| Basic Information | |
|---|---|
| Family ID | F040361 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 162 |
| Average Sequence Length | 43 residues |
| Representative Sequence | IRILLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWKLHPE |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 162 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 95.06 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (54.321 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.605 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.691 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.531 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.62% β-sheet: 0.00% Coil/Unstructured: 46.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 162 Family Scaffolds |
|---|---|---|
| PF00582 | Usp | 43.21 |
| PF00067 | p450 | 13.58 |
| PF07883 | Cupin_2 | 1.85 |
| PF01381 | HTH_3 | 1.23 |
| PF02694 | UPF0060 | 0.62 |
| PF07282 | OrfB_Zn_ribbon | 0.62 |
| PF13561 | adh_short_C2 | 0.62 |
| PF00117 | GATase | 0.62 |
| PF01979 | Amidohydro_1 | 0.62 |
| PF13193 | AMP-binding_C | 0.62 |
| PF00732 | GMC_oxred_N | 0.62 |
| PF13520 | AA_permease_2 | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 162 Family Scaffolds |
|---|---|---|---|
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 13.58 |
| COG1742 | Uncharacterized inner membrane protein YnfA, drug/metabolite transporter superfamily | General function prediction only [R] | 0.62 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.32 % |
| Unclassified | root | N/A | 45.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005332|Ga0066388_108260882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300005334|Ga0068869_100822992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 799 | Open in IMG/M |
| 3300005345|Ga0070692_10817318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
| 3300005363|Ga0008090_15776872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1563 | Open in IMG/M |
| 3300005434|Ga0070709_11599736 | Not Available | 531 | Open in IMG/M |
| 3300005435|Ga0070714_102258083 | Not Available | 529 | Open in IMG/M |
| 3300005468|Ga0070707_101384783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 670 | Open in IMG/M |
| 3300005563|Ga0068855_101462925 | Not Available | 702 | Open in IMG/M |
| 3300005577|Ga0068857_101136929 | Not Available | 755 | Open in IMG/M |
| 3300005578|Ga0068854_101767522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
| 3300005602|Ga0070762_11043095 | Not Available | 562 | Open in IMG/M |
| 3300005618|Ga0068864_102182193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300005764|Ga0066903_102968458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 919 | Open in IMG/M |
| 3300005764|Ga0066903_103674775 | Not Available | 825 | Open in IMG/M |
| 3300005764|Ga0066903_105847922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300005764|Ga0066903_106945244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium avium complex (MAC) → Mycobacterium intracellulare → Mycobacterium intracellulare subsp. yongonense → Mycobacterium intracellulare subsp. yongonense 05-1390 | 587 | Open in IMG/M |
| 3300006028|Ga0070717_10982144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 769 | Open in IMG/M |
| 3300006163|Ga0070715_10585748 | Not Available | 652 | Open in IMG/M |
| 3300006173|Ga0070716_100497546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 898 | Open in IMG/M |
| 3300006575|Ga0074053_11882290 | Not Available | 713 | Open in IMG/M |
| 3300006605|Ga0074057_12328611 | Not Available | 633 | Open in IMG/M |
| 3300006806|Ga0079220_11499317 | Not Available | 578 | Open in IMG/M |
| 3300006806|Ga0079220_11631752 | Not Available | 560 | Open in IMG/M |
| 3300006844|Ga0075428_100708906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1072 | Open in IMG/M |
| 3300006854|Ga0075425_100875285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1028 | Open in IMG/M |
| 3300006854|Ga0075425_101355979 | Not Available | 805 | Open in IMG/M |
| 3300006903|Ga0075426_11073066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 3300006954|Ga0079219_10263747 | Not Available | 1036 | Open in IMG/M |
| 3300006954|Ga0079219_10796666 | Not Available | 741 | Open in IMG/M |
| 3300006954|Ga0079219_12067713 | Not Available | 544 | Open in IMG/M |
| 3300009101|Ga0105247_10332744 | Not Available | 1063 | Open in IMG/M |
| 3300009176|Ga0105242_10719120 | Not Available | 979 | Open in IMG/M |
| 3300009553|Ga0105249_10730016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1052 | Open in IMG/M |
| 3300009792|Ga0126374_11144098 | Not Available | 620 | Open in IMG/M |
| 3300010046|Ga0126384_11952067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
| 3300010358|Ga0126370_10261141 | Not Available | 1350 | Open in IMG/M |
| 3300010358|Ga0126370_11135597 | Not Available | 722 | Open in IMG/M |
| 3300010359|Ga0126376_11069672 | Not Available | 812 | Open in IMG/M |
| 3300010359|Ga0126376_11514340 | Not Available | 700 | Open in IMG/M |
| 3300010360|Ga0126372_10283978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1443 | Open in IMG/M |
| 3300010360|Ga0126372_10969782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 859 | Open in IMG/M |
| 3300010361|Ga0126378_11739642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 709 | Open in IMG/M |
| 3300010361|Ga0126378_13420536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300010366|Ga0126379_10157865 | All Organisms → cellular organisms → Bacteria | 2125 | Open in IMG/M |
| 3300010366|Ga0126379_13087128 | Not Available | 557 | Open in IMG/M |
| 3300010371|Ga0134125_12446955 | Not Available | 568 | Open in IMG/M |
| 3300010371|Ga0134125_12689622 | Not Available | 541 | Open in IMG/M |
| 3300010375|Ga0105239_11686164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
| 3300010376|Ga0126381_101021617 | Not Available | 1193 | Open in IMG/M |
| 3300010376|Ga0126381_101552964 | Not Available | 956 | Open in IMG/M |
| 3300010379|Ga0136449_102377738 | Not Available | 765 | Open in IMG/M |
| 3300010396|Ga0134126_11398004 | Not Available | 773 | Open in IMG/M |
| 3300010398|Ga0126383_13071055 | Not Available | 545 | Open in IMG/M |
| 3300010880|Ga0126350_10972391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 954 | Open in IMG/M |
| 3300012096|Ga0137389_11808107 | Not Available | 507 | Open in IMG/M |
| 3300012189|Ga0137388_10379643 | Not Available | 1306 | Open in IMG/M |
| 3300012200|Ga0137382_10770324 | Not Available | 691 | Open in IMG/M |
| 3300012201|Ga0137365_10991632 | Not Available | 610 | Open in IMG/M |
| 3300012209|Ga0137379_10546577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus poikilotrophus | 1066 | Open in IMG/M |
| 3300012209|Ga0137379_10925025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 777 | Open in IMG/M |
| 3300012350|Ga0137372_10000810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 30252 | Open in IMG/M |
| 3300012351|Ga0137386_10241032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1300 | Open in IMG/M |
| 3300012961|Ga0164302_11232317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300012971|Ga0126369_10106697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2548 | Open in IMG/M |
| 3300013296|Ga0157374_10430798 | Not Available | 1319 | Open in IMG/M |
| 3300014056|Ga0120125_1175872 | Not Available | 528 | Open in IMG/M |
| 3300014969|Ga0157376_12928087 | Not Available | 517 | Open in IMG/M |
| 3300015359|Ga0134085_10478691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300016270|Ga0182036_10810480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 763 | Open in IMG/M |
| 3300016270|Ga0182036_11100827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 658 | Open in IMG/M |
| 3300016270|Ga0182036_11349320 | Not Available | 596 | Open in IMG/M |
| 3300016294|Ga0182041_10789248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 848 | Open in IMG/M |
| 3300016387|Ga0182040_10818034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 768 | Open in IMG/M |
| 3300017942|Ga0187808_10222282 | Not Available | 842 | Open in IMG/M |
| 3300017961|Ga0187778_10550257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 770 | Open in IMG/M |
| 3300017961|Ga0187778_10658102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 706 | Open in IMG/M |
| 3300017972|Ga0187781_10839790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 668 | Open in IMG/M |
| 3300017974|Ga0187777_11305094 | Not Available | 533 | Open in IMG/M |
| 3300018064|Ga0187773_10734597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300019362|Ga0173479_10820986 | Not Available | 517 | Open in IMG/M |
| 3300019888|Ga0193751_1022303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3096 | Open in IMG/M |
| 3300020010|Ga0193749_1065891 | Not Available | 681 | Open in IMG/M |
| 3300020082|Ga0206353_10812466 | Not Available | 873 | Open in IMG/M |
| 3300020580|Ga0210403_10317605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1276 | Open in IMG/M |
| 3300021403|Ga0210397_10176164 | Not Available | 1513 | Open in IMG/M |
| 3300021478|Ga0210402_10587509 | Not Available | 1033 | Open in IMG/M |
| 3300021559|Ga0210409_10913360 | Not Available | 752 | Open in IMG/M |
| 3300021560|Ga0126371_10949757 | Not Available | 1002 | Open in IMG/M |
| 3300021560|Ga0126371_11001507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 977 | Open in IMG/M |
| 3300021560|Ga0126371_11482459 | Not Available | 807 | Open in IMG/M |
| 3300021560|Ga0126371_13826021 | Not Available | 507 | Open in IMG/M |
| 3300024251|Ga0247679_1078715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300024331|Ga0247668_1119548 | Not Available | 534 | Open in IMG/M |
| 3300025321|Ga0207656_10704541 | Not Available | 517 | Open in IMG/M |
| 3300025898|Ga0207692_10021681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2942 | Open in IMG/M |
| 3300025898|Ga0207692_10773412 | Not Available | 627 | Open in IMG/M |
| 3300025903|Ga0207680_10317313 | Not Available | 1089 | Open in IMG/M |
| 3300025905|Ga0207685_10460741 | Not Available | 663 | Open in IMG/M |
| 3300025906|Ga0207699_10311414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1102 | Open in IMG/M |
| 3300025910|Ga0207684_10351108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1269 | Open in IMG/M |
| 3300025915|Ga0207693_11120964 | Not Available | 597 | Open in IMG/M |
| 3300025931|Ga0207644_10793396 | Not Available | 792 | Open in IMG/M |
| 3300025936|Ga0207670_11020118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
| 3300026095|Ga0207676_11876969 | Not Available | 598 | Open in IMG/M |
| 3300026304|Ga0209240_1090498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1112 | Open in IMG/M |
| 3300026310|Ga0209239_1225879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300026316|Ga0209155_1239227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300027725|Ga0209178_1254134 | Not Available | 636 | Open in IMG/M |
| 3300027725|Ga0209178_1261214 | Not Available | 628 | Open in IMG/M |
| 3300027775|Ga0209177_10258205 | Not Available | 647 | Open in IMG/M |
| 3300027857|Ga0209166_10293440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 856 | Open in IMG/M |
| 3300027884|Ga0209275_10733249 | Not Available | 569 | Open in IMG/M |
| 3300027903|Ga0209488_10048616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3119 | Open in IMG/M |
| 3300028875|Ga0307289_10141057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 990 | Open in IMG/M |
| 3300028906|Ga0308309_11523450 | Not Available | 571 | Open in IMG/M |
| 3300030494|Ga0310037_10477159 | Not Available | 508 | Open in IMG/M |
| 3300030580|Ga0311355_10331402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1516 | Open in IMG/M |
| 3300031128|Ga0170823_13352574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
| 3300031474|Ga0170818_111214407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 730 | Open in IMG/M |
| 3300031561|Ga0318528_10560930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
| 3300031573|Ga0310915_10857115 | Not Available | 638 | Open in IMG/M |
| 3300031668|Ga0318542_10775089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300031680|Ga0318574_10663519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 611 | Open in IMG/M |
| 3300031680|Ga0318574_10859364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300031681|Ga0318572_10438963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 777 | Open in IMG/M |
| 3300031713|Ga0318496_10167917 | Not Available | 1201 | Open in IMG/M |
| 3300031720|Ga0307469_11185570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 721 | Open in IMG/M |
| 3300031720|Ga0307469_12212419 | Not Available | 536 | Open in IMG/M |
| 3300031744|Ga0306918_10624928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 844 | Open in IMG/M |
| 3300031748|Ga0318492_10344137 | Not Available | 780 | Open in IMG/M |
| 3300031751|Ga0318494_10287232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 947 | Open in IMG/M |
| 3300031765|Ga0318554_10310756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 896 | Open in IMG/M |
| 3300031765|Ga0318554_10708438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
| 3300031769|Ga0318526_10265800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 702 | Open in IMG/M |
| 3300031782|Ga0318552_10204829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
| 3300031795|Ga0318557_10357190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300031798|Ga0318523_10060042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1807 | Open in IMG/M |
| 3300031799|Ga0318565_10009336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3997 | Open in IMG/M |
| 3300031799|Ga0318565_10143947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1155 | Open in IMG/M |
| 3300031799|Ga0318565_10565463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300031821|Ga0318567_10321057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 874 | Open in IMG/M |
| 3300031831|Ga0318564_10174624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 958 | Open in IMG/M |
| 3300031833|Ga0310917_10822343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
| 3300031897|Ga0318520_10289874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 984 | Open in IMG/M |
| 3300031897|Ga0318520_10550752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 715 | Open in IMG/M |
| 3300031910|Ga0306923_11823629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
| 3300031941|Ga0310912_10292480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1260 | Open in IMG/M |
| 3300031942|Ga0310916_10152795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1905 | Open in IMG/M |
| 3300031945|Ga0310913_10886413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300031946|Ga0310910_10835844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
| 3300031954|Ga0306926_10231443 | Not Available | 2292 | Open in IMG/M |
| 3300032008|Ga0318562_10720765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
| 3300032043|Ga0318556_10132503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1280 | Open in IMG/M |
| 3300032180|Ga0307471_100541814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1317 | Open in IMG/M |
| 3300032261|Ga0306920_101770745 | Not Available | 873 | Open in IMG/M |
| 3300032261|Ga0306920_102886560 | Not Available | 652 | Open in IMG/M |
| 3300032261|Ga0306920_103468106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
| 3300032783|Ga0335079_10445372 | Not Available | 1389 | Open in IMG/M |
| 3300032895|Ga0335074_10458723 | Not Available | 1346 | Open in IMG/M |
| 3300032898|Ga0335072_11435933 | Not Available | 594 | Open in IMG/M |
| 3300032955|Ga0335076_10573512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1011 | Open in IMG/M |
| 3300033158|Ga0335077_10955630 | Not Available | 859 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.79% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.09% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.09% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.09% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.47% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.23% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.23% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.62% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.62% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.62% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.62% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.62% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.62% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066388_1082608822 | 3300005332 | Tropical Forest Soil | IRILLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWKLHPE* |
| Ga0068869_1008229921 | 3300005334 | Miscanthus Rhizosphere | QLLLLLPVVMSFWFLFYMPRWRRRVREKARSLRRWNLHPE* |
| Ga0070692_108173182 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | FTGLQLLLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWNLHPE* |
| Ga0008090_157768723 | 3300005363 | Tropical Rainforest Soil | RILILLPVIMGFWFIFYMPRWRRRVREQARSLQRWKLHPE* |
| Ga0070709_115997362 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VLGFRILLLLPVLMSFWFLFYMPRWRRRVRQQARSLQRWQLHPE* |
| Ga0070714_1022580831 | 3300005435 | Agricultural Soil | FRILLLLPVMMSFWYLFYMPRWRRRVRQRARSLTSWQLHPE* |
| Ga0070707_1013847832 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ALVPFLGIPILLVLPLVMGFWYMFYMPRWRRRVREQARSLRKWKLRPE* |
| Ga0068855_1014629252 | 3300005563 | Corn Rhizosphere | GIRIMILLPVVMSFWFLFYMPRWRRRVRLQARSLQRWQLHPE* |
| Ga0068857_1011369292 | 3300005577 | Corn Rhizosphere | LLPVVMSFWFLFYMPRWRRRVRQRARSLTSWQLHPE* |
| Ga0068854_1017675221 | 3300005578 | Corn Rhizosphere | LLLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWQLHPE* |
| Ga0070762_110430952 | 3300005602 | Soil | PVVMSFWFLFYMPRWRRRVRQQARSLRKWKLHPE* |
| Ga0068864_1021821932 | 3300005618 | Switchgrass Rhizosphere | LVLPLVMGFWYMFYMPRWRRRVREQARSLRKWKLRPE* |
| Ga0066903_1029684581 | 3300005764 | Tropical Forest Soil | LVPFLGIPILFVLPIAMGFWFMFYMPRWRRRVREQTRNLRKWKLRPE* |
| Ga0066903_1036747751 | 3300005764 | Tropical Forest Soil | IALAPFLGPRILLLLPLVMGFWYLFYMPRWRRRVREQTRSLRKWKLRPE* |
| Ga0066903_1058479222 | 3300005764 | Tropical Forest Soil | LLPIVMSFWFLFYMPRWRRRVREQARSLRRWKLHPE* |
| Ga0066903_1069452442 | 3300005764 | Tropical Forest Soil | PILFVLPIVLGFWFMFYMPRWRRRVREHTRNLRKWKLRPD* |
| Ga0070717_109821443 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LLPVLMSFWFLFYMPRWRRQVRERTRNLRRWKLHPE* |
| Ga0070715_105857481 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LPVVMSFWFLFYMPRWRRRVRQQARSLQRWQLHPE* |
| Ga0070716_1004975461 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ILLLLPVVMSFWFLFYMPRWRRRVRQRARSLTSWQLHPE* |
| Ga0074053_118822901 | 3300006575 | Soil | IPILILTAVAGIRILILLPVVMSFWFLFYMPRWRRRVRLQARNLQKWQLHPE* |
| Ga0074057_123286112 | 3300006605 | Soil | FLGIPILLVLPLVMGFWYMFYMPRWRRRVREQARSLRKWKLRPE* |
| Ga0079220_114993172 | 3300006806 | Agricultural Soil | VALSVVLGFRILLLLPVMMSFWYLFYMPRWRRRVRQRARSLTSWQLHPE* |
| Ga0079220_116317522 | 3300006806 | Agricultural Soil | ILLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE* |
| Ga0075428_1007089063 | 3300006844 | Populus Rhizosphere | FLGIPILMVLPIVMGFWFVFYMPRWRRRVREQARNLRKWKLRPE* |
| Ga0075425_1008752851 | 3300006854 | Populus Rhizosphere | PILALSTIAGIRILLLLPVVMSFWFLFYMPRWRRRVRQQARSLRRWNLHPE* |
| Ga0075425_1013559791 | 3300006854 | Populus Rhizosphere | IPILILTAVAGIRIMILLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE* |
| Ga0075426_110730661 | 3300006903 | Populus Rhizosphere | LVPFLGIPILMVLPIVMGFWFVFYMPRWRRRVREQARSLRKWKLRPE* |
| Ga0079219_102637471 | 3300006954 | Agricultural Soil | GFRILLLLPVMMSFWYLFYMPRWRRRVRQRARSLTSWQLHPE* |
| Ga0079219_107966661 | 3300006954 | Agricultural Soil | LLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE* |
| Ga0079219_120677132 | 3300006954 | Agricultural Soil | PVVMGFWFLFYMPRWRRRVREQARSLRRWQLHPE* |
| Ga0105247_103327441 | 3300009101 | Switchgrass Rhizosphere | PILILTAVAGIKILALLPVVMGFWFLFYMPRWRRRVRLQARSLQRWQLHPE* |
| Ga0105242_107191201 | 3300009176 | Miscanthus Rhizosphere | LLPVVMSFWFLFYMPRWRRRVRLQARSLQRWQLHPE* |
| Ga0105249_107300163 | 3300009553 | Switchgrass Rhizosphere | IPILMVLPIVMGFWFVFYMPRWRRRVREQTRNLRKWKLRPE* |
| Ga0126374_111440982 | 3300009792 | Tropical Forest Soil | PVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE* |
| Ga0126384_119520672 | 3300010046 | Tropical Forest Soil | GLRLLILLPVLMSFWFLFYMPRWRRQVRERARNLRRWKLHPE* |
| Ga0126370_102611411 | 3300010358 | Tropical Forest Soil | LAAFAGFQLLVLLPVVMGFWFIFYMPRWRRRVREKTRSLRRWQLHPE* |
| Ga0126370_111355971 | 3300010358 | Tropical Forest Soil | ALTPFLGPRILLLIPLLMGFWYLFYMPRWRRQVREQARSLRKWKLRPE* |
| Ga0126376_110696722 | 3300010359 | Tropical Forest Soil | GLQLLLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWKLHPE* |
| Ga0126376_115143402 | 3300010359 | Tropical Forest Soil | LTPFLGPRILLLIPLLMGFWYLFYMPRWRRQVREQARSLRKWKLRPE* |
| Ga0126372_102839783 | 3300010360 | Tropical Forest Soil | PVVMGFWFMFYMPRWRRRVREQARSLRKWKLRPE* |
| Ga0126372_109697822 | 3300010360 | Tropical Forest Soil | GFQLLVLLPVVMGFWFFFYMPRWRRRVREQARSLRRWQLHPE* |
| Ga0126378_117396423 | 3300010361 | Tropical Forest Soil | VLPVVMGFWFMFYMPRWRRRVRENARNLRKWKLRPE* |
| Ga0126378_134205362 | 3300010361 | Tropical Forest Soil | VLLPVVMGFWFIFYMPRWRRRVREQARSLRRWQLHPE* |
| Ga0126379_101578654 | 3300010366 | Tropical Forest Soil | PFLGIPILFVIPIVMGFWFMFYMPRWRRRVREQTRNLRKWKLRPE* |
| Ga0126379_130871281 | 3300010366 | Tropical Forest Soil | APFLGPRILLLLPLVMGFWYLFYMPRWRRRVREQTRSLRKWKLRPE* |
| Ga0134125_124469551 | 3300010371 | Terrestrial Soil | RVLLLLPIVMSFWFLFYMPRWRRRVRQKSRSLSRWQLHSE* |
| Ga0134125_126896222 | 3300010371 | Terrestrial Soil | LILTAVAGIRIMILLPVVMSFWFLFYMPRWRRRVRLQARSLQRWQLHPE* |
| Ga0105239_116861642 | 3300010375 | Corn Rhizosphere | PVVMSFWFLFYMPRWRRRVREQARSLRRWNLHPE* |
| Ga0126381_1010216173 | 3300010376 | Tropical Forest Soil | GPRILLLVPLVMSFWYLFYMPRWRRRVREQARSLRKWKLRPE* |
| Ga0126381_1015529642 | 3300010376 | Tropical Forest Soil | PFLGIRILLLLPVVMSFWFMFYMPRWRRQVRERARSLRRWKLHPE* |
| Ga0136449_1023777381 | 3300010379 | Peatlands Soil | PVVMGFWFLFYMPRWRRRVRQQARSLRRWQLHPE* |
| Ga0134126_113980041 | 3300010396 | Terrestrial Soil | ILTAVAGIRIMILLPVVMSFWFLFYMPRWRRRVRLRARRLQRWQLHPE* |
| Ga0126383_130710551 | 3300010398 | Tropical Forest Soil | PVVVLAAFGGFQLLVLLPVVMGFWFFFYMPRWRRRVREQARSLRRWKLHPE* |
| Ga0126350_109723911 | 3300010880 | Boreal Forest Soil | ILALSLVAGIRILLLLPVAMSFWFIFYMPRWRRRVREQARSLRRWKLTPE* |
| Ga0137389_118081071 | 3300012096 | Vadose Zone Soil | PFLGPRILLLLPLVMGFWYLFYMPRWRRQVREQTRSLRKWKLRPE* |
| Ga0137388_103796431 | 3300012189 | Vadose Zone Soil | IPIVVLSVVAGIRILILLPVVMSFWFLCYVPRWRQRVREQARSLRKWQLHPE* |
| Ga0137382_107703241 | 3300012200 | Vadose Zone Soil | TAVAGIRILILLPVVMSFWFLFYMPRWRRRVRQQARNLQRWQLHPE* |
| Ga0137365_109916322 | 3300012201 | Vadose Zone Soil | VLGFRILLLLPVVMSFWFLFYMPRWRRRVRQQARSLQRWQLHPE* |
| Ga0137379_105465771 | 3300012209 | Vadose Zone Soil | LGVRIMMLLPIVLGFWFIFYMPRWRRRVREQARNLRKWKLRPE* |
| Ga0137379_109250252 | 3300012209 | Vadose Zone Soil | LTAVAGIRILILLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE* |
| Ga0137372_1000081031 | 3300012350 | Vadose Zone Soil | LILLPVVMSFWFLFYMPRWRRRVRLQARNLQKWQLHPE* |
| Ga0137386_102410323 | 3300012351 | Vadose Zone Soil | AGFRILVLLPLVMGFWFMFYMPRWRRQVRERARSLRRWKLHPE* |
| Ga0164302_112323172 | 3300012961 | Soil | VVLALFTGLQLLLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWQLHPE* |
| Ga0126369_101066974 | 3300012971 | Tropical Forest Soil | VAGIRILLLLPVVMSFWFLFYMPRWRRRVRQRARSLTSWQLHPE* |
| Ga0157374_104307981 | 3300013296 | Miscanthus Rhizosphere | RIMILLPVVMSFWFLFYMPRWRRRVRLQARSLQRWQLHPE* |
| Ga0120125_11758721 | 3300014056 | Permafrost | LTPFAGIRILLLLPVVMSFWFMFYMPRWRRQVRERARNLRRWKLYPE* |
| Ga0157376_129280871 | 3300014969 | Miscanthus Rhizosphere | ILTAVAGIRIMILLPVVMSFWFLFYMPRWRRRVRLQARSLQRWQLHPE* |
| Ga0134085_104786911 | 3300015359 | Grasslands Soil | IAALVPFLGIPILFVLPIVMGFWFMFYMPRWRRRVREQARNLRKWKLRPE* |
| Ga0182036_108104801 | 3300016270 | Soil | VIVLAAFAGFQLLMLLPVVMGFWFFFYMPRWRRRVREQARSLRRWQLHPE |
| Ga0182036_111008273 | 3300016270 | Soil | VLLPVVMGFWFIFYMPRWRRRVREQARSLQRWQLHPE |
| Ga0182036_113493202 | 3300016270 | Soil | PIVAASVFLGIRILLLLPVVMGFWFLFYMPRWRRRVRQQARSLRRWKLHPE |
| Ga0182041_107892482 | 3300016294 | Soil | VPIVVLAAFAGFQLLVLLPVVMGFWFLFYMPRWRRRVREQARSLRRWQLHPE |
| Ga0182040_108180341 | 3300016387 | Soil | PLLGLRIMILLPLVMGFWFIFYMPRWRRRAREQARSLRRWKLRPE |
| Ga0187808_102222821 | 3300017942 | Freshwater Sediment | IRILILLPVLMSFWFIFYMPRWRRSVREQARSLRRWKLHPE |
| Ga0187778_105502573 | 3300017961 | Tropical Peatland | GARIMILLPLLMGFWFILYMPRWRRRVREQARSLQKWKLRPE |
| Ga0187778_106581023 | 3300017961 | Tropical Peatland | LLPVVLGGWYLWYMPMWRRRVRKRARNLPKWQLHPE |
| Ga0187781_108397902 | 3300017972 | Tropical Peatland | AGLRILILLPVLMSFWFLFYMPRWRRQVRERARNLRRWKLHPE |
| Ga0187777_113050942 | 3300017974 | Tropical Peatland | LPLVMGFWFILYMPRWRRRVREQARNLQKWKLRPE |
| Ga0187773_107345972 | 3300018064 | Tropical Peatland | LGLQIMVLLPLVMGFWFIFYMPRWRRRVREQARSLQRWKLRPE |
| Ga0173479_108209862 | 3300019362 | Soil | GIRILILLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE |
| Ga0193751_10223031 | 3300019888 | Soil | RILLLLPVVMSFWFMFYMPRWRRQVRQRARNLRSWKLYPE |
| Ga0193749_10658912 | 3300020010 | Soil | FAGIRILLLLPVVMSFWFMFYMPRWRRQVRQRARNLRSWKLYPE |
| Ga0206353_108124661 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | AGIRILILLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE |
| Ga0210403_103176051 | 3300020580 | Soil | SVFGGIRILLLLPVVMSFWFLFYMPRWRRRVRQQARSLRRWKLHPE |
| Ga0210397_101761642 | 3300021403 | Soil | RILLLLPVVMSFWFLFYMPRWRRRVRQQARSLQRWQLHPE |
| Ga0210402_105875091 | 3300021478 | Soil | LLLPVLMSFWFLFYMPRWRRRVRQQARSLQRWQLHPE |
| Ga0210409_109133602 | 3300021559 | Soil | FRILLLLPVVMSFWFLFYMPRWRRRVRQQARNLTKWQLHPE |
| Ga0126371_109497573 | 3300021560 | Tropical Forest Soil | LVLLPVVMGFWFIFYMPRWRRRVREQARSLRRWQLHPE |
| Ga0126371_110015073 | 3300021560 | Tropical Forest Soil | FVIPIVMGFWFMFYMPRWRRRVREQARNLRKWKLRPD |
| Ga0126371_114824593 | 3300021560 | Tropical Forest Soil | PRILLLLPLVMGFWYLFYMPRWRRRVRERTRSLHKWKLRPE |
| Ga0126371_138260212 | 3300021560 | Tropical Forest Soil | GFQLLVLLPVVMGFWFIFYMPRWRRRVREQARNLRRWQLHPE |
| Ga0247679_10787151 | 3300024251 | Soil | QLLLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWNLHPE |
| Ga0247668_11195482 | 3300024331 | Soil | RILLLLPVLMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE |
| Ga0207656_107045412 | 3300025321 | Corn Rhizosphere | AGIRIMILLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHRE |
| Ga0207692_100216815 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LVLPLVMGFWYMFYMPRWRRRVREQARSLRKWKLRPE |
| Ga0207692_107734121 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | STVVGLRVLLLLPIVMSFWFLFYMPRWRRRVRQKSRSLSRWQLHPE |
| Ga0207680_103173132 | 3300025903 | Switchgrass Rhizosphere | RIMILLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE |
| Ga0207685_104607412 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLLPVVMSFWFLFYMPRWRRRVRQQARSLQRWQLHPE |
| Ga0207699_103114143 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VPFLGIPILFVLPVVMDFWFMLYMPRWRRRVREQARNMRKWQLRPE |
| Ga0207684_103511083 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | PVAGIRILMLLPLAMGFWFMFYMPRWRRQVREHARNLRRWKPHPE |
| Ga0207693_111209642 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ALSVVLGLRILLLLPVVMSFWFLFYMPRWRRRVRQQARSLQRWQLHPE |
| Ga0207644_107933961 | 3300025931 | Switchgrass Rhizosphere | LTAVAGIRIMILLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE |
| Ga0207670_110201181 | 3300025936 | Switchgrass Rhizosphere | VLPLVMGFWYMFYMPRWRRRVREQARSLRKWKLRPE |
| Ga0207676_118769691 | 3300026095 | Switchgrass Rhizosphere | LLLPVVMSFWFLFYMPRWRRRVRQRARSLTSWQLHPE |
| Ga0209240_10904981 | 3300026304 | Grasslands Soil | LRLLLLLPVLMSFWFLFYMPRWRRQVRQRARSLRRWKLHPE |
| Ga0209239_12258791 | 3300026310 | Grasslands Soil | LGIPILLVLPLVMGFWYMFYMPRWRRRVREQARSLRKWKLSPE |
| Ga0209155_12392272 | 3300026316 | Soil | IAALVPFLGIPILLVMPIVMGFWFVFYMPRWRRRVREQARSLRKWKLRPE |
| Ga0209178_12541342 | 3300027725 | Agricultural Soil | TAVAGIKILALLPVVMGFWFLFYMPRWRRRVRLQARSLQRWQLHPE |
| Ga0209178_12612141 | 3300027725 | Agricultural Soil | ILALSAIAGIRILLLLPVVMSFWFLFYMPRWRRRVRQQARSLRRWNLHPE |
| Ga0209177_102582052 | 3300027775 | Agricultural Soil | LLPVVMSFWFLFYMPRWRRRVRLQARNLQRWQLHPE |
| Ga0209166_102934402 | 3300027857 | Surface Soil | FLGPRILLLLPLVMGFWYLFYMPRWRRQVRAQARNLRKWKLRPE |
| Ga0209275_107332492 | 3300027884 | Soil | LLPVVMSFWFLFYMPRWRRRVREQARSLRRWKLHPE |
| Ga0209488_100486164 | 3300027903 | Vadose Zone Soil | FRILLLLPVLMSFWFLFYMPRWRRRVRQQARSLQRWQLHPE |
| Ga0307289_101410571 | 3300028875 | Soil | VLPIVMGFWFVFYMPRWRRRVREQARSLRKWKLRPE |
| Ga0308309_115234502 | 3300028906 | Soil | VPIVALSVVLGFRILLLLPVVMSFWFLFYMPRWRRRVRQQARSLQRWQLHPE |
| Ga0310037_104771591 | 3300030494 | Peatlands Soil | LSAFAGPRILMLLPVVMGFWFLFYMPRWRRRVREQARNLRRWQLHPE |
| Ga0311355_103314021 | 3300030580 | Palsa | LRILLLLPVLMSFWFLFYMPRWRREVRQRARSLRRWQLHPE |
| Ga0170823_133525742 | 3300031128 | Forest Soil | LGLRLLLLLPVLMSFWFLFYMPRWRRQVRERARNLTRWQLHPE |
| Ga0170818_1112144072 | 3300031474 | Forest Soil | AAVAGIRIMLLLPVVMSFWFLFYMPRWRRRVRQQARSLRRWKLHPE |
| Ga0318528_105609302 | 3300031561 | Soil | TRIMIVLPLVMGFWFILYMPRWRRRVREQARSLQKWKLRPE |
| Ga0310915_108571152 | 3300031573 | Soil | PIVALSLFAGIRILLLLPVVMGFWFLFYMPRWRRRVRQQARSLRRWKLHPE |
| Ga0318542_107750892 | 3300031668 | Soil | LVPFAGTRILILLPVIMGFWFVFYMPRWRRRVREQARSLRRWNLHPE |
| Ga0318574_106635191 | 3300031680 | Soil | LMLLPVVMGFWFIFYMPRWRRRVREHARSLQRWQLHPE |
| Ga0318574_108593641 | 3300031680 | Soil | PVVALVPFAGARILILLPVIMGFWFVFYMPRWRRRVREQARSLRRWNLHPE |
| Ga0318572_104389632 | 3300031681 | Soil | VALIPLLGTRIMILLPLVMGFWFILYMPRWRRRVREQARSLQKWKLRPE |
| Ga0318496_101679171 | 3300031713 | Soil | LLVLLPVVMGFWFLFYMPRWRRRVREQARSLRRWQLHPE |
| Ga0307469_111855701 | 3300031720 | Hardwood Forest Soil | ILFVLPVLMGFWFMFYMPRWRRRVREHARNLRKWKLRPE |
| Ga0307469_122124192 | 3300031720 | Hardwood Forest Soil | QLLILLPVVMSFWFLFYMPRWRRRVREQARSLRRWNLHPE |
| Ga0306918_106249281 | 3300031744 | Soil | LGLRIMILLPLVMGFWFIFYMPRWRRRAREQARSLRRWKLRPE |
| Ga0318492_103441371 | 3300031748 | Soil | LLPVVMSFWFLFYMPRWRRRVREQARSLRRWKLTPE |
| Ga0318494_102872323 | 3300031751 | Soil | GTRIMIVLPLVMGFWFILYMPRWRRRVREQARSLQKWKLRPE |
| Ga0318554_103107563 | 3300031765 | Soil | LILLPVIMGFWFVFYMPRWRRRVREQARSLRRWNLHPE |
| Ga0318554_107084382 | 3300031765 | Soil | GFQLLMLLPVVMGFWFIFYMPRWRRRVREHARSLQRWQLHPE |
| Ga0318526_102658002 | 3300031769 | Soil | VPVFGTRVMILLPVVMGFWFVFYMPRWRRRVREQARSLQKWTLRPE |
| Ga0318552_102048291 | 3300031782 | Soil | PVAGFQLLVLLPVVMGFWFIFYMPRWRRRVREHARSLQRWQLHPE |
| Ga0318557_103571901 | 3300031795 | Soil | LLGLRIMILLPLVMGFWFIFYMPRWRRRAREQARSLRRWKLRPE |
| Ga0318523_100600421 | 3300031798 | Soil | IMILLPLVMGFWFIFYMPRWRRRAREQARSLRRWKLRPE |
| Ga0318565_100093361 | 3300031799 | Soil | LRIMILLPLVMGFWFIFYMPRWRRRAREQARSLRRWKLRPE |
| Ga0318565_101439473 | 3300031799 | Soil | IPLLGARIMVLLPLVMGFWFILYMPRWRRRVREQARSLQKWTLRPE |
| Ga0318565_105654631 | 3300031799 | Soil | AFAGFQLLVLLPVVMGFWFIFYMPRWRRRVREQARSLQRWQLHPE |
| Ga0318567_103210571 | 3300031821 | Soil | MVLLPLVMGFWFILYMPRWRRRVREQARSLQKWTLRPE |
| Ga0318564_101746243 | 3300031831 | Soil | VALIPLLGPRIMILLPLVMGFWFILYMPRWRRRVREQARSLQKWTLRPE |
| Ga0310917_108223432 | 3300031833 | Soil | FAGIRILLLLPVVMGFWFLFYMPRWRRRVRQQARSLRRWKLHPE |
| Ga0318520_102898741 | 3300031897 | Soil | LPLVMGFWFIFYMPRWRRRAREQARSLRRWKLRPE |
| Ga0318520_105507522 | 3300031897 | Soil | GLRILLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWKLHPE |
| Ga0306923_118236292 | 3300031910 | Soil | VALAAFAGFQLLVLLPVVMGFWFIFYMPRWRRRVREQARSLQRWQLHPE |
| Ga0310912_102924804 | 3300031941 | Soil | GLRIMILLPLVMGFWFIFYMPRWRRRAREQARSLRRWKLRPE |
| Ga0310916_101527951 | 3300031942 | Soil | MILLPLVMGFWFIFYMPRWRRRAREQARSLRRWKLRPE |
| Ga0310913_108864131 | 3300031945 | Soil | FVALIPLLGARIMVLLPLVMGFWFILYMPRWRRRVREQARSLQKWTLRPE |
| Ga0310910_108358442 | 3300031946 | Soil | MLLPVVMGFWFIFYMPRWRRRVREHARSLQRWQLHPE |
| Ga0306926_102314434 | 3300031954 | Soil | AGFQLLVLLPVVMGFWFIFYMPRWRRRVREQARSLRRWQLHPE |
| Ga0318562_107207652 | 3300032008 | Soil | PIVALSVVGGLRILLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWKLHPE |
| Ga0318556_101325033 | 3300032043 | Soil | FQLLVLLPVVMGFWFIFYMPRWRRRVREQARSLQRWQLHPE |
| Ga0307471_1005418143 | 3300032180 | Hardwood Forest Soil | SVFGGIRFLLLLPVVMSFWFLFYMPRWRRRVREQARSLRRWKLHPE |
| Ga0306920_1017707451 | 3300032261 | Soil | LLPVVMGFWFLFYMPRWRRRVRQQARSLRRWKLHPE |
| Ga0306920_1028865602 | 3300032261 | Soil | ILLLLPLVMSFWYLFYMPRWRRRVREQARSLRKWKLRPE |
| Ga0306920_1034681061 | 3300032261 | Soil | LPVLLSFWFLFYMPRWRRRVREQARNLRRWQLHPE |
| Ga0335079_104453723 | 3300032783 | Soil | AVLTPFLGIRIVLLLPVVMSFWFMFYMPRWRRRVREQTRNLLKWKLRPE |
| Ga0335074_104587231 | 3300032895 | Soil | AGVRIPLLLPVVMGFWYMFYMPRWRRQVRERARNLRRWKLHPE |
| Ga0335072_114359332 | 3300032898 | Soil | LPVLMSFWFIFYMPRWRRRVRQKARSLNRWQLHPE |
| Ga0335076_105735121 | 3300032955 | Soil | ILFVLPIAMGFWFMFYMPRWRRRVREQTRNLRKWKLRPE |
| Ga0335077_109556302 | 3300033158 | Soil | LSVVLGFRILLLLPVLMSFWYLFYMPRWRRRVRQQARSLQRWQLHPE |
| ⦗Top⦘ |