038 | Vadose Zone Soil | MTSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCF |
| Ga0099828_101241233 | 3300009089 | Vadose Zone Soil | MTTVARTPGALTVGPLRPVILTLAAPAVAMMACHFC |
| Ga0075418_130543811 | 3300009100 | Populus Rhizosphere | VTTAAVVPGALTVGPLRPVIFRLALPAVAMMACHFCFNLIDSIW |
| Ga0066709_1001225115 | 3300009137 | Grasslands Soil | MTSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIGP |
| Ga0066709_1008096002 | 3300009137 | Grasslands Soil | MTSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIGPAALAA |
| Ga0134070_101224032 | 3300010301 | Grasslands Soil | VTAGTLTVGPLRPVVFRLAAPAVAMMACHFCFNFIDSIWVGRLIGPAALA |
| Ga0134088_105082792 | 3300010304 | Grasslands Soil | VTTTAPPGVGALTVGPLRPVILRLALPAVAMMACHFCFNLIDSIWVGRLI |
| Ga0134086_101075292 | 3300010323 | Grasslands Soil | MTTVARPAGSLTVGPLRPVILRLAVPAVAMMACHFCFNLIDAIWVGRLIGP |
| Ga0134065_102311331 | 3300010326 | Grasslands Soil | MTSVTRAPGSLTVGPLRPVILQLAAPAVAMMACHFCFNLIDSIWVGRLIGPAALA |
| Ga0134111_100831971 | 3300010329 | Grasslands Soil | MATVARPVGSLTVGPLRPVILRLALPAVAMMACHFCFNL |
| Ga0134062_1000115110 | 3300010337 | Grasslands Soil | MTSTSRTPGALTVGPLRPVILNLAAPAVAMMACHFCFNLIDAI |
| Ga0134062_100272133 | 3300010337 | Grasslands Soil | MISTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIGPAALAAV |
| Ga0134124_109190591 | 3300010397 | Terrestrial Soil | MISTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGNLIGPAALAAVSTA |
| Ga0134123_102630253 | 3300010403 | Terrestrial Soil | MTSGTAGALTVGPLRPVVLKLAAPAVAMMACNFSFNLIDTIWVGRLIGPAAL |
| Ga0137391_109645041 | 3300011270 | Vadose Zone Soil | VTTAARPEGALTVGPLRPVILRLAIPAVAMMACHFSFNVIDSLWVGRL |
| Ga0137388_111383492 | 3300012189 | Vadose Zone Soil | MTTVARTPGSLTVGPLRPVILRLAAPAVAMMACHFCFNLI |
| Ga0137388_116252772 | 3300012189 | Vadose Zone Soil | VTTLARPAGTLTVGPLRPVILRLAAPAVAMMACHFCFNLIDSI |
| Ga0137388_117370772 | 3300012189 | Vadose Zone Soil | MTSTTRPPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIG |
| Ga0137383_108861102 | 3300012199 | Vadose Zone Soil | MTSAARVPGSLTVGPLRPVILQLAAPAVAMMACHFCFNLIDSIWVGRLIG |
| Ga0137365_100256196 | 3300012201 | Vadose Zone Soil | MTSAARVPGSLTVGPLRPVILQLAAPAVAMMACHFCFNLIDSIWVGRLIGP |
| Ga0137362_111164461 | 3300012205 | Vadose Zone Soil | MMSTTRPPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIW |
| Ga0137380_101197733 | 3300012206 | Vadose Zone Soil | MTTVARTPGSLTVGPLRPVILKLAAPAVAMMACHFCFNLIDSIWVGRLIGP |
| Ga0137380_106337831 | 3300012206 | Vadose Zone Soil | MTSVARTPGSLTVGPLRPVILKLAAPAVAMMACHFCFNLIDSIWVGRLIGP |
| Ga0137376_100086861 | 3300012208 | Vadose Zone Soil | MTSTSRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAI |
| Ga0137376_106077102 | 3300012208 | Vadose Zone Soil | MPSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIGP |
| Ga0137378_100123991 | 3300012210 | Vadose Zone Soil | MTSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIW |
| Ga0137377_109233561 | 3300012211 | Vadose Zone Soil | MTSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVG |
| Ga0137370_102458713 | 3300012285 | Vadose Zone Soil | VTTAARTPGALTVGPLRPVILRLAAPAVAMMACHFCFNLIDAIWVG |
| Ga0137387_102781361 | 3300012349 | Vadose Zone Soil | MTSVARTPGSLTVGPLRPVILKLAAPAVAMMACHFCFNLIDS |
| Ga0137386_101054731 | 3300012351 | Vadose Zone Soil | MTSVARTPGSLTVGPLRPVILKLAAPAVAMMACHFCFNLIDSIWVGRLIGPAAL |
| Ga0137386_107446171 | 3300012351 | Vadose Zone Soil | VTTTARSAGALTVGPLRPVILRLAAPAVAMMACHF |
| Ga0137386_113067981 | 3300012351 | Vadose Zone Soil | MTSTSRTPGALTVGPLRPVLLKLAAPAVAMMACHSCFNLIDATSVGRLIGPASG* |
| Ga0137384_100319891 | 3300012357 | Vadose Zone Soil | MTSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIGPAALAAVST |
| Ga0137385_111468831 | 3300012359 | Vadose Zone Soil | MTSTTRTPGALTVGTLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIGPAALAAV |
| Ga0137375_113081911 | 3300012360 | Vadose Zone Soil | MSTVARPAGSLTVGPLRPVILRLAAPAVAMMACHFCFNLIDS |
| Ga0137361_103532271 | 3300012362 | Vadose Zone Soil | MMSTTRPPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLI |
| Ga0137361_113961901 | 3300012362 | Vadose Zone Soil | MTTVARTPGSLTVGPLRPVILRLAAPAVAMMACHFCFNLIDAIWVG |
| Ga0134037_10887511 | 3300012372 | Grasslands Soil | VTTVARPPGSLTVGPLRPVILRLAAPAVAMMACHFSFNLIDSIW |
| Ga0134032_11138121 | 3300012376 | Grasslands Soil | VTTVARPPGSLTVGPLRPVILRLAAPAVAMMACHFSFNLI |
| Ga0134050_10808901 | 3300012407 | Grasslands Soil | VTTVARPPGSLTVGPLRPVILRLAAPAVAMMACHFSFNLIDSIWV |
| Ga0137396_100147431 | 3300012918 | Vadose Zone Soil | MTSTTRPPGALTVGPLRPVILKLAAPAVAMMACHFCFN |
| Ga0137394_101186661 | 3300012922 | Vadose Zone Soil | MTSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIGPAAFAAVSTA |
| Ga0137394_112910492 | 3300012922 | Vadose Zone Soil | MTTGALTLGPLRPVVLRLAAPAVAMMACHFSFNLI |
| Ga0137419_100125341 | 3300012925 | Vadose Zone Soil | MTSTTRPPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGHLIGPAALAA |
| Ga0137416_112505292 | 3300012927 | Vadose Zone Soil | MTSGGGTAGALTIGPLRPVVLKLAAPAVAMMACNFSFNLIDTI |
| Ga0137404_110491291 | 3300012929 | Vadose Zone Soil | MTSTTRPPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIGPAALAA |
| Ga0137410_100007901 | 3300012944 | Vadose Zone Soil | MTSTTRPPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWV |
| Ga0137410_117158622 | 3300012944 | Vadose Zone Soil | MTSGVLTVGPLRPVVLKLAAPAVAMMACHFSFNLID |
| Ga0134077_102359301 | 3300012972 | Grasslands Soil | VTTLVRPAGTLTVGPLRPVILRLAAPAVAMMACHFCFNLIDSIWVG |
| Ga0134076_105686301 | 3300012976 | Grasslands Soil | MTPPTLARTPGTLTVGPLRPVILKLAAPAVAMMACHFCFNLIDAVW |
| Ga0134075_102694301 | 3300014154 | Grasslands Soil | VTTLVRPAGTLTVGPLRPVILRLAAPAVAMMACHFCFNLIDSIWV |
| Ga0134079_101355281 | 3300014166 | Grasslands Soil | MTSVTRAPGSLTVGPLRPVILQLAAPAVAMMACHFCFNLIDSVWVGRLIGPAALAAVSTA |
