| Basic Information | |
|---|---|
| Family ID | F040285 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 162 |
| Average Sequence Length | 46 residues |
| Representative Sequence | IAAGDLPVERVVTSNVTLDDAPDAFARLASGAADEIKVLVDQ |
| Number of Associated Samples | 144 |
| Number of Associated Scaffolds | 162 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.38 % |
| % of genes from short scaffolds (< 2000 bps) | 97.53 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (65.432 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.963 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.420 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.57% β-sheet: 20.00% Coil/Unstructured: 61.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 162 Family Scaffolds |
|---|---|---|
| PF08240 | ADH_N | 94.44 |
| PF13823 | ADH_N_assoc | 2.47 |
| PF07883 | Cupin_2 | 1.23 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 65.43 % |
| All Organisms | root | All Organisms | 34.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725004|GPKC_F5OHE3B02FZR2O | Not Available | 500 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig518396 | Not Available | 864 | Open in IMG/M |
| 2170459017|G14TP7Y01B10Y5 | Not Available | 649 | Open in IMG/M |
| 3300000550|F24TB_14794088 | Not Available | 548 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101622556 | Not Available | 544 | Open in IMG/M |
| 3300004114|Ga0062593_101786796 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300004156|Ga0062589_101520287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300004479|Ga0062595_102201886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300004803|Ga0058862_12398528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300005167|Ga0066672_10962342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300005327|Ga0070658_10923191 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300005329|Ga0070683_101517516 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005331|Ga0070670_101887786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300005337|Ga0070682_100065500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2309 | Open in IMG/M |
| 3300005356|Ga0070674_100243297 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300005367|Ga0070667_101832928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300005435|Ga0070714_101141405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
| 3300005435|Ga0070714_102054855 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005437|Ga0070710_11231684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300005441|Ga0070700_100122869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1742 | Open in IMG/M |
| 3300005446|Ga0066686_10962035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300005458|Ga0070681_11166179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 692 | Open in IMG/M |
| 3300005467|Ga0070706_101558348 | Not Available | 603 | Open in IMG/M |
| 3300005536|Ga0070697_101304412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300005539|Ga0068853_100632033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1018 | Open in IMG/M |
| 3300005544|Ga0070686_100715299 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300005566|Ga0066693_10358859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 588 | Open in IMG/M |
| 3300005616|Ga0068852_101740738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 646 | Open in IMG/M |
| 3300005616|Ga0068852_102793128 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005834|Ga0068851_10609123 | Not Available | 665 | Open in IMG/M |
| 3300005840|Ga0068870_10682565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 707 | Open in IMG/M |
| 3300006028|Ga0070717_10812214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 851 | Open in IMG/M |
| 3300006034|Ga0066656_10620081 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300006046|Ga0066652_101902845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 534 | Open in IMG/M |
| 3300006058|Ga0075432_10562431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300006173|Ga0070716_100361465 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300006175|Ga0070712_101118368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
| 3300006175|Ga0070712_101446371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 600 | Open in IMG/M |
| 3300006354|Ga0075021_10525982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 751 | Open in IMG/M |
| 3300006578|Ga0074059_11913633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
| 3300006605|Ga0074057_11947008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
| 3300006755|Ga0079222_11146608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 689 | Open in IMG/M |
| 3300006755|Ga0079222_11557120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
| 3300006800|Ga0066660_11477574 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300006804|Ga0079221_10725560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
| 3300006852|Ga0075433_10349786 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300006852|Ga0075433_11474246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 588 | Open in IMG/M |
| 3300006881|Ga0068865_101025364 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300006954|Ga0079219_10278546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1018 | Open in IMG/M |
| 3300009011|Ga0105251_10441726 | Not Available | 602 | Open in IMG/M |
| 3300009093|Ga0105240_12228637 | Not Available | 568 | Open in IMG/M |
| 3300009094|Ga0111539_10071166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4104 | Open in IMG/M |
| 3300009098|Ga0105245_10328768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1508 | Open in IMG/M |
| 3300009100|Ga0075418_10450708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1378 | Open in IMG/M |
| 3300009137|Ga0066709_100472970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1758 | Open in IMG/M |
| 3300009137|Ga0066709_100945553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1259 | Open in IMG/M |
| 3300009137|Ga0066709_102784150 | Not Available | 649 | Open in IMG/M |
| 3300009137|Ga0066709_104045440 | Not Available | 533 | Open in IMG/M |
| 3300009156|Ga0111538_11980526 | Not Available | 733 | Open in IMG/M |
| 3300009174|Ga0105241_12522854 | Not Available | 515 | Open in IMG/M |
| 3300009551|Ga0105238_11228296 | Not Available | 774 | Open in IMG/M |
| 3300009551|Ga0105238_12702819 | Not Available | 533 | Open in IMG/M |
| 3300010036|Ga0126305_10381454 | Not Available | 927 | Open in IMG/M |
| 3300010041|Ga0126312_10902895 | Not Available | 644 | Open in IMG/M |
| 3300010042|Ga0126314_10401511 | Not Available | 988 | Open in IMG/M |
| 3300010044|Ga0126310_10613903 | Not Available | 813 | Open in IMG/M |
| 3300010152|Ga0126318_10829655 | Not Available | 506 | Open in IMG/M |
| 3300010152|Ga0126318_10858232 | Not Available | 679 | Open in IMG/M |
| 3300010321|Ga0134067_10309573 | Not Available | 611 | Open in IMG/M |
| 3300010362|Ga0126377_13512018 | Not Available | 507 | Open in IMG/M |
| 3300010366|Ga0126379_12159151 | Not Available | 658 | Open in IMG/M |
| 3300010375|Ga0105239_12486462 | Not Available | 603 | Open in IMG/M |
| 3300010396|Ga0134126_10902739 | Not Available | 994 | Open in IMG/M |
| 3300010397|Ga0134124_12054376 | Not Available | 609 | Open in IMG/M |
| 3300010399|Ga0134127_13707874 | Not Available | 502 | Open in IMG/M |
| 3300011119|Ga0105246_10927255 | Not Available | 783 | Open in IMG/M |
| 3300012011|Ga0120152_1112465 | Not Available | 758 | Open in IMG/M |
| 3300012198|Ga0137364_10860443 | Not Available | 685 | Open in IMG/M |
| 3300012209|Ga0137379_10435918 | Not Available | 1219 | Open in IMG/M |
| 3300012210|Ga0137378_11036359 | Not Available | 734 | Open in IMG/M |
| 3300012211|Ga0137377_10837159 | Not Available | 852 | Open in IMG/M |
| 3300012212|Ga0150985_115024545 | Not Available | 510 | Open in IMG/M |
| 3300012492|Ga0157335_1031122 | Not Available | 560 | Open in IMG/M |
| 3300012905|Ga0157296_10315056 | Not Available | 553 | Open in IMG/M |
| 3300012906|Ga0157295_10113405 | Not Available | 763 | Open in IMG/M |
| 3300012911|Ga0157301_10207612 | Not Available | 663 | Open in IMG/M |
| 3300012917|Ga0137395_10747094 | Not Available | 708 | Open in IMG/M |
| 3300012955|Ga0164298_11455717 | Not Available | 533 | Open in IMG/M |
| 3300012957|Ga0164303_10533453 | Not Available | 758 | Open in IMG/M |
| 3300012958|Ga0164299_10799659 | Not Available | 672 | Open in IMG/M |
| 3300012975|Ga0134110_10493761 | Not Available | 556 | Open in IMG/M |
| 3300012984|Ga0164309_11875050 | Not Available | 514 | Open in IMG/M |
| 3300012986|Ga0164304_10897382 | Not Available | 693 | Open in IMG/M |
| 3300012987|Ga0164307_11474577 | Not Available | 575 | Open in IMG/M |
| 3300013296|Ga0157374_11989366 | Not Available | 607 | Open in IMG/M |
| 3300013297|Ga0157378_11468036 | Not Available | 726 | Open in IMG/M |
| 3300013297|Ga0157378_12990054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 524 | Open in IMG/M |
| 3300013306|Ga0163162_10052217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 4105 | Open in IMG/M |
| 3300013306|Ga0163162_11253092 | Not Available | 842 | Open in IMG/M |
| 3300013306|Ga0163162_11962898 | Not Available | 670 | Open in IMG/M |
| 3300013308|Ga0157375_12304894 | Not Available | 642 | Open in IMG/M |
| 3300014497|Ga0182008_10994654 | Not Available | 500 | Open in IMG/M |
| 3300014745|Ga0157377_10828997 | Not Available | 685 | Open in IMG/M |
| 3300014968|Ga0157379_10376426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1302 | Open in IMG/M |
| 3300015371|Ga0132258_11202533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1916 | Open in IMG/M |
| 3300015372|Ga0132256_103138631 | Not Available | 556 | Open in IMG/M |
| 3300015373|Ga0132257_102809173 | Not Available | 635 | Open in IMG/M |
| 3300015373|Ga0132257_103056892 | Not Available | 609 | Open in IMG/M |
| 3300016422|Ga0182039_10909115 | Not Available | 786 | Open in IMG/M |
| 3300017936|Ga0187821_10304133 | Not Available | 634 | Open in IMG/M |
| 3300018063|Ga0184637_10594546 | Not Available | 627 | Open in IMG/M |
| 3300018077|Ga0184633_10332173 | Not Available | 770 | Open in IMG/M |
| 3300018082|Ga0184639_10398055 | Not Available | 711 | Open in IMG/M |
| 3300018482|Ga0066669_11927262 | Not Available | 551 | Open in IMG/M |
| 3300019356|Ga0173481_10596607 | Not Available | 580 | Open in IMG/M |
| 3300019885|Ga0193747_1042283 | Not Available | 1136 | Open in IMG/M |
| 3300019888|Ga0193751_1165446 | Not Available | 778 | Open in IMG/M |
| 3300020082|Ga0206353_11608081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1564 | Open in IMG/M |
| 3300021073|Ga0210378_10293388 | Not Available | 612 | Open in IMG/M |
| 3300023057|Ga0247797_1006930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1278 | Open in IMG/M |
| 3300023102|Ga0247754_1008929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2051 | Open in IMG/M |
| 3300025910|Ga0207684_11214698 | Not Available | 624 | Open in IMG/M |
| 3300025911|Ga0207654_11067069 | Not Available | 588 | Open in IMG/M |
| 3300025914|Ga0207671_11535445 | Not Available | 513 | Open in IMG/M |
| 3300025916|Ga0207663_11634217 | Not Available | 518 | Open in IMG/M |
| 3300025920|Ga0207649_10759952 | Not Available | 755 | Open in IMG/M |
| 3300025920|Ga0207649_11043873 | Not Available | 644 | Open in IMG/M |
| 3300025922|Ga0207646_11472978 | Not Available | 590 | Open in IMG/M |
| 3300025924|Ga0207694_10708609 | Not Available | 849 | Open in IMG/M |
| 3300025924|Ga0207694_11417435 | Not Available | 587 | Open in IMG/M |
| 3300025926|Ga0207659_10404852 | Not Available | 1142 | Open in IMG/M |
| 3300025932|Ga0207690_10381841 | Not Available | 1120 | Open in IMG/M |
| 3300025932|Ga0207690_11360014 | Not Available | 594 | Open in IMG/M |
| 3300025949|Ga0207667_11424646 | Not Available | 666 | Open in IMG/M |
| 3300025972|Ga0207668_12157194 | Not Available | 501 | Open in IMG/M |
| 3300025981|Ga0207640_11392600 | Not Available | 628 | Open in IMG/M |
| 3300025986|Ga0207658_10363657 | Not Available | 1263 | Open in IMG/M |
| 3300026075|Ga0207708_11652541 | Not Available | 563 | Open in IMG/M |
| 3300026121|Ga0207683_11708021 | Not Available | 579 | Open in IMG/M |
| 3300026142|Ga0207698_11977913 | Not Available | 597 | Open in IMG/M |
| 3300026300|Ga0209027_1235117 | Not Available | 587 | Open in IMG/M |
| 3300026318|Ga0209471_1272540 | Not Available | 568 | Open in IMG/M |
| 3300027725|Ga0209178_1387375 | Not Available | 529 | Open in IMG/M |
| 3300028293|Ga0247662_1055690 | Not Available | 692 | Open in IMG/M |
| 3300028380|Ga0268265_11801198 | Not Available | 619 | Open in IMG/M |
| 3300028587|Ga0247828_11031269 | Not Available | 540 | Open in IMG/M |
| 3300028717|Ga0307298_10271289 | Not Available | 506 | Open in IMG/M |
| 3300028744|Ga0307318_10119786 | Not Available | 896 | Open in IMG/M |
| 3300028771|Ga0307320_10468016 | Not Available | 509 | Open in IMG/M |
| 3300028796|Ga0307287_10262448 | Not Available | 654 | Open in IMG/M |
| 3300028802|Ga0307503_10658232 | Not Available | 584 | Open in IMG/M |
| 3300028807|Ga0307305_10059559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1760 | Open in IMG/M |
| 3300028811|Ga0307292_10147483 | Not Available | 949 | Open in IMG/M |
| 3300028876|Ga0307286_10258574 | Not Available | 638 | Open in IMG/M |
| 3300028884|Ga0307308_10138368 | Not Available | 1165 | Open in IMG/M |
| 3300028889|Ga0247827_10729777 | Not Available | 649 | Open in IMG/M |
| 3300031726|Ga0302321_102740184 | Not Available | 576 | Open in IMG/M |
| 3300031918|Ga0311367_11793707 | Not Available | 596 | Open in IMG/M |
| 3300031995|Ga0307409_100202534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1777 | Open in IMG/M |
| 3300031995|Ga0307409_102021738 | Not Available | 606 | Open in IMG/M |
| 3300032017|Ga0310899_10311584 | Not Available | 733 | Open in IMG/M |
| 3300032074|Ga0308173_12278998 | Not Available | 511 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.32% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.70% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.09% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.09% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.09% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.09% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.47% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.23% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.23% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.23% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.23% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.62% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.62% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.62% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.62% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.62% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.62% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725004 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300023057 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6 | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300028293 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPKC_07945340 | 2067725004 | Soil | WVYDFDRIAAQISAGDLPVERVVTSTVTLDRAPDMFAQLASGEADEMKVLVDQ |
| KansclcFeb2_05363770 | 2124908045 | Soil | AGGLPVERVVTRTIGLEDAPDAFAALASGSADEIKVLIDQ |
| 4ZMR_04401480 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | QIAAGDLPVERVVTSGVGLDDAPDAFERLASGAADEIKVLVER |
| F24TB_147940881 | 3300000550 | Soil | CYWVYDFDRIAAQIEAGDLPVERAVTSNVILDDAPDAFARLASGTADEIKELIDHEE* |
| JGIcombinedJ26739_1016225562 | 3300002245 | Forest Soil | ERVVTSSVALDGAPGAFALLASGTADEIKVLVDQ* |
| Ga0062593_1017867962 | 3300004114 | Soil | AGDLPVERVVTSQVDLDGAPDAFARLASGAADEIKVLVDQ* |
| Ga0062589_1015202872 | 3300004156 | Soil | YWVYDFDRIAAQIAAGDLPVERVVTSHVGLDDAPGAFELLASGTADEMKILIDQ* |
| Ga0062595_1022018862 | 3300004479 | Soil | RIAAQIAAGDLPVERAVTSAVALDDAPDAFARLASGTADEIKVLIDHE* |
| Ga0058862_123985281 | 3300004803 | Host-Associated | VYDFDRIAAQIASGSLPVERVVTSTVSLDGAPDAFAMLASGTADEIKVLVEQ* |
| Ga0066672_109623421 | 3300005167 | Soil | WVYDFDRIAAQIAAGDLPVERVITSNVGLEEAPDAFARLASGSADEIKVLVEQ* |
| Ga0070658_109231912 | 3300005327 | Corn Rhizosphere | WVYDFDRIAAQIAAGDLPVERIVTRTARLDDAPDVFAQLASGKADEIKVLIDQ* |
| Ga0070683_1015175161 | 3300005329 | Corn Rhizosphere | TWCYWVYDFDRVAAQIAAGDLPVERVVTSHVGLDGSPDAFERLASGAADEIKVLIDQ* |
| Ga0070670_1018877862 | 3300005331 | Switchgrass Rhizosphere | GDLPVERVVTRTIGLGDAPDAFAALASGTADEIKVLIDQ* |
| Ga0070682_1000655003 | 3300005337 | Corn Rhizosphere | TWCYWVYDFDRIAAQIGTGSLPVERVVTSSVALGDAPDAFARLASGAADEIKVLVDQ* |
| Ga0070674_1002432971 | 3300005356 | Miscanthus Rhizosphere | RVAAQIAAGDLPVERVVTSHVALDDAPDAFERLASGAADEIKVLIDQ* |
| Ga0070667_1018329281 | 3300005367 | Switchgrass Rhizosphere | CYWVYDFERIAAQIAAGDLPVERVITGSRTLDDAPDAFASLASGKADEIKVLINQ* |
| Ga0070714_1011414052 | 3300005435 | Agricultural Soil | RIVSQIATGSLPVERVITSGVTLDGAPDAFARLASGTADEIKVLIDQ* |
| Ga0070714_1020548552 | 3300005435 | Agricultural Soil | WCYWVYDFDRIAAQIGTGNLPVERVVTSNVSLDDAPEAFQRLASGAADEIKVLVDH* |
| Ga0070710_112316842 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | YWVYDFDRIAAQIGTGNLPVERVVTSNVSLDDAPEAFQRLASGAADEIKVLVDH* |
| Ga0070700_1001228691 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | AQIAAGDLPVERVVTRTIGLGDAPDAFAALASGTADEIKVLIDQ* |
| Ga0066686_109620351 | 3300005446 | Soil | IAAGDLPVERVVTSNVTLDDAPDAFARLASGAADEIKVLVDQ* |
| Ga0070681_111661792 | 3300005458 | Corn Rhizosphere | QIAAGDLPVERVITSNVGLDEAPDAFARLASGSADEIKVLVDQ* |
| Ga0070706_1015583481 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | YDFDRIAAQIEAGDLPVERAVTSNVILDDAPDAFARLASGTADEIKVLIDHEE* |
| Ga0070697_1013044122 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | QIAAGSLPVERIVTSRDTLDGAPDAFARLASGAADEIKVLIDQ* |
| Ga0068853_1006320331 | 3300005539 | Corn Rhizosphere | YDFDRIAAQIASGSLPVERVVTSTVSLDGAPDAFAMLASGTADEIKVLVEQ* |
| Ga0070686_1007152992 | 3300005544 | Switchgrass Rhizosphere | GDLPVERVVTSHVELDGAPDAFERLASGAADEIKVLIDQ* |
| Ga0066693_103588591 | 3300005566 | Soil | TWCYWVYDFDRIAAQIAAGDLPVERVVTSSVALDGAPDAFAQLASGTADEIKVLVEQ* |
| Ga0068852_1017407381 | 3300005616 | Corn Rhizosphere | FDRIVAQIAAGDLPVERIVTRTVPLDDAPDVFAQLASGKADEIKVSIDQ* |
| Ga0068852_1027931282 | 3300005616 | Corn Rhizosphere | GDLPVERVITSGVELDEAPEAFARLASGAADEIKVLVER* |
| Ga0068851_106091231 | 3300005834 | Corn Rhizosphere | ERVITSSTSLDGAPDAFARLASGTADEMKVLINQ* |
| Ga0068870_106825651 | 3300005840 | Miscanthus Rhizosphere | WCYWVYDFDRIAAQIAAGDLPVERVVTGRVDLDGAPEAFARLASGTADEIKVLIDQ* |
| Ga0070717_108122141 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FDRIAAQIAAGDLPVERVVTSSVDLDRAPDAFEQLASGGADEIKVLVEQ* |
| Ga0066656_106200811 | 3300006034 | Soil | YWVYDFDRIAAQISAGDLPVERVVTSTVTLDGAHNAFARLASGAADEIKVLVDQ* |
| Ga0066652_1019028451 | 3300006046 | Soil | TWCYWVYDFDRIAAQIAAGDLPVERVVTSTVTLDDAPEAFARLASGAADEIKVLVDQ* |
| Ga0075432_105624311 | 3300006058 | Populus Rhizosphere | VYDFDRIAAQIAAGDLPVERVVTRTIGLDDAPDAFAELASGTADEIKVLIDQ* |
| Ga0070716_1003614652 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TWCYWVYDFDRIAAQIAAGDLPVERVVTSSAALDDAPHAFERLASGAADEIKVLIDQ* |
| Ga0070712_1011183681 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GTLPVERVVTSTVLLGDAPGAFERLASGGADEIKVLVDQ* |
| Ga0070712_1014463712 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | WCYWVYDFDRIAAQIAAGDLPVERVITSQVGLTEAPEAFERLASGTADEIKVLVNQ* |
| Ga0075021_105259822 | 3300006354 | Watersheds | CYWVYDFDRIAAQIAAGDLPVERVITSSVTLDGAPDAFALLASGTADEIKVLIDQ* |
| Ga0074059_119136331 | 3300006578 | Soil | WVYDFERIAAQIAAGDLPVERVVTSSGALDDAPGAFASLASGEADEIKVLINQ* |
| Ga0074057_119470082 | 3300006605 | Soil | TWCYWVYDFERIAAQIAAGDLPVERVVTSSGALDDAPGAFASLASGEADEIKVLINQ* |
| Ga0079222_111466082 | 3300006755 | Agricultural Soil | LPVERVITSNVTLDDAPDAFDRLASGTADEIKVLIDQ* |
| Ga0079222_115571202 | 3300006755 | Agricultural Soil | AAQIAAGDLPVERVVTSTHSLDEAPDAFAMLASGSADEIKVLIDQQGETR* |
| Ga0066660_114775742 | 3300006800 | Soil | RLPVEKIITSTVGLDDAPESFAQLASGSASEIKVLVDQ* |
| Ga0079221_107255601 | 3300006804 | Agricultural Soil | IASQIAAGDLPVERVVTSSATLDDAPEAFARLASGTADEIKVLIDQ* |
| Ga0075433_103497861 | 3300006852 | Populus Rhizosphere | RVAAQIAAGSLPVERVITSKVSLDDSPDAFERLASGTADEIKILVEQ* |
| Ga0075433_114742462 | 3300006852 | Populus Rhizosphere | TWCYWVYDFDRIAAQIAAGDLPVERVVTGRVDLDGAPEAFARLASGTADEIKVLIDQ* |
| Ga0068865_1010253642 | 3300006881 | Miscanthus Rhizosphere | TWCYWVYDFDRVAAQIAAGDLPVERVVTSHVELDGAPDAFERLASGAADEIKVLIDQ* |
| Ga0079219_102785461 | 3300006954 | Agricultural Soil | QIGAGSLPVERVITSTVGLDDAPDAFARLASGAADEIKVLVVQ* |
| Ga0105251_104417262 | 3300009011 | Switchgrass Rhizosphere | YWVYDFDRVAAQIAAGDLPVERVVTSHVGLDDAPDAFERLASGAADEIKVLIDQ* |
| Ga0105240_122286371 | 3300009093 | Corn Rhizosphere | TWCYWVYDFDRVAAQIGAGTLPVERVITSTITLGEAPGAFERLASGSADEIKILIDQ* |
| Ga0111539_100711661 | 3300009094 | Populus Rhizosphere | AQIAAGDLPVERIVTRTARLDDAPDVFAQLASGKADEIKVLIDE* |
| Ga0105245_103287681 | 3300009098 | Miscanthus Rhizosphere | DLPVERIVTRTVPLDDAPDVFAQLASGKADEIKVLIDQ* |
| Ga0075418_104507081 | 3300009100 | Populus Rhizosphere | TWCYWVYDFDRVAAQIAAGDLPVERVVTSHVTLDDAPDAFERLASGAADEIKVLIDQ* |
| Ga0066709_1004729703 | 3300009137 | Grasslands Soil | RLPVEKIITSTVGLDEAPESFAQLASGSASEIKVLVDQ* |
| Ga0066709_1009455533 | 3300009137 | Grasslands Soil | ERVVTSNVTLDAAPDAFARLASGAADEIKVLIDQ* |
| Ga0066709_1027841501 | 3300009137 | Grasslands Soil | RIAAQIAAGDLPVERVVTSNVTLDDAPEAFARLASGAADEIKVLIDQ* |
| Ga0066709_1040454401 | 3300009137 | Grasslands Soil | PVERTVTSNVILDDAPDAFARLASGAADEIKVLIDHEE* |
| Ga0111538_119805261 | 3300009156 | Populus Rhizosphere | LPVERVVTGRVDLDGAPEAFARLASGTADEIKVLIDQ* |
| Ga0105241_125228542 | 3300009174 | Corn Rhizosphere | PVERVVTSQVDLDGAPDAFARLASGAADEIKVLVDQ* |
| Ga0105238_112282961 | 3300009551 | Corn Rhizosphere | AAGDLPVERVITGSRTLDDAPDAFASLASGKADEIKVLINQ* |
| Ga0105238_127028192 | 3300009551 | Corn Rhizosphere | RIAAQIAAGDLPVERVVTRTIGLGDAPDAFAALASGTADEIKVLIDQ* |
| Ga0126305_103814542 | 3300010036 | Serpentine Soil | YWVYDFDRIAAQIGAGSLPVERVITSNVPLADAPDAFARLASGAADEIKILVDQ* |
| Ga0126312_109028952 | 3300010041 | Serpentine Soil | RVVTSTIGLDEAPAAFSDLASGNADEIKVLIRLGEVE* |
| Ga0126314_104015111 | 3300010042 | Serpentine Soil | ASQIAAGSLPVERVITSSVGLDESPDAFARLASGSADEIKVLVDQ* |
| Ga0126310_106139031 | 3300010044 | Serpentine Soil | ERVITSNVPLADAPDAFARLASGAADEIKILVDQ* |
| Ga0126318_108296551 | 3300010152 | Soil | AGSLPVERVITSTVRLDDAPDAFSRLASGAADEIKVLVAQ* |
| Ga0126318_108582322 | 3300010152 | Soil | YDFDRIAAQIAAGSLPVERVVTSTVTLDNAPDAFAMLASGTADEIKVLVEQ* |
| Ga0134067_103095731 | 3300010321 | Grasslands Soil | RIASQIAAGALPVERVVTSNVTLDDAPDAFARLASGAADEIKVLIDQ* |
| Ga0126377_135120181 | 3300010362 | Tropical Forest Soil | QIAAGDLPVERVVTSSATLDDAPDAFARLASGTADEIKVLIDQ* |
| Ga0126379_121591512 | 3300010366 | Tropical Forest Soil | WCYWVYDFDRIAAQIAAGDLPVERVVTSNTTLDAAPDAFERLASGAADETKVLIDQ* |
| Ga0105239_124864621 | 3300010375 | Corn Rhizosphere | AQIAAGDLPVERVVTSEVDLDGAPDAFARLASGAADEIKVLVDQ* |
| Ga0134126_109027391 | 3300010396 | Terrestrial Soil | AAGDLPVERVITSSVELDGAPDAFAQLASGAADEIKVLVEQ* |
| Ga0134124_120543762 | 3300010397 | Terrestrial Soil | YDFDRVAAQIAGGGLPVERVITGKVGLDDAPAAFERLASGTADEIKVLVAQ* |
| Ga0134127_137078741 | 3300010399 | Terrestrial Soil | DFDRIAAQIAAGDLPVERVVTGRVDLDGAPEAFARLASGTADEIKVLIDQ* |
| Ga0105246_109272551 | 3300011119 | Miscanthus Rhizosphere | FDRVAAQIAAGDLPVERVVTSHVELDGAPDAFERLASGAADEIKVLIDQ* |
| Ga0120152_11124651 | 3300012011 | Permafrost | RRSPSTPIAAQIAAGSLPVERVVTSSVTLDGAPDAFARLASGAADEIKVMVDQ* |
| Ga0137364_108604431 | 3300012198 | Vadose Zone Soil | ERVVTSEIDLEGAPDAFARLASGAADEