| Basic Information | |
|---|---|
| Family ID | F040360 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 162 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VASLLSPQLKRLLSYVRPYAFRLTLGVVLVAFVALAEGLV |
| Number of Associated Samples | 142 |
| Number of Associated Scaffolds | 162 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.50 % |
| % of genes near scaffold ends (potentially truncated) | 97.53 % |
| % of genes from short scaffolds (< 2000 bps) | 87.65 % |
| Associated GOLD sequencing projects | 132 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.827 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.518 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.074 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.025 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.94% β-sheet: 0.00% Coil/Unstructured: 47.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 162 Family Scaffolds |
|---|---|---|
| PF03668 | ATP_bind_2 | 69.75 |
| PF04552 | Sigma54_DBD | 5.56 |
| PF00005 | ABC_tran | 3.09 |
| PF05960 | DUF885 | 2.47 |
| PF04963 | Sigma54_CBD | 2.47 |
| PF13578 | Methyltransf_24 | 1.23 |
| PF00664 | ABC_membrane | 0.62 |
| PF03938 | OmpH | 0.62 |
| PF12833 | HTH_18 | 0.62 |
| PF14317 | YcxB | 0.62 |
| PF05199 | GMC_oxred_C | 0.62 |
| PF12399 | BCA_ABC_TP_C | 0.62 |
| PF12867 | DinB_2 | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 162 Family Scaffolds |
|---|---|---|---|
| COG1660 | RNase adaptor protein RapZ for GlmZ sRNA degradation, contains a P-loop ATPase domain | Signal transduction mechanisms [T] | 69.75 |
| COG1508 | DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog | Transcription [K] | 8.02 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 2.47 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.62 |
| COG2825 | Periplasmic chaperone for outer membrane proteins, Skp family | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.83 % |
| Unclassified | root | N/A | 6.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_109214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300000567|JGI12270J11330_10138546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 943 | Open in IMG/M |
| 3300000789|JGI1027J11758_11325025 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300001167|JGI12673J13574_1001712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1183 | Open in IMG/M |
| 3300002562|JGI25382J37095_10185414 | Not Available | 637 | Open in IMG/M |
| 3300004091|Ga0062387_100637128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300004092|Ga0062389_101569121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 841 | Open in IMG/M |
| 3300004152|Ga0062386_101768674 | Not Available | 516 | Open in IMG/M |
| 3300004267|Ga0066396_10105761 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300004479|Ga0062595_100343445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
| 3300004633|Ga0066395_10608227 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300005180|Ga0066685_10249341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1224 | Open in IMG/M |
| 3300005332|Ga0066388_108595481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300005439|Ga0070711_101048246 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300005439|Ga0070711_101204480 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005468|Ga0070707_100611818 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300005536|Ga0070697_100952933 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300005537|Ga0070730_10048241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3090 | Open in IMG/M |
| 3300005542|Ga0070732_10099966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1709 | Open in IMG/M |
| 3300005554|Ga0066661_10066172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2101 | Open in IMG/M |
| 3300005555|Ga0066692_10203375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1240 | Open in IMG/M |
| 3300005556|Ga0066707_10297369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300005566|Ga0066693_10169231 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300005586|Ga0066691_10909884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300005712|Ga0070764_10103813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1521 | Open in IMG/M |
| 3300006031|Ga0066651_10511565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300006046|Ga0066652_102047471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300006050|Ga0075028_100582857 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300006162|Ga0075030_101089013 | Not Available | 628 | Open in IMG/M |
| 3300006163|Ga0070715_10599929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300006175|Ga0070712_101880936 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300006358|Ga0068871_100044388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3575 | Open in IMG/M |
| 3300006791|Ga0066653_10631375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300006794|Ga0066658_10324819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300006796|Ga0066665_10275300 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300006797|Ga0066659_10154631 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300006800|Ga0066660_11169273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300006800|Ga0066660_11449083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300006893|Ga0073928_10569150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300006893|Ga0073928_10896685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300007265|Ga0099794_10683153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300009038|Ga0099829_11802375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300009088|Ga0099830_10512977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
| 3300009088|Ga0099830_10532943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
| 3300009089|Ga0099828_11677924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300009143|Ga0099792_10845059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300009525|Ga0116220_10133387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300009698|Ga0116216_10506707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300010321|Ga0134067_10500310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300010337|Ga0134062_10127501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1114 | Open in IMG/M |
| 3300010343|Ga0074044_10763455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300010359|Ga0126376_11179916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300010865|Ga0126346_1424050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300011271|Ga0137393_11474025 | Not Available | 570 | Open in IMG/M |
| 3300012096|Ga0137389_10083252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2505 | Open in IMG/M |
| 3300012198|Ga0137364_10421521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
| 3300012203|Ga0137399_11037711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300012211|Ga0137377_11481360 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300012351|Ga0137386_10515140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300012361|Ga0137360_11260809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300012362|Ga0137361_11962715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300012923|Ga0137359_10164850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1978 | Open in IMG/M |
| 3300012927|Ga0137416_10852004 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300012929|Ga0137404_11517235 | Not Available | 620 | Open in IMG/M |
| 3300012977|Ga0134087_10110490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1160 | Open in IMG/M |
| 3300013503|Ga0120127_10009135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1619 | Open in IMG/M |
| 3300014154|Ga0134075_10085383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1327 | Open in IMG/M |
| 3300014169|Ga0181531_10120962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1573 | Open in IMG/M |
| 3300015051|Ga0137414_1230916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1645 | Open in IMG/M |
| 3300015241|Ga0137418_10349140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1222 | Open in IMG/M |
| 3300015245|Ga0137409_11204044 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300015358|Ga0134089_10102730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
| 3300016341|Ga0182035_10220193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1514 | Open in IMG/M |
| 3300016730|Ga0181515_1364560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300017656|Ga0134112_10205330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300017961|Ga0187778_10205449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1256 | Open in IMG/M |
| 3300018433|Ga0066667_11219202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300018482|Ga0066669_10025197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3412 | Open in IMG/M |
| 3300020004|Ga0193755_1219585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300020199|Ga0179592_10060177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1733 | Open in IMG/M |
| 3300020581|Ga0210399_10354889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1224 | Open in IMG/M |
| 3300020581|Ga0210399_10863313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300020582|Ga0210395_11179749 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300021086|Ga0179596_10354314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300021088|Ga0210404_10839064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300021168|Ga0210406_10123379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2188 | Open in IMG/M |
| 3300021171|Ga0210405_10778810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300021171|Ga0210405_10913737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300021181|Ga0210388_10906466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300021405|Ga0210387_11875020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300021407|Ga0210383_10224178 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300021407|Ga0210383_11492497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300021420|Ga0210394_10383836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1235 | Open in IMG/M |
| 3300021433|Ga0210391_10175034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1689 | Open in IMG/M |
| 3300021478|Ga0210402_10375652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1319 | Open in IMG/M |
| 3300021559|Ga0210409_10158499 | All Organisms → cellular organisms → Bacteria | 2072 | Open in IMG/M |
| 3300025904|Ga0207647_10603697 | Not Available | 605 | Open in IMG/M |
| 3300025910|Ga0207684_10857848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300025939|Ga0207665_10589423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300026281|Ga0209863_10097444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300026313|Ga0209761_1018339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4422 | Open in IMG/M |
| 3300026324|Ga0209470_1212715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300026334|Ga0209377_1155268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300026514|Ga0257168_1039991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300026515|Ga0257158_1003770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2014 | Open in IMG/M |
| 3300026528|Ga0209378_1027750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3025 | Open in IMG/M |
| 3300026537|Ga0209157_1291554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300026548|Ga0209161_10038038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3253 | Open in IMG/M |
| 3300026551|Ga0209648_10202744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1512 | Open in IMG/M |
| 3300026552|Ga0209577_10355854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1075 | Open in IMG/M |
| 3300026999|Ga0207949_1019115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300027643|Ga0209076_1005541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3012 | Open in IMG/M |
| 3300027660|Ga0209736_1016022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2348 | Open in IMG/M |
| 3300027667|Ga0209009_1200380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300027678|Ga0209011_1188277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300027765|Ga0209073_10108102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
| 3300027765|Ga0209073_10287103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300027829|Ga0209773_10273399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300027842|Ga0209580_10019237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3022 | Open in IMG/M |
| 3300027842|Ga0209580_10135479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1207 | Open in IMG/M |
| 3300027857|Ga0209166_10325478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300027875|Ga0209283_10208385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1298 | Open in IMG/M |
| 3300027875|Ga0209283_10952274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300027882|Ga0209590_10134706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1516 | Open in IMG/M |
| 3300027884|Ga0209275_10464909 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300027894|Ga0209068_10085010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1651 | Open in IMG/M |
| 3300027903|Ga0209488_10351728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
| 3300027903|Ga0209488_10656527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300027903|Ga0209488_10950863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300027986|Ga0209168_10160343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
| 3300028047|Ga0209526_10524441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300028047|Ga0209526_10629033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300028047|Ga0209526_10742932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300028536|Ga0137415_10192132 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
| 3300028577|Ga0265318_10253846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300028906|Ga0308309_10326250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1304 | Open in IMG/M |
| 3300028906|Ga0308309_10903545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300030746|Ga0302312_10357338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300030878|Ga0265770_1108804 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300031231|Ga0170824_116194258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300031240|Ga0265320_10487135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300031446|Ga0170820_13012980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300031469|Ga0170819_13157385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300031708|Ga0310686_106004572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300031708|Ga0310686_108651214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300031718|Ga0307474_10100776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2159 | Open in IMG/M |
| 3300031720|Ga0307469_10166079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1676 | Open in IMG/M |
| 3300031753|Ga0307477_11129982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300031754|Ga0307475_10069482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2688 | Open in IMG/M |
| 3300031754|Ga0307475_10475014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
| 3300031771|Ga0318546_11253721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300031794|Ga0318503_10268240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300031820|Ga0307473_11337571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300031962|Ga0307479_10570456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1114 | Open in IMG/M |
| 3300031962|Ga0307479_11435096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300032076|Ga0306924_12429404 | Not Available | 528 | Open in IMG/M |
| 3300032160|Ga0311301_10329102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2414 | Open in IMG/M |
| 3300032180|Ga0307471_100382913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1528 | Open in IMG/M |
| 3300032180|Ga0307471_100387143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1521 | Open in IMG/M |
| 3300032955|Ga0335076_10168296 | Not Available | 2102 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.70% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.70% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.09% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.47% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.47% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.85% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.23% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.23% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.23% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.62% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.62% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.62% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.62% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.62% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.62% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.62% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001167 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_01943740 | 2199352024 | Soil | VASLFSPQLKRLLNYVRPYSFRLGAGILLLAFVALAEGGVALMVA |
| JGI12270J11330_101385462 | 3300000567 | Peatlands Soil | VASLLSPQLKRLLGYVRPYSVRLSAGVILLAFVGLAEGMTALMVK |
| JGI1027J11758_113250251 | 3300000789 | Soil | VASFFSPQLKRLLGYVRPYWIXMVVGVALLAVVAVAEGA |
| JGI12673J13574_10017121 | 3300001167 | Forest Soil | VASLFSSQLKRLLAYVRPYSLRLVVGVLLLAFVALAEGGVAL |
| JGI25382J37095_101854141 | 3300002562 | Grasslands Soil | VASLLSPQLKRLFAYVRPYSFRLGVGVMLVAFTALADGIVALMLR |
| Ga0062387_1004174151 | 3300004091 | Bog Forest Soil | VASLLSPHLKRLFRYVRPYGFRMAFGIVMLALMAVAEGIVALMIHPAVDYVLDPSVVTTSLP |
| Ga0062387_1006371282 | 3300004091 | Bog Forest Soil | VAALLSPQLKRLLSYVRPYSLRLSIGVVLVAIVALAEGVITLMVRPAVDYVLDP |
| Ga0062389_1015691211 | 3300004092 | Bog Forest Soil | VASLLSPQLKRLLSYVRPYAFRLSLGVVLVAFVALAEGMVAFMVKIAVDYVL |
| Ga0062386_1017686741 | 3300004152 | Bog Forest Soil | VGRLISPQLKRLFGYVKPYSFRLSLGVLLVAFVAAAEGLVALMIVP |
| Ga0066396_101057611 | 3300004267 | Tropical Forest Soil | MLSWLSPQLKRLLGYVRPYSIRLSIGILLVAFVAVAEGLVALMVKLALDFV |
| Ga0062595_1003434452 | 3300004479 | Soil | VASLFSSQLKRLLSYVRPYSFRLLLGIVLLAVVAFAEGLVALMIR |
| Ga0066395_106082272 | 3300004633 | Tropical Forest Soil | LASVFSPQLKRLLAYVRPYWVGMIAGVLFLAIMALGEGAVTLM |
| Ga0066685_102493413 | 3300005180 | Soil | VALLLTPQWKRLLSYVRPYSLRLSAGVVLLAFVALAEGAVTLLIV |
| Ga0066388_1085954811 | 3300005332 | Tropical Forest Soil | LSSLLPPQLSRLVSYLRPYALRFGLGVALVAFVALAEGAVALMLKLAVDFVL |
| Ga0070711_1010482461 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VASLLSPQLKRLLSYVRPYSFRLTLGVVLVAFVALAEGMVAFMVKIAVDYVLNPSVFVTK |
| Ga0070711_1012044802 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VASLFSPQLKRLLSYVRPYGFRLSLGVVLVAFVALAEGMVAFMVKIAVDYV |
| Ga0070707_1006118182 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VAELLSPQLKRLLGYVGPYAFRLGVGVVLVAFAAIAEGGVALMIKLAVDFV |
| Ga0070697_1009529331 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VASLLSPQLKRLLSYVRPYSFRLTLGVVLVAFVALAEGMVAFMVKIAV |
| Ga0070730_100482411 | 3300005537 | Surface Soil | LLSPQLKRLLSYTRPYLFRMVFGVVFLGIVALAEG |
| Ga0070732_100999661 | 3300005542 | Surface Soil | VASLFSPQLKRLLSYVRPYAFRLSIGVLLVAFVALADGLVA |
| Ga0066661_100661724 | 3300005554 | Soil | VALLLTPQWKRLLSYVRPYSLRLSAGVVLLAFVALAEG |
| Ga0066692_102033753 | 3300005555 | Soil | VALLLTPQWKRLLGFVRPYTFRLAVGVVLLGFVALAEGAVALLIVPIFDRV |
| Ga0066707_102973691 | 3300005556 | Soil | LASVISPQWKRLLVYVRPYGVRLTIGVCLVAFVALAEGAVALMVRL |
| Ga0066693_101692312 | 3300005566 | Soil | VASLLSPQWKRLLSYVRPYSFRLAVGVVLVAITALADGIVALMLR |
| Ga0066691_109098841 | 3300005586 | Soil | LLISPQLKRLLSYVRPHAVRMAAGIALMAFVALCEGVIALLI |
| Ga0070764_101038133 | 3300005712 | Soil | VASVFSPQLKRLLAYVRPYSLRLFVGIILLAIVAAAEGLVALMIKPAVDY |
| Ga0066651_105115651 | 3300006031 | Soil | VALLLTPQWKRLLGFVRPYTFRLAVGVVLLGFVAL |
| Ga0066652_1020474712 | 3300006046 | Soil | VTSLLSPQWKRLLSYVRPHAFRLAVGVVLVAFTALADGIVALMLRPGFDYVLN |
| Ga0075028_1005828572 | 3300006050 | Watersheds | VALTLSPQLKRLLGYVWPYRFRMSLGVVLLAFVALADGLILLM |
| Ga0075030_1010890132 | 3300006162 | Watersheds | VASLLSPQLKRLFAYVRPYSFRLGVGIVLVAVTALADGIVALM |
| Ga0070715_105999291 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VASLLSPQLKRLLSYVRPYAFRLTLGVVLVAFVALAEGLV |
| Ga0070712_1018809362 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VASLFSPQLKRLLSYVRPYSFRLAVGVVLLAVVAVAEGLVALMIKPAVDYV |
| Ga0068871_1000443885 | 3300006358 | Miscanthus Rhizosphere | LASFISPQLKRLLAFVRPYGVRLTIGVCLVAFVALAEGAVALMVRL |
| Ga0066653_106313751 | 3300006791 | Soil | VALLLTPQWKRLLSYVRPYSLRLSAGVVLLAFVALAEGA |
| Ga0066658_103248192 | 3300006794 | Soil | VTSLLSPQWKRLLSYVRPYSFRLAVGVVLVAFTALA |
| Ga0066665_102753001 | 3300006796 | Soil | VALLLTPQWKRLLSYVRPYSFRLAVGVVLLAFVALAEGAVALLIVPI |
| Ga0066659_101546313 | 3300006797 | Soil | VASFFSPQLKRLFGYVRPYRFRMSLGVVLLAIVALAEGAV |
| Ga0066660_111692732 | 3300006800 | Soil | QGARSVALLLTPQWKRLLSYVRPYSLRLSAGVVLLAFVALA* |
| Ga0066660_114490831 | 3300006800 | Soil | VALLLTPQWKRLLSYVRPYSLRLSAGVVLLAFVALA |
| Ga0073928_105691501 | 3300006893 | Iron-Sulfur Acid Spring | VTSLLSPQLKRLLSYVQPYALRLSFGVVLVAFVALAEG |
| Ga0073928_108966851 | 3300006893 | Iron-Sulfur Acid Spring | VASLFSPQLKRLLAYVRPYSLRLGAGILLLAFVALAEGG |
| Ga0099794_106831531 | 3300007265 | Vadose Zone Soil | VAELLSPQLKRLLSYVRPYTFRLMVGVALLALVALAEGGWALMIRLAV |
| Ga0099829_118023752 | 3300009038 | Vadose Zone Soil | VASLLSPQLKRLLGYVRPYGLRLSIGVILAAFVALAEGGVALMIKLAV |
| Ga0099830_105129771 | 3300009088 | Vadose Zone Soil | VASLLSPQLKRLLGYVRPYGLRLSIGVILVAFVALAEGGVAL |
| Ga0099830_105329431 | 3300009088 | Vadose Zone Soil | VVSLLSPQLKRLLGYVRPYGLRLSIGVILVAFVALAEGGVAL |
| Ga0099828_116779241 | 3300009089 | Vadose Zone Soil | VASLLSPQWKRLLGYVRPYSFRLAVGVVLVACTALAEGIVALLIRPG |
| Ga0099792_108450591 | 3300009143 | Vadose Zone Soil | VASLLSPQWKRLLSYVRPYSLRLAVAVVLLAFVALAE |
| Ga0116220_101333871 | 3300009525 | Peatlands Soil | VKRGAGAWGVASLLSPQLKRLLGYVRPYTVRLVAGVILLAFVGLAEGMTA |
| Ga0116216_105067072 | 3300009698 | Peatlands Soil | VASLLSPQLKRLLGYVRPYTVRLVAGVILLAFVGLAEGMTALMVKP |
| Ga0134067_105003102 | 3300010321 | Grasslands Soil | VASFFSPQLKRLLGYVRPYLAGLTVGVVLLAVVAIAEGAVAL |
| Ga0134062_101275012 | 3300010337 | Grasslands Soil | VASLLSPQWKRLLSYVRPYSFRLAVGVVLVAITAL |
| Ga0074044_107634551 | 3300010343 | Bog Forest Soil | VASLFSPQLKRLLNYVRPYAFRLVLGVVLVAFLACAEGLVA |
| Ga0126376_111799161 | 3300010359 | Tropical Forest Soil | LLSPQLKRLLGYVRPYAFRMVSGVIFLAVVALAEGL |
| Ga0126346_14240501 | 3300010865 | Boreal Forest Soil | VASLFSPQLKRLLAYVRPYSVRLSVGILLLAFVALAEGG |
| Ga0137393_114740252 | 3300011271 | Vadose Zone Soil | VGPLFSPQLKRLFAYVKPYSFRLGVGVLLVAFVALAEGLV |
| Ga0137389_100832524 | 3300012096 | Vadose Zone Soil | VGPLFSPQLKRLFAYVKPYSFRLGVGVLLVAFVALAEGMVAFMARLAFDYVLKPS |
| Ga0137364_104215211 | 3300012198 | Vadose Zone Soil | VISPQWKRLLVYVRPYGVRLTIGVCLVAFVALAEGAVALMVRLAIDYVLTP |
| Ga0137399_110377111 | 3300012203 | Vadose Zone Soil | VASLFSPQLKRLLNYARPYRVRLSLGVMLLALGALAEG |
| Ga0137377_114813601 | 3300012211 | Vadose Zone Soil | LAWFLSPQLKRLLSYVWPYRFRMLLGVVLLAFVAIAEGLIALI |
| Ga0137386_105151402 | 3300012351 | Vadose Zone Soil | VTSLLSPQWKRLLSYVRPYSFRLAVGVVLVAITALADG |
| Ga0137360_112608092 | 3300012361 | Vadose Zone Soil | VASFFSPQLKRLLAYVRPYWVGMVVGVSLLAVVALAE |
| Ga0137361_119627151 | 3300012362 | Vadose Zone Soil | VISPQWKRLLVYVRPYGVRLTIGVCLVAFVALAEGAVALMVRLA |
| Ga0137359_101648503 | 3300012923 | Vadose Zone Soil | LASVISRQWKRLLVYVRPYGVRLSIGVCLVAFVALAEGAVALM |
| Ga0137416_108520041 | 3300012927 | Vadose Zone Soil | VARFLSPQLKRLLSYVRPYRFRISLGVVLLAFVAMAEGLIALI |
| Ga0137404_115172351 | 3300012929 | Vadose Zone Soil | VASLLSPQLKRLFAYVRPYSFRLGVGIALVAVTALAD |
| Ga0134087_101104902 | 3300012977 | Grasslands Soil | VALLLTPQWKRLLGYVRPYSFRLAVGVVLLGFVALAEGAVTL |
| Ga0120127_100091353 | 3300013503 | Permafrost | VASLFSPQLKRLLNYVQPYSFRLGAGILLPILALVAGIFILIGR* |
| Ga0134075_100853833 | 3300014154 | Grasslands Soil | VALLLTPQWKRLLSYVRPYSLRLSAGVVLLAFVALAEGAV |
| Ga0181531_101209621 | 3300014169 | Bog | VASVFSPQLKRLLAYVRPYSLRLFVGIILLAIVAAAEG |
| Ga0137414_12309161 | 3300015051 | Vadose Zone Soil | VALLFSPQLKRLFSYVRPYTFRLGVGVILVAFVAIADGLVAFMARIAWDY |
| Ga0137418_103491403 | 3300015241 | Vadose Zone Soil | VASWLSPELKRLLNYVRPYSFRLMLGVLLLAFVALAEG |
| Ga0137409_112040442 | 3300015245 | Vadose Zone Soil | VARFLSPQLKRLLSYVRPYRFRMSLGVVLLAFVAMA |
| Ga0134089_101027302 | 3300015358 | Grasslands Soil | VALLLTPQWKRLLGFVRPYTFRLAVGVVLLGFVALAEGAVALLI |
| Ga0182035_102201933 | 3300016341 | Soil | VASLFSPQLKRLLGYVRPYSARLVLGIILVGFVAAAEG |
| Ga0181515_13645602 | 3300016730 | Peatland | MWGVKRGAGAWGVASLLSPQLKRLLGYVRPYSVRLVAGVILLAFVGLAEGLTALMVKPAV |
| Ga0134112_102053301 | 3300017656 | Grasslands Soil | VALLLTPQWKRLLSYVRPYSLRLSAGVVLLAFVALAEGAVTLLIVPIFDRV |
| Ga0187778_102054491 | 3300017961 | Tropical Peatland | VASLLSPQLKRLLRYVRPYSVRLVAGVILLAFVGLAEGMTALMVKPAVD |
| Ga0066667_112192022 | 3300018433 | Grasslands Soil | VTSLLSPQWKRLFSYVRPYSFRLAVGVVLVAFTALADGIVALMLRPGFDYVLN |
| Ga0066669_100251971 | 3300018482 | Grasslands Soil | LLSPQLKRLLSYVRPYSFRMITGVIFLAVVALAEGLIVFLI |
| Ga0193755_12195852 | 3300020004 | Soil | VASFFSPPLKRLLGYVRPYRIRMSLGVVLLAIVALAE |
| Ga0179592_100601773 | 3300020199 | Vadose Zone Soil | VASFLSPQLKRLLGYLRPYAFRFGLGVILVAFVAMAEGAVALM |
| Ga0210407_107695302 | 3300020579 | Soil | VAALFSPKLKRLFGYVRPYGFRLGLGVCMLAFMALAEGTVALMIRLAVDYVLNP |
| Ga0210399_103548891 | 3300020581 | Soil | VASLLSPQLKRLFAYVRPYSFRLGVGIVLVAVTALADGIVALMLRPGFDYVLNPSV |
| Ga0210399_108633131 | 3300020581 | Soil | LSSLLSPQLKRLLAYVRPYGFRLGVGVVLVAFVALAEGAV |
| Ga0210395_111797491 | 3300020582 | Soil | VASIVSPQLRRLLSYVRPYTFRLIAGVLLLAFVALAEVVIA |
| Ga0179596_103543141 | 3300021086 | Vadose Zone Soil | VASLFSPQLKRLVGYVRPYSFRLAVGAVLVAFTALADGIV |
| Ga0210404_108390642 | 3300021088 | Soil | VASYLSPQLKRLLGYLRPYALRFGLGIILVAFVALAEGA |
| Ga0210406_101233793 | 3300021168 | Soil | VASWFSPQLKRLLSYERPYSVRLALGVLLVAFVAVAEGAVALMV |
| Ga0210405_107788101 | 3300021171 | Soil | VASLFSPQLKRLLAYVRPYSVRLVAGILLLAFVALAEGGVALMVAPAVD |
| Ga0210405_109137372 | 3300021171 | Soil | VADLLSPQLKRLLGYVRPYTFRLAVGVAFVAFVALAEGGVALMIK |
| Ga0210388_109064661 | 3300021181 | Soil | VASLFSPQLKRLLGYVRPYAFRLVIGVILVAVVALAEGLTA |
| Ga0210387_118750201 | 3300021405 | Soil | VASLFSPQLKRLLGYVRPYALRLVIGVILVAVVALA |
| Ga0210383_102241783 | 3300021407 | Soil | VSSFLSPQLKRLFGYVRPYSLRLFVGLVLVAFVAIVEA |
| Ga0210383_114924972 | 3300021407 | Soil | VASLLSPQLKRLLSYVRPYAFRLSLGVVLVAFVALAEGLVAFMVKIAV |
| Ga0210394_103838362 | 3300021420 | Soil | VASLFSPQLKRLLGYVRPYALRLVIGVILVAVVALAEGLTALMIKPA |
| Ga0210391_101750341 | 3300021433 | Soil | VASWFSPQLKRLLSYERPYSVRLALGVLLVAFVAVAE |
| Ga0210402_103756521 | 3300021478 | Soil | VASLLSPQLKRLFAYVRPYSFRLGVGIVLVAITALADGI |
| Ga0210409_101584993 | 3300021559 | Soil | VASIVSPQLRRLLSYVRPYTFRLIAGVLLLAFVALAEGVIALL |
| Ga0207647_106036972 | 3300025904 | Corn Rhizosphere | VASLFSSQLKRLLSYVRPYSFRLLLGIVLLAVVAFAEGLVALMIRPAVD |
| Ga0207684_108578482 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VISPQWKRLLVYVRPYGVRLTIGVCLVAFVALAEGAV |
| Ga0207665_105894232 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LASAISPQLKRLLIYVRPYSVRLIFGVCLVAFVALAEGAVALMV |
| Ga0209863_100974441 | 3300026281 | Prmafrost Soil | VASVFTPQLKRLLSYVRPYGFRLAIGVVLVAFVALAEGLVA |
| Ga0209761_10183391 | 3300026313 | Grasslands Soil | VASFLSPQLKRLLGYVQPYSFRLALGVLLVAFVAVAEGGVALMIKLAVDFVLNPGA |
| Ga0209470_12127151 | 3300026324 | Soil | LLSPQLKRLLGYIRPYFLRMVTGVIFLAIVALAEGA |
| Ga0209377_11552681 | 3300026334 | Soil | VASLFSPQLKRLLTYVRPYSFRFTVGVILVAFVALAEGGVALMIRLAVDFV |
| Ga0257168_10399912 | 3300026514 | Soil | VASLFSPQLKRLLGYVRPYSFRLAVGVVLVAVVALAEG |
| Ga0257158_10037701 | 3300026515 | Soil | VASLSSPQWKRLLSYVRPYSFRLALGIVLVAFTALADGIVALLLRPAF |
| Ga0209378_10277501 | 3300026528 | Soil | VASLLSPQWKRLLSYVRPYSFRLAVGVVLVAITALADGIVALML |
| Ga0209157_12915541 | 3300026537 | Soil | LASVISPQWKRLLVYVRPYGVRLTIGVCLVAFVALAE |
| Ga0209161_100380381 | 3300026548 | Soil | VALLLTPQWKRLLSYVRPYSLRLSAGVVLLAFVALAEGAVTLLIVPI |
| Ga0209648_102027441 | 3300026551 | Grasslands Soil | VTSLLSPQWKRLLSYVRPYSFRLAVGVVLVAFTALADGI |
| Ga0209577_103558542 | 3300026552 | Soil | VALLLTPQWKRLLSYVRPYSFRLAVGVVLLAFVALAEGAVALLIVPIFD |
| Ga0207949_10191152 | 3300026999 | Forest Soil | VASLSSPQWKRLLSYVRPYSFRLAVGVALVAFTSLADGIVALLLRPAF |
| Ga0209076_10055411 | 3300027643 | Vadose Zone Soil | VTSLLSPQWKRLLSYVRPYSLRLAVGVVLVAFTALADGIVALMLRPGF |
| Ga0209736_10160221 | 3300027660 | Forest Soil | VASLLSPQWKRLLSYVGPYSFRLAVGVMLVAFTALADGIVALMLRPGFDYVLNP |
| Ga0209009_12003801 | 3300027667 | Forest Soil | VTSLLSPQWKRLLSYVRPYSFRLAVGVVLVAFTALADGIVALMLRPGFDYVL |
| Ga0209011_11882772 | 3300027678 | Forest Soil | VASWCSPQLKRLLGYVRPYSFRLGAGILLLAFVALAEGGVALMVAPAVD |
| Ga0209073_101081022 | 3300027765 | Agricultural Soil | VSSLFSPQLKRLLSYVRPYLVRLTLGVGLVAFVALAEGMVALMVKLA |
| Ga0209073_102871032 | 3300027765 | Agricultural Soil | VTAWLSPQLKRLLSYVRPYSLRLGLGVLLVAFVALAEGLVAFMVKLAWDFVLKP |
| Ga0209773_102733991 | 3300027829 | Bog Forest Soil | VASLFSPHLKRLFRYVRPYSFRLGFGILMMAAMAVAE |
| Ga0209580_100192371 | 3300027842 | Surface Soil | VASLFSPQLKRLLSYVRPYAFRLSIGVLLVAFVALADGL |
| Ga0209580_101354793 | 3300027842 | Surface Soil | VSALLSPQLKRLLSYVRPYAFRLSFGVVLVAFVALAEGMVALMVKIAVDYVLN |
| Ga0209166_103254781 | 3300027857 | Surface Soil | VASFFSPQLKRLLGYVRPYWAGMAIGIFALGLKALGELAVT |
| Ga0209283_102083853 | 3300027875 | Vadose Zone Soil | VASLLSPQWKRLLSYVRPYTFRLAVGVVLVAFTALADGIVALMLRPG |
| Ga0209283_109522741 | 3300027875 | Vadose Zone Soil | VASLLSPQWKRLLGYVRPYSFRLAVGVVLVACTALAEGIVALLIRPGFDY |
| Ga0209590_101347061 | 3300027882 | Vadose Zone Soil | VTSLLSPQWKRLLSYVRPYSFRLAVGVVLVAFTAL |
| Ga0209275_104649092 | 3300027884 | Soil | VARLFSPQLKRLLSYVRPYRLRMTLGVVLLALVAVAEG |
| Ga0209068_100850101 | 3300027894 | Watersheds | VASLLSPQLKRLFAYVRPYSFRLGVGIVLVAVTAL |
| Ga0209488_103517281 | 3300027903 | Vadose Zone Soil | VASLFSPQLKRLFSYVRPYTFRLAVGVVLVAFVAIAEGLVAFMARIAWDYVLTP |
| Ga0209488_106565272 | 3300027903 | Vadose Zone Soil | VASLFSPQLKRLLTYVRPYSFRFTVGVILVAFVALAEGGVALMIR |
| Ga0209488_109508632 | 3300027903 | Vadose Zone Soil | VASLLSPPWKRLLSYVRPYSFRLAVGIVLVAFTALADGIVALMIRPG |
| Ga0209168_101603432 | 3300027986 | Surface Soil | VASVFSPQLKRLLAYVRPYSLRLFVGIILLAIVAAAEGLVA |
| Ga0209526_105244412 | 3300028047 | Forest Soil | VASWLSPELKRLLNYVRPYSFRLMVGVLLLAFVALAEGGVALMIKLAVDFVLNL |
| Ga0209526_106290331 | 3300028047 | Forest Soil | VASLFSPQLKRLFAYVRPYSLRLGAGILLLAYVALAEGGVALM |
| Ga0209526_107429322 | 3300028047 | Forest Soil | VASLFSPQLKRLLGYVRPYAFRLVVGIILVAVVALAEGLV |
| Ga0137415_101921321 | 3300028536 | Vadose Zone Soil | VARFFSPQLKRLLSYVRPYRFRMFVGVVLLAFVAMAEGLIALII |
| Ga0265318_102538461 | 3300028577 | Rhizosphere | VASLLSPQLKRLLSYVRPYAFRLSLGVVLVAFVALAEGMVAFMVKIAVDYVLNPSV |
| Ga0308309_103262501 | 3300028906 | Soil | VASLFSPQLKRLLAYVRPYSLRLVAGILLLAFVALAEGGVALMVAPAVDRVL |
| Ga0308309_109035452 | 3300028906 | Soil | VPSLLSPQLKRLFGYVRPYLYRLVPGVVLMAFVALAEGGVALMIKL |
| Ga0302312_103573382 | 3300030746 | Palsa | VPSLFTPQLKRLLSYVRPYAFRLTVGVVLVAFVAL |
| Ga0265770_11088042 | 3300030878 | Soil | VAALFSPQLKRLFGYVRPYGLRLAGGVIMLAFMAAAEGLVALMIRLAVD |
| Ga0170824_1161942581 | 3300031231 | Forest Soil | VASLFSPQLKRLLAYVRPYSLRLTAGILLLAFVALAEGGVALMVAPAVDRV |
| Ga0265320_104871351 | 3300031240 | Rhizosphere | VASLLSPQLKRLLSYVRPYAFRLSLGVVLVAFVALAEGMVAFMVKIA |
| Ga0170820_130129802 | 3300031446 | Forest Soil | VASVFSPQLKRLLAYVRPYAIRLGVGIFLLAIVAITEGLVALMIKPAVDYVLDPSVVGS |
| Ga0170819_131573852 | 3300031469 | Forest Soil | VASVFSPQLKRLLAYVRPYALRLGVGIVLLAIVALTEGLVALMIKPAVDYVLDPSVV |
| Ga0310686_1060045721 | 3300031708 | Soil | VASLFSPQLKRLLGYVRPYAFRLAVGVVLLAVVALAEGLVAL |
| Ga0310686_1086512141 | 3300031708 | Soil | VASWFSPQLKRLFAYVWPYSFRLTLGVLLLAFVALAEGCVAFMIKLAVDF |
| Ga0307474_101007762 | 3300031718 | Hardwood Forest Soil | VASLFSPQLKRLLGYVRPYSFRLAVGVVLVAVVALAEGLVALMIKPADE |
| Ga0307469_101660793 | 3300031720 | Hardwood Forest Soil | VASWLSPELKRLLSYVRPYSFRLTLGVFLLAFVALAEGGVALMIKLAVD |
| Ga0307477_111299822 | 3300031753 | Hardwood Forest Soil | VASVLSPQMKRLLGYVRPYLFRMSLGVVLLAIVALAEGAV |
| Ga0307475_100694823 | 3300031754 | Hardwood Forest Soil | VALSLPPQLKRLLGYVRPYAIRLTLGILLVAFVAVAEGLVALMVK |
| Ga0307475_104750142 | 3300031754 | Hardwood Forest Soil | VASFLSPQLKRLLGYLRPYALRFGLGIILVAFVALAEGAVALMIKLAVDFVLN |
| Ga0318546_112537212 | 3300031771 | Soil | VGSLVSGQLKRLLGYTRPYWLRLVAGVLLVAYVAFAEGS |
| Ga0318503_102682401 | 3300031794 | Soil | VALSLPPQLKRLLGYVRPYSIRLALGILLVAFVAVAEGLVALMVKLA |
| Ga0307473_113375711 | 3300031820 | Hardwood Forest Soil | VASLLSPPWKRLLSYVRPYSFRLAVGIVLVAFTALADGIVA |
| Ga0307479_105704563 | 3300031962 | Hardwood Forest Soil | VASFLSPQLKRLLGYLRPYALRFGLGIILVAFVALAEGA |
| Ga0307479_114350961 | 3300031962 | Hardwood Forest Soil | VASLLSPQLKRLFAYVRPYSFRLGVGIVLVAVTALADGIVALMLRPGFDYVLNP |
| Ga0306924_124294042 | 3300032076 | Soil | VPSLLSPQLKRLLTYVRPYSFRLALGIVLVAFVALAEAVVA |
| Ga0311301_103291021 | 3300032160 | Peatlands Soil | VASWFSPQLKRLLSYERPYAFRLALGVLLVAFVAVAEGAV |
| Ga0307471_1003829131 | 3300032180 | Hardwood Forest Soil | MSPQWKRLLVYVRPYGVRLTIGVCLVAFVALAEGAVALMVRLAIDYVL |
| Ga0307471_1003871433 | 3300032180 | Hardwood Forest Soil | VASLLSPQLKRLLSYVRPYSFRLTLGVVLVAFVALAEGMVAFMVKIAVDYVLNPSVFV |
| Ga0335076_101682961 | 3300032955 | Soil | VVSLLSPRLKRLLSYARPYAFRLSLGVALVAFVALA |
| ⦗Top⦘ |