| Ga0134079_101355291 | 3300014166 | Grasslands Soil | MTSATRVPGSLTVGPLRPVILQLAAPAVAMMACHF |
| Ga0134079_101950863 | 3300014166 | Grasslands Soil | MTSTSRTPGALTVGPLRPVILNLAAPAVAMMACHFCFNLI |
| Ga0137418_113089061 | 3300015241 | Vadose Zone Soil | MTTGALTIGPLRPVVLRLAAPAVAMMACHFSFNLI |
| Ga0137409_101018601 | 3300015245 | Vadose Zone Soil | MTTGALTLGPLRPVVLRLAAPAVAMMACHFSFNLIDSIWVGRLIGPA |
| Ga0134112_100913803 | 3300017656 | Grasslands Soil | MATVARPAGSLTVGPLRPVILRLAVPAVAMMACHFCFNLIDAIWVGRLIGPAALA |
| Ga0134074_10397173 | 3300017657 | Grasslands Soil | VTTAARTTGALTVGPLRPVILRLAAPAVAMMACHFCFNLIDAIWV |
| Ga0184618_100717983 | 3300018071 | Groundwater Sediment | VTTGALTVGPLRPVVLKLAAPAVAMMACHFSFNLIDSIWVGRLIGPAA |
| Ga0066667_106248902 | 3300018433 | Grasslands Soil | MTSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLID |
| Ga0066667_110214101 | 3300018433 | Grasslands Soil | VTTAARVTGGGALTVGPLRPVILRLAAPAVAMMACHFCFNLIDSIWVGRLIGPAAL |
| Ga0066669_102178391 | 3300018482 | Grasslands Soil | MTSAIRVPGSLTVGPLRPVILQLAAPAVAMMACHFCFNLIDSIWV |
| Ga0193756_10538832 | 3300019866 | Soil | MTTGGGALTVGPLRPVVLKLAAPAVAMMACHFSFNLIDSIWVGRLI |
| Ga0215015_105275172 | 3300021046 | Soil | MTSIARTTGSLTGGPLRPVILKLAAPAVAIMACHFCFNLIDSIWVG |
| Ga0210379_101341643 | 3300021081 | Groundwater Sediment | VTTGTTGVLTVGPLRPVVLKLAAPAVAMMACHFSFNLIDSIWVGRLI |
| Ga0207653_102482952 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MISTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDA |
| Ga0207685_103613092 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSVAGTPPSPPGSLTVGPLRPVVLKLAMPAVAMMACHFCFNLIDAIWVGNLIG |
| Ga0207646_108410352 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VTTAAGPAGVLTVGPLRSAVLRLAVPAVAMMACHFCFNLID |
| Ga0207665_107471752 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VSDVAAPAGRLTTGDLRPTILRLAAPTVAMMAFNTGFNVIDSVWVGRLIGPAA |
| Ga0209350_10188653 | 3300026277 | Grasslands Soil | MTTVARTPGSLTVGPLRPVILRLAAPAVAMMACHFCFNLIDSIWVGRLIGP |
| Ga0209350_11310672 | 3300026277 | Grasslands Soil | MTSATRAPGSLTVGPLRPAILQLAAPAVAMMACHFCFNLIDSIWVGRLIGPAALAA |
| Ga0209350_11506851 | 3300026277 | Grasslands Soil | MTSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIGPAALAAV |
| Ga0209235_11945621 | 3300026296 | Grasslands Soil | VTTLARPAGTLTVGPLRPVILRLAAPAVAMMACHFCFN |
| Ga0209027_10013291 | 3300026300 | Grasslands Soil | MISTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRL |
| Ga0209469_11304441 | 3300026307 | Soil | MTSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDA |
| Ga0209265_10020431 | 3300026308 | Soil | MTSVTRAPGSLTVGPLRPVILQLAAPAVAMMACHFCFN |
| Ga0209153_11908062 | 3300026312 | Soil | MTSATRVPGSLTVGPLRPVILQLAAPAVAMMACHFCFNLI |
| Ga0209159_10294274 | 3300026343 | Soil | MTTVARTPGSLTVGPLRPVILRLAAPAVAMMACHF |
| Ga0209159_11223901 | 3300026343 | Soil | MTSTSRTPGALTVGPLRPVILNLAAPAVAMMACHFCFNLIDAIWVGRLIGPAALAAVSTA |
| Ga0209059_10988822 | 3300026527 | Soil | MISTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAI |
| Ga0209058_11214731 | 3300026536 | Soil | MTTVARTPGSLTVGPLRPVILRLAVPAVAMMACHFSFNLIDSVWVGRLIGA |
| Ga0209157_10945881 | 3300026537 | Soil | VTTLARPAGTLTVGPLRPVILRLAAPAVAMMACHFCFNLIDSIWV |
| Ga0209056_1000593613 | 3300026538 | Soil | MTTAARPEGALTVGPLRPVILRLATPAVAMMAWAG |
| Ga0209056_100567701 | 3300026538 | Soil | MTSTSRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLI |
| Ga0209376_12812822 | 3300026540 | Soil | MTSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIGPAA |
| Ga0209156_102116751 | 3300026547 | Soil | MTSAIRVPGSLTVGPLRPVILQLAAPAVAMMACHFCFNLIDSIWVGR |
| Ga0209886_10043061 | 3300027273 | Groundwater Sand | VTAASIPTPGALTQGPLRPVILRLALPAVAMMGCHFTFNLIDMVWVGR |
| Ga0209076_11459162 | 3300027643 | Vadose Zone Soil | VTTAARPDGALTVGPLRPVILRLGIPAVAMMACHFSFNVIDSLW |
| Ga0209177_101481141 | 3300027775 | Agricultural Soil | MTSVAGTPPSPPGSLTVGPLRPVILKLATPAVAMM |
| Ga0209177_101663332 | 3300027775 | Agricultural Soil | MTSVVRTPGSLTVGPLRPVILKLAAPAVAMMACHFTFN |
| Ga0209590_101635191 | 3300027882 | Vadose Zone Soil | VTTAARPAGSLTVGPLRPVILRLALPAVAMMACHFCFNLIDSVWVGRLI |
| Ga0209382_107669121 | 3300027909 | Populus Rhizosphere | VTTATAGALTVGPLRPVVLKLAAPAVAMMACHFSFNLIDSIWVGR |
| Ga0137415_100964671 | 3300028536 | Vadose Zone Soil | MISTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIGPAA |
| Ga0307293_100422713 | 3300028711 | Soil | VTAGALTVGPLRPVVLKLAAPAVAMMACHFSFNLIDSIWVGRLI |
| Ga0307282_100343755 | 3300028784 | Soil | LTVGPLRPVVLGLAVPAVAMMACHFSFNLIDSIWVGRLIGPAALA |
| Ga0307302_104759521 | 3300028814 | Soil | MTSVARTPGSLTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIWVGRLIGP |
| Ga0307308_103142681 | 3300028884 | Soil | LTVGPLRPVVLGLAVPAVAMMACHFSFNLIDSIWVGRLIGPAAL |
| Ga0307469_1000136511 | 3300031720 | Hardwood Forest Soil | MTSTTRPPGALTVGPLRPVILNLAAPAVAMMACHFCFNLIDAIWVGRLIGPAALAAVS |
| Ga0307477_107569871 | 3300031753 | Hardwood Forest Soil | VPAGRLTTGALRPTILRLAAPTVAMMAFNTGFYVIDSMWVGRLIGPA |
| Ga0307479_102123443 | 3300031962 | Hardwood Forest Soil | VTTAARPEGALTVGPLRPVILRLAIPAVAMMACHFSFNVIDSLWVGRLIG |
| Ga0326597_121327092 | 3300031965 | Soil | VTPAAGSSLTEGPLRPVILRLALPAVGMMACHFTFNLVDTIWVGRL |
| Ga0307470_117209082 | 3300032174 | Hardwood Forest Soil | MTSVAGTPGSLTVGPLRPVILKLAAPAVAMMACHFCFNLID |
| Ga0307471_1003038611 | 3300032180 | Hardwood Forest Soil | VTVTARPAGVLTVGPLRPAILKLALPAVAMMACHFCFNLIDSIWVGRLIGPAALAAVS |
| Ga0307471_1030662141 | 3300032180 | Hardwood Forest Soil | MMSTTRTPGALTVGPLRPVILKLAAPAVAMMACHFCFNLIDAIW |
| Ga0326730_11087262 | 3300033500 | Peat Soil | VTETAAGTPGALTTGPLRPVILRLALPAVAMMACHFT |
| Ga0314864_0032425_1_141 | 3300033805 | Peatland | MTEAAAGAPGILTHGPLRPVILRLALPAVAMMACHFTFGLIDAVWVG |
| ⦗Top⦘ |