NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F040361

Metagenome / Metatranscriptome Family F040361

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040361
Family Type Metagenome / Metatranscriptome
Number of Sequences 162
Average Sequence Length 43 residues
Representative Sequence IRILLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWKLHPE
Number of Associated Samples 131
Number of Associated Scaffolds 162

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 95.06 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (54.321 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(21.605 % of family members)
Environment Ontology (ENVO) Unclassified
(24.691 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.531 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 53.62%    β-sheet: 0.00%    Coil/Unstructured: 46.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 162 Family Scaffolds
PF00582Usp 43.21
PF00067p450 13.58
PF07883Cupin_2 1.85
PF01381HTH_3 1.23
PF02694UPF0060 0.62
PF07282OrfB_Zn_ribbon 0.62
PF13561adh_short_C2 0.62
PF00117GATase 0.62
PF01979Amidohydro_1 0.62
PF13193AMP-binding_C 0.62
PF00732GMC_oxred_N 0.62
PF13520AA_permease_2 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 162 Family Scaffolds
COG2124Cytochrome P450Defense mechanisms [V] 13.58
COG1742Uncharacterized inner membrane protein YnfA, drug/metabolite transporter superfamilyGeneral function prediction only [R] 0.62
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms54.32 %
UnclassifiedrootN/A45.68 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005332|Ga0066388_108260882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300005334|Ga0068869_100822992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium799Open in IMG/M
3300005345|Ga0070692_10817318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium638Open in IMG/M
3300005363|Ga0008090_15776872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1563Open in IMG/M
3300005434|Ga0070709_11599736Not Available531Open in IMG/M
3300005435|Ga0070714_102258083Not Available529Open in IMG/M
3300005468|Ga0070707_101384783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria670Open in IMG/M
3300005563|Ga0068855_101462925Not Available702Open in IMG/M
3300005577|Ga0068857_101136929Not Available755Open in IMG/M
3300005578|Ga0068854_101767522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300005602|Ga0070762_11043095Not Available562Open in IMG/M
3300005618|Ga0068864_102182193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300005764|Ga0066903_102968458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium919Open in IMG/M
3300005764|Ga0066903_103674775Not Available825Open in IMG/M
3300005764|Ga0066903_105847922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium646Open in IMG/M
3300005764|Ga0066903_106945244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium avium complex (MAC) → Mycobacterium intracellulare → Mycobacterium intracellulare subsp. yongonense → Mycobacterium intracellulare subsp. yongonense 05-1390587Open in IMG/M
3300006028|Ga0070717_10982144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria769Open in IMG/M
3300006163|Ga0070715_10585748Not Available652Open in IMG/M
3300006173|Ga0070716_100497546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria898Open in IMG/M
3300006575|Ga0074053_11882290Not Available713Open in IMG/M
3300006605|Ga0074057_12328611Not Available633Open in IMG/M
3300006806|Ga0079220_11499317Not Available578Open in IMG/M
3300006806|Ga0079220_11631752Not Available560Open in IMG/M
3300006844|Ga0075428_100708906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1072Open in IMG/M
3300006854|Ga0075425_100875285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1028Open in IMG/M
3300006854|Ga0075425_101355979Not Available805Open in IMG/M
3300006903|Ga0075426_11073066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium609Open in IMG/M
3300006954|Ga0079219_10263747Not Available1036Open in IMG/M
3300006954|Ga0079219_10796666Not Available741Open in IMG/M
3300006954|Ga0079219_12067713Not Available544Open in IMG/M
3300009101|Ga0105247_10332744Not Available1063Open in IMG/M
3300009176|Ga0105242_10719120Not Available979Open in IMG/M
3300009553|Ga0105249_10730016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1052Open in IMG/M
3300009792|Ga0126374_11144098Not Available620Open in IMG/M
3300010046|Ga0126384_11952067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300010358|Ga0126370_10261141Not Available1350Open in IMG/M
3300010358|Ga0126370_11135597Not Available722Open in IMG/M
3300010359|Ga0126376_11069672Not Available812Open in IMG/M
3300010359|Ga0126376_11514340Not Available700Open in IMG/M
3300010360|Ga0126372_10283978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1443Open in IMG/M
3300010360|Ga0126372_10969782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria859Open in IMG/M
3300010361|Ga0126378_11739642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium709Open in IMG/M
3300010361|Ga0126378_13420536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300010366|Ga0126379_10157865All Organisms → cellular organisms → Bacteria2125Open in IMG/M
3300010366|Ga0126379_13087128Not Available557Open in IMG/M
3300010371|Ga0134125_12446955Not Available568Open in IMG/M
3300010371|Ga0134125_12689622Not Available541Open in IMG/M
3300010375|Ga0105239_11686164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria733Open in IMG/M
3300010376|Ga0126381_101021617Not Available1193Open in IMG/M
3300010376|Ga0126381_101552964Not Available956Open in IMG/M
3300010379|Ga0136449_102377738Not Available765Open in IMG/M
3300010396|Ga0134126_11398004Not Available773Open in IMG/M
3300010398|Ga0126383_13071055Not Available545Open in IMG/M
3300010880|Ga0126350_10972391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium954Open in IMG/M
3300012096|Ga0137389_11808107Not Available507Open in IMG/M
3300012189|Ga0137388_10379643Not Available1306Open in IMG/M
3300012200|Ga0137382_10770324Not Available691Open in IMG/M
3300012201|Ga0137365_10991632Not Available610Open in IMG/M
3300012209|Ga0137379_10546577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus poikilotrophus1066Open in IMG/M
3300012209|Ga0137379_10925025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia777Open in IMG/M
3300012350|Ga0137372_10000810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia30252Open in IMG/M
3300012351|Ga0137386_10241032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1300Open in IMG/M
3300012961|Ga0164302_11232317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300012971|Ga0126369_10106697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2548Open in IMG/M
3300013296|Ga0157374_10430798Not Available1319Open in IMG/M
3300014056|Ga0120125_1175872Not Available528Open in IMG/M
3300014969|Ga0157376_12928087Not Available517Open in IMG/M
3300015359|Ga0134085_10478691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium567Open in IMG/M
3300016270|Ga0182036_10810480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria763Open in IMG/M
3300016270|Ga0182036_11100827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria658Open in IMG/M
3300016270|Ga0182036_11349320Not Available596Open in IMG/M
3300016294|Ga0182041_10789248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria848Open in IMG/M
3300016387|Ga0182040_10818034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium768Open in IMG/M
3300017942|Ga0187808_10222282Not Available842Open in IMG/M
3300017961|Ga0187778_10550257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium770Open in IMG/M
3300017961|Ga0187778_10658102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium706Open in IMG/M
3300017972|Ga0187781_10839790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium668Open in IMG/M
3300017974|Ga0187777_11305094Not Available533Open in IMG/M
3300018064|Ga0187773_10734597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300019362|Ga0173479_10820986Not Available517Open in IMG/M
3300019888|Ga0193751_1022303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3096Open in IMG/M
3300020010|Ga0193749_1065891Not Available681Open in IMG/M
3300020082|Ga0206353_10812466Not Available873Open in IMG/M
3300020580|Ga0210403_10317605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1276Open in IMG/M
3300021403|Ga0210397_10176164Not Available1513Open in IMG/M
3300021478|Ga0210402_10587509Not Available1033Open in IMG/M
3300021559|Ga0210409_10913360Not Available752Open in IMG/M
3300021560|Ga0126371_10949757Not Available1002Open in IMG/M
3300021560|Ga0126371_11001507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium977Open in IMG/M
3300021560|Ga0126371_11482459Not Available807Open in IMG/M
3300021560|Ga0126371_13826021Not Available507Open in IMG/M
3300024251|Ga0247679_1078715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300024331|Ga0247668_1119548Not Available534Open in IMG/M
3300025321|Ga0207656_10704541Not Available517Open in IMG/M
3300025898|Ga0207692_10021681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2942Open in IMG/M
3300025898|Ga0207692_10773412Not Available627Open in IMG/M
3300025903|Ga0207680_10317313Not Available1089Open in IMG/M
3300025905|Ga0207685_10460741Not Available663Open in IMG/M
3300025906|Ga0207699_10311414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1102Open in IMG/M
3300025910|Ga0207684_10351108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1269Open in IMG/M
3300025915|Ga0207693_11120964Not Available597Open in IMG/M
3300025931|Ga0207644_10793396Not Available792Open in IMG/M
3300025936|Ga0207670_11020118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria697Open in IMG/M
3300026095|Ga0207676_11876969Not Available598Open in IMG/M
3300026304|Ga0209240_1090498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1112Open in IMG/M
3300026310|Ga0209239_1225879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300026316|Ga0209155_1239227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium563Open in IMG/M
3300027725|Ga0209178_1254134Not Available636Open in IMG/M
3300027725|Ga0209178_1261214Not Available628Open in IMG/M
3300027775|Ga0209177_10258205Not Available647Open in IMG/M
3300027857|Ga0209166_10293440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium856Open in IMG/M
3300027884|Ga0209275_10733249Not Available569Open in IMG/M
3300027903|Ga0209488_10048616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3119Open in IMG/M
3300028875|Ga0307289_10141057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium990Open in IMG/M
3300028906|Ga0308309_11523450Not Available571Open in IMG/M
3300030494|Ga0310037_10477159Not Available508Open in IMG/M
3300030580|Ga0311355_10331402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1516Open in IMG/M
3300031128|Ga0170823_13352574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300031474|Ga0170818_111214407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium730Open in IMG/M
3300031561|Ga0318528_10560930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300031573|Ga0310915_10857115Not Available638Open in IMG/M
3300031668|Ga0318542_10775089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300031680|Ga0318574_10663519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria611Open in IMG/M
3300031680|Ga0318574_10859364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300031681|Ga0318572_10438963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium777Open in IMG/M
3300031713|Ga0318496_10167917Not Available1201Open in IMG/M
3300031720|Ga0307469_11185570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria721Open in IMG/M
3300031720|Ga0307469_12212419Not Available536Open in IMG/M
3300031744|Ga0306918_10624928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium844Open in IMG/M
3300031748|Ga0318492_10344137Not Available780Open in IMG/M
3300031751|Ga0318494_10287232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium947Open in IMG/M
3300031765|Ga0318554_10310756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium896Open in IMG/M
3300031765|Ga0318554_10708438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300031769|Ga0318526_10265800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium702Open in IMG/M
3300031782|Ga0318552_10204829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria998Open in IMG/M
3300031795|Ga0318557_10357190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium672Open in IMG/M
3300031798|Ga0318523_10060042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1807Open in IMG/M
3300031799|Ga0318565_10009336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3997Open in IMG/M
3300031799|Ga0318565_10143947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1155Open in IMG/M
3300031799|Ga0318565_10565463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300031821|Ga0318567_10321057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium874Open in IMG/M
3300031831|Ga0318564_10174624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium958Open in IMG/M
3300031833|Ga0310917_10822343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium627Open in IMG/M
3300031897|Ga0318520_10289874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium984Open in IMG/M
3300031897|Ga0318520_10550752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium715Open in IMG/M
3300031910|Ga0306923_11823629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300031941|Ga0310912_10292480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1260Open in IMG/M
3300031942|Ga0310916_10152795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1905Open in IMG/M
3300031945|Ga0310913_10886413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium628Open in IMG/M
3300031946|Ga0310910_10835844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria724Open in IMG/M
3300031954|Ga0306926_10231443Not Available2292Open in IMG/M
3300032008|Ga0318562_10720765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium573Open in IMG/M
3300032043|Ga0318556_10132503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1280Open in IMG/M
3300032180|Ga0307471_100541814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1317Open in IMG/M
3300032261|Ga0306920_101770745Not Available873Open in IMG/M
3300032261|Ga0306920_102886560Not Available652Open in IMG/M
3300032261|Ga0306920_103468106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia584Open in IMG/M
3300032783|Ga0335079_10445372Not Available1389Open in IMG/M
3300032895|Ga0335074_10458723Not Available1346Open in IMG/M
3300032898|Ga0335072_11435933Not Available594Open in IMG/M
3300032955|Ga0335076_10573512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1011Open in IMG/M
3300033158|Ga0335077_10955630Not Available859Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil21.60%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil12.35%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.79%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.09%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.09%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.09%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.09%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.47%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.47%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.23%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.23%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.23%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.23%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.23%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.23%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.23%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.23%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.62%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.62%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.62%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.62%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.62%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.62%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.62%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.62%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.62%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.62%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014056Permafrost microbial communities from Nunavut, Canada - A20_5cm_0MEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020010Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066388_10826088223300005332Tropical Forest SoilIRILLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWKLHPE*
Ga0068869_10082299213300005334Miscanthus RhizosphereQLLLLLPVVMSFWFLFYMPRWRRRVREKARSLRRWNLHPE*
Ga0070692_1081731823300005345Corn, Switchgrass And Miscanthus RhizosphereFTGLQLLLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWNLHPE*
Ga0008090_1577687233300005363Tropical Rainforest SoilRILILLPVIMGFWFIFYMPRWRRRVREQARSLQRWKLHPE*
Ga0070709_1159973623300005434Corn, Switchgrass And Miscanthus RhizosphereVLGFRILLLLPVLMSFWFLFYMPRWRRRVRQQARSLQRWQLHPE*
Ga0070714_10225808313300005435Agricultural SoilFRILLLLPVMMSFWYLFYMPRWRRRVRQRARSLTSWQLHPE*
Ga0070707_10138478323300005468Corn, Switchgrass And Miscanthus RhizosphereALVPFLGIPILLVLPLVMGFWYMFYMPRWRRRVREQARSLRKWKLRPE*
Ga0068855_10146292523300005563Corn RhizosphereGIRIMILLPVVMSFWFLFYMPRWRRRVRLQARSLQRWQLHPE*
Ga0068857_10113692923300005577Corn RhizosphereLLPVVMSFWFLFYMPRWRRRVRQRARSLTSWQLHPE*
Ga0068854_10176752213300005578Corn RhizosphereLLLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWQLHPE*
Ga0070762_1104309523300005602SoilPVVMSFWFLFYMPRWRRRVRQQARSLRKWKLHPE*
Ga0068864_10218219323300005618Switchgrass RhizosphereLVLPLVMGFWYMFYMPRWRRRVREQARSLRKWKLRPE*
Ga0066903_10296845813300005764Tropical Forest SoilLVPFLGIPILFVLPIAMGFWFMFYMPRWRRRVREQTRNLRKWKLRPE*
Ga0066903_10367477513300005764Tropical Forest SoilIALAPFLGPRILLLLPLVMGFWYLFYMPRWRRRVREQTRSLRKWKLRPE*
Ga0066903_10584792223300005764Tropical Forest SoilLLPIVMSFWFLFYMPRWRRRVREQARSLRRWKLHPE*
Ga0066903_10694524423300005764Tropical Forest SoilPILFVLPIVLGFWFMFYMPRWRRRVREHTRNLRKWKLRPD*
Ga0070717_1098214433300006028Corn, Switchgrass And Miscanthus RhizosphereLLPVLMSFWFLFYMPRWRRQVRERTRNLRRWKLHPE*
Ga0070715_1058574813300006163Corn, Switchgrass And Miscanthus RhizosphereLPVVMSFWFLFYMPRWRRRVRQQARSLQRWQLHPE*
Ga0070716_10049754613300006173Corn, Switchgrass And Miscanthus RhizosphereILLLLPVVMSFWFLFYMPRWRRRVRQRARSLTSWQLHPE*
Ga0074053_1188229013300006575SoilIPILILTAVAGIRILILLPVVMSFWFLFYMPRWRRRVRLQARNLQKWQLHPE*
Ga0074057_1232861123300006605SoilFLGIPILLVLPLVMGFWYMFYMPRWRRRVREQARSLRKWKLRPE*
Ga0079220_1149931723300006806Agricultural SoilVALSVVLGFRILLLLPVMMSFWYLFYMPRWRRRVRQRARSLTSWQLHPE*
Ga0079220_1163175223300006806Agricultural SoilILLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE*
Ga0075428_10070890633300006844Populus RhizosphereFLGIPILMVLPIVMGFWFVFYMPRWRRRVREQARNLRKWKLRPE*
Ga0075425_10087528513300006854Populus RhizospherePILALSTIAGIRILLLLPVVMSFWFLFYMPRWRRRVRQQARSLRRWNLHPE*
Ga0075425_10135597913300006854Populus RhizosphereIPILILTAVAGIRIMILLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE*
Ga0075426_1107306613300006903Populus RhizosphereLVPFLGIPILMVLPIVMGFWFVFYMPRWRRRVREQARSLRKWKLRPE*
Ga0079219_1026374713300006954Agricultural SoilGFRILLLLPVMMSFWYLFYMPRWRRRVRQRARSLTSWQLHPE*
Ga0079219_1079666613300006954Agricultural SoilLLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE*
Ga0079219_1206771323300006954Agricultural SoilPVVMGFWFLFYMPRWRRRVREQARSLRRWQLHPE*
Ga0105247_1033274413300009101Switchgrass RhizospherePILILTAVAGIKILALLPVVMGFWFLFYMPRWRRRVRLQARSLQRWQLHPE*
Ga0105242_1071912013300009176Miscanthus RhizosphereLLPVVMSFWFLFYMPRWRRRVRLQARSLQRWQLHPE*
Ga0105249_1073001633300009553Switchgrass RhizosphereIPILMVLPIVMGFWFVFYMPRWRRRVREQTRNLRKWKLRPE*
Ga0126374_1114409823300009792Tropical Forest SoilPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE*
Ga0126384_1195206723300010046Tropical Forest SoilGLRLLILLPVLMSFWFLFYMPRWRRQVRERARNLRRWKLHPE*
Ga0126370_1026114113300010358Tropical Forest SoilLAAFAGFQLLVLLPVVMGFWFIFYMPRWRRRVREKTRSLRRWQLHPE*
Ga0126370_1113559713300010358Tropical Forest SoilALTPFLGPRILLLIPLLMGFWYLFYMPRWRRQVREQARSLRKWKLRPE*
Ga0126376_1106967223300010359Tropical Forest SoilGLQLLLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWKLHPE*
Ga0126376_1151434023300010359Tropical Forest SoilLTPFLGPRILLLIPLLMGFWYLFYMPRWRRQVREQARSLRKWKLRPE*
Ga0126372_1028397833300010360Tropical Forest SoilPVVMGFWFMFYMPRWRRRVREQARSLRKWKLRPE*
Ga0126372_1096978223300010360Tropical Forest SoilGFQLLVLLPVVMGFWFFFYMPRWRRRVREQARSLRRWQLHPE*
Ga0126378_1173964233300010361Tropical Forest SoilVLPVVMGFWFMFYMPRWRRRVRENARNLRKWKLRPE*
Ga0126378_1342053623300010361Tropical Forest SoilVLLPVVMGFWFIFYMPRWRRRVREQARSLRRWQLHPE*
Ga0126379_1015786543300010366Tropical Forest SoilPFLGIPILFVIPIVMGFWFMFYMPRWRRRVREQTRNLRKWKLRPE*
Ga0126379_1308712813300010366Tropical Forest SoilAPFLGPRILLLLPLVMGFWYLFYMPRWRRRVREQTRSLRKWKLRPE*
Ga0134125_1244695513300010371Terrestrial SoilRVLLLLPIVMSFWFLFYMPRWRRRVRQKSRSLSRWQLHSE*
Ga0134125_1268962223300010371Terrestrial SoilLILTAVAGIRIMILLPVVMSFWFLFYMPRWRRRVRLQARSLQRWQLHPE*
Ga0105239_1168616423300010375Corn RhizospherePVVMSFWFLFYMPRWRRRVREQARSLRRWNLHPE*
Ga0126381_10102161733300010376Tropical Forest SoilGPRILLLVPLVMSFWYLFYMPRWRRRVREQARSLRKWKLRPE*
Ga0126381_10155296423300010376Tropical Forest SoilPFLGIRILLLLPVVMSFWFMFYMPRWRRQVRERARSLRRWKLHPE*
Ga0136449_10237773813300010379Peatlands SoilPVVMGFWFLFYMPRWRRRVRQQARSLRRWQLHPE*
Ga0134126_1139800413300010396Terrestrial SoilILTAVAGIRIMILLPVVMSFWFLFYMPRWRRRVRLRARRLQRWQLHPE*
Ga0126383_1307105513300010398Tropical Forest SoilPVVVLAAFGGFQLLVLLPVVMGFWFFFYMPRWRRRVREQARSLRRWKLHPE*
Ga0126350_1097239113300010880Boreal Forest SoilILALSLVAGIRILLLLPVAMSFWFIFYMPRWRRRVREQARSLRRWKLTPE*
Ga0137389_1180810713300012096Vadose Zone SoilPFLGPRILLLLPLVMGFWYLFYMPRWRRQVREQTRSLRKWKLRPE*
Ga0137388_1037964313300012189Vadose Zone SoilIPIVVLSVVAGIRILILLPVVMSFWFLCYVPRWRQRVREQARSLRKWQLHPE*
Ga0137382_1077032413300012200Vadose Zone SoilTAVAGIRILILLPVVMSFWFLFYMPRWRRRVRQQARNLQRWQLHPE*
Ga0137365_1099163223300012201Vadose Zone SoilVLGFRILLLLPVVMSFWFLFYMPRWRRRVRQQARSLQRWQLHPE*
Ga0137379_1054657713300012209Vadose Zone SoilLGVRIMMLLPIVLGFWFIFYMPRWRRRVREQARNLRKWKLRPE*
Ga0137379_1092502523300012209Vadose Zone SoilLTAVAGIRILILLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE*
Ga0137372_10000810313300012350Vadose Zone SoilLILLPVVMSFWFLFYMPRWRRRVRLQARNLQKWQLHPE*
Ga0137386_1024103233300012351Vadose Zone SoilAGFRILVLLPLVMGFWFMFYMPRWRRQVRERARSLRRWKLHPE*
Ga0164302_1123231723300012961SoilVVLALFTGLQLLLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWQLHPE*
Ga0126369_1010669743300012971Tropical Forest SoilVAGIRILLLLPVVMSFWFLFYMPRWRRRVRQRARSLTSWQLHPE*
Ga0157374_1043079813300013296Miscanthus RhizosphereRIMILLPVVMSFWFLFYMPRWRRRVRLQARSLQRWQLHPE*
Ga0120125_117587213300014056PermafrostLTPFAGIRILLLLPVVMSFWFMFYMPRWRRQVRERARNLRRWKLYPE*
Ga0157376_1292808713300014969Miscanthus RhizosphereILTAVAGIRIMILLPVVMSFWFLFYMPRWRRRVRLQARSLQRWQLHPE*
Ga0134085_1047869113300015359Grasslands SoilIAALVPFLGIPILFVLPIVMGFWFMFYMPRWRRRVREQARNLRKWKLRPE*
Ga0182036_1081048013300016270SoilVIVLAAFAGFQLLMLLPVVMGFWFFFYMPRWRRRVREQARSLRRWQLHPE
Ga0182036_1110082733300016270SoilVLLPVVMGFWFIFYMPRWRRRVREQARSLQRWQLHPE
Ga0182036_1134932023300016270SoilPIVAASVFLGIRILLLLPVVMGFWFLFYMPRWRRRVRQQARSLRRWKLHPE
Ga0182041_1078924823300016294SoilVPIVVLAAFAGFQLLVLLPVVMGFWFLFYMPRWRRRVREQARSLRRWQLHPE
Ga0182040_1081803413300016387SoilPLLGLRIMILLPLVMGFWFIFYMPRWRRRAREQARSLRRWKLRPE
Ga0187808_1022228213300017942Freshwater SedimentIRILILLPVLMSFWFIFYMPRWRRSVREQARSLRRWKLHPE
Ga0187778_1055025733300017961Tropical PeatlandGARIMILLPLLMGFWFILYMPRWRRRVREQARSLQKWKLRPE
Ga0187778_1065810233300017961Tropical PeatlandLLPVVLGGWYLWYMPMWRRRVRKRARNLPKWQLHPE
Ga0187781_1083979023300017972Tropical PeatlandAGLRILILLPVLMSFWFLFYMPRWRRQVRERARNLRRWKLHPE
Ga0187777_1130509423300017974Tropical PeatlandLPLVMGFWFILYMPRWRRRVREQARNLQKWKLRPE
Ga0187773_1073459723300018064Tropical PeatlandLGLQIMVLLPLVMGFWFIFYMPRWRRRVREQARSLQRWKLRPE
Ga0173479_1082098623300019362SoilGIRILILLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE
Ga0193751_102230313300019888SoilRILLLLPVVMSFWFMFYMPRWRRQVRQRARNLRSWKLYPE
Ga0193749_106589123300020010SoilFAGIRILLLLPVVMSFWFMFYMPRWRRQVRQRARNLRSWKLYPE
Ga0206353_1081246613300020082Corn, Switchgrass And Miscanthus RhizosphereAGIRILILLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE
Ga0210403_1031760513300020580SoilSVFGGIRILLLLPVVMSFWFLFYMPRWRRRVRQQARSLRRWKLHPE
Ga0210397_1017616423300021403SoilRILLLLPVVMSFWFLFYMPRWRRRVRQQARSLQRWQLHPE
Ga0210402_1058750913300021478SoilLLLPVLMSFWFLFYMPRWRRRVRQQARSLQRWQLHPE
Ga0210409_1091336023300021559SoilFRILLLLPVVMSFWFLFYMPRWRRRVRQQARNLTKWQLHPE
Ga0126371_1094975733300021560Tropical Forest SoilLVLLPVVMGFWFIFYMPRWRRRVREQARSLRRWQLHPE
Ga0126371_1100150733300021560Tropical Forest SoilFVIPIVMGFWFMFYMPRWRRRVREQARNLRKWKLRPD
Ga0126371_1148245933300021560Tropical Forest SoilPRILLLLPLVMGFWYLFYMPRWRRRVRERTRSLHKWKLRPE
Ga0126371_1382602123300021560Tropical Forest SoilGFQLLVLLPVVMGFWFIFYMPRWRRRVREQARNLRRWQLHPE
Ga0247679_107871513300024251SoilQLLLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWNLHPE
Ga0247668_111954823300024331SoilRILLLLPVLMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE
Ga0207656_1070454123300025321Corn RhizosphereAGIRIMILLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHRE
Ga0207692_1002168153300025898Corn, Switchgrass And Miscanthus RhizosphereLVLPLVMGFWYMFYMPRWRRRVREQARSLRKWKLRPE
Ga0207692_1077341213300025898Corn, Switchgrass And Miscanthus RhizosphereSTVVGLRVLLLLPIVMSFWFLFYMPRWRRRVRQKSRSLSRWQLHPE
Ga0207680_1031731323300025903Switchgrass RhizosphereRIMILLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE
Ga0207685_1046074123300025905Corn, Switchgrass And Miscanthus RhizosphereLLLLPVVMSFWFLFYMPRWRRRVRQQARSLQRWQLHPE
Ga0207699_1031141433300025906Corn, Switchgrass And Miscanthus RhizosphereVPFLGIPILFVLPVVMDFWFMLYMPRWRRRVREQARNMRKWQLRPE
Ga0207684_1035110833300025910Corn, Switchgrass And Miscanthus RhizospherePVAGIRILMLLPLAMGFWFMFYMPRWRRQVREHARNLRRWKPHPE
Ga0207693_1112096423300025915Corn, Switchgrass And Miscanthus RhizosphereALSVVLGLRILLLLPVVMSFWFLFYMPRWRRRVRQQARSLQRWQLHPE
Ga0207644_1079339613300025931Switchgrass RhizosphereLTAVAGIRIMILLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE
Ga0207670_1102011813300025936Switchgrass RhizosphereVLPLVMGFWYMFYMPRWRRRVREQARSLRKWKLRPE
Ga0207676_1187696913300026095Switchgrass RhizosphereLLLPVVMSFWFLFYMPRWRRRVRQRARSLTSWQLHPE
Ga0209240_109049813300026304Grasslands SoilLRLLLLLPVLMSFWFLFYMPRWRRQVRQRARSLRRWKLHPE
Ga0209239_122587913300026310Grasslands SoilLGIPILLVLPLVMGFWYMFYMPRWRRRVREQARSLRKWKLSPE
Ga0209155_123922723300026316SoilIAALVPFLGIPILLVMPIVMGFWFVFYMPRWRRRVREQARSLRKWKLRPE
Ga0209178_125413423300027725Agricultural SoilTAVAGIKILALLPVVMGFWFLFYMPRWRRRVRLQARSLQRWQLHPE
Ga0209178_126121413300027725Agricultural SoilILALSAIAGIRILLLLPVVMSFWFLFYMPRWRRRVRQQARSLRRWNLHPE
Ga0209177_1025820523300027775Agricultural SoilLLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE
Ga0209166_1029344023300027857Surface SoilFLGPRILLLLPLVMGFWYLFYMPRWRRQVRAQARNLRKWKLRPE
Ga0209275_1073324923300027884SoilLLPVVMSFWFLFYMPRWRRRVREQARSLRRWKLHPE
Ga0209488_1004861643300027903Vadose Zone SoilFRILLLLPVLMSFWFLFYMPRWRRRVRQQARSLQRWQLHPE
Ga0307289_1014105713300028875SoilVLPIVMGFWFVFYMPRWRRRVREQARSLRKWKLRPE
Ga0308309_1152345023300028906SoilVPIVALSVVLGFRILLLLPVVMSFWFLFYMPRWRRRVRQQARSLQRWQLHPE
Ga0310037_1047715913300030494Peatlands SoilLSAFAGPRILMLLPVVMGFWFLFYMPRWRRRVREQARNLRRWQLHPE
Ga0311355_1033140213300030580PalsaLRILLLLPVLMSFWFLFYMPRWRREVRQRARSLRRWQLHPE
Ga0170823_1335257423300031128Forest SoilLGLRLLLLLPVLMSFWFLFYMPRWRRQVRERARNLTRWQLHPE
Ga0170818_11121440723300031474Forest SoilAAVAGIRIMLLLPVVMSFWFLFYMPRWRRRVRQQARSLRRWKLHPE
Ga0318528_1056093023300031561SoilTRIMIVLPLVMGFWFILYMPRWRRRVREQARSLQKWKLRPE
Ga0310915_1085711523300031573SoilPIVALSLFAGIRILLLLPVVMGFWFLFYMPRWRRRVRQQARSLRRWKLHPE
Ga0318542_1077508923300031668SoilLVPFAGTRILILLPVIMGFWFVFYMPRWRRRVREQARSLRRWNLHPE
Ga0318574_1066351913300031680SoilLMLLPVVMGFWFIFYMPRWRRRVREHARSLQRWQLHPE
Ga0318574_1085936413300031680SoilPVVALVPFAGARILILLPVIMGFWFVFYMPRWRRRVREQARSLRRWNLHPE
Ga0318572_1043896323300031681SoilVALIPLLGTRIMILLPLVMGFWFILYMPRWRRRVREQARSLQKWKLRPE
Ga0318496_1016791713300031713SoilLLVLLPVVMGFWFLFYMPRWRRRVREQARSLRRWQLHPE
Ga0307469_1118557013300031720Hardwood Forest SoilILFVLPVLMGFWFMFYMPRWRRRVREHARNLRKWKLRPE
Ga0307469_1221241923300031720Hardwood Forest SoilQLLILLPVVMSFWFLFYMPRWRRRVREQARSLRRWNLHPE
Ga0306918_1062492813300031744SoilLGLRIMILLPLVMGFWFIFYMPRWRRRAREQARSLRRWKLRPE
Ga0318492_1034413713300031748SoilLLPVVMSFWFLFYMPRWRRRVREQARSLRRWKLTPE
Ga0318494_1028723233300031751SoilGTRIMIVLPLVMGFWFILYMPRWRRRVREQARSLQKWKLRPE
Ga0318554_1031075633300031765SoilLILLPVIMGFWFVFYMPRWRRRVREQARSLRRWNLHPE
Ga0318554_1070843823300031765SoilGFQLLMLLPVVMGFWFIFYMPRWRRRVREHARSLQRWQLHPE
Ga0318526_1026580023300031769SoilVPVFGTRVMILLPVVMGFWFVFYMPRWRRRVREQARSLQKWTLRPE
Ga0318552_1020482913300031782SoilPVAGFQLLVLLPVVMGFWFIFYMPRWRRRVREHARSLQRWQLHPE
Ga0318557_1035719013300031795SoilLLGLRIMILLPLVMGFWFIFYMPRWRRRAREQARSLRRWKLRPE
Ga0318523_1006004213300031798SoilIMILLPLVMGFWFIFYMPRWRRRAREQARSLRRWKLRPE
Ga0318565_1000933613300031799SoilLRIMILLPLVMGFWFIFYMPRWRRRAREQARSLRRWKLRPE
Ga0318565_1014394733300031799SoilIPLLGARIMVLLPLVMGFWFILYMPRWRRRVREQARSLQKWTLRPE
Ga0318565_1056546313300031799SoilAFAGFQLLVLLPVVMGFWFIFYMPRWRRRVREQARSLQRWQLHPE
Ga0318567_1032105713300031821SoilMVLLPLVMGFWFILYMPRWRRRVREQARSLQKWTLRPE
Ga0318564_1017462433300031831SoilVALIPLLGPRIMILLPLVMGFWFILYMPRWRRRVREQARSLQKWTLRPE
Ga0310917_1082234323300031833SoilFAGIRILLLLPVVMGFWFLFYMPRWRRRVRQQARSLRRWKLHPE
Ga0318520_1028987413300031897SoilLPLVMGFWFIFYMPRWRRRAREQARSLRRWKLRPE
Ga0318520_1055075223300031897SoilGLRILLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWKLHPE
Ga0306923_1182362923300031910SoilVALAAFAGFQLLVLLPVVMGFWFIFYMPRWRRRVREQARSLQRWQLHPE
Ga0310912_1029248043300031941SoilGLRIMILLPLVMGFWFIFYMPRWRRRAREQARSLRRWKLRPE
Ga0310916_1015279513300031942SoilMILLPLVMGFWFIFYMPRWRRRAREQARSLRRWKLRPE
Ga0310913_1088641313300031945SoilFVALIPLLGARIMVLLPLVMGFWFILYMPRWRRRVREQARSLQKWTLRPE
Ga0310910_1083584423300031946SoilMLLPVVMGFWFIFYMPRWRRRVREHARSLQRWQLHPE
Ga0306926_1023144343300031954SoilAGFQLLVLLPVVMGFWFIFYMPRWRRRVREQARSLRRWQLHPE
Ga0318562_1072076523300032008SoilPIVALSVVGGLRILLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWKLHPE
Ga0318556_1013250333300032043SoilFQLLVLLPVVMGFWFIFYMPRWRRRVREQARSLQRWQLHPE
Ga0307471_10054181433300032180Hardwood Forest SoilSVFGGIRFLLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWKLHPE
Ga0306920_10177074513300032261SoilLLPVVMGFWFLFYMPRWRRRVRQQARSLRRWKLHPE
Ga0306920_10288656023300032261SoilILLLLPLVMSFWYLFYMPRWRRRVREQARSLRKWKLRPE
Ga0306920_10346810613300032261SoilLPVLLSFWFLFYMPRWRRRVREQARNLRRWQLHPE
Ga0335079_1044537233300032783SoilAVLTPFLGIRIVLLLPVVMSFWFMFYMPRWRRRVREQTRNLLKWKLRPE
Ga0335074_1045872313300032895SoilAGVRIPLLLPVVMGFWYMFYMPRWRRQVRERARNLRRWKLHPE
Ga0335072_1143593323300032898SoilLPVLMSFWFIFYMPRWRRRVRQKARSLNRWQLHPE
Ga0335076_1057351213300032955SoilILFVLPIAMGFWFMFYMPRWRRRVREQTRNLRKWKLRPE
Ga0335077_1095563023300033158SoilLSVVLGFRILLLLPVLMSFWYLFYMPRWRRRVRQQARSLQRWQLHPE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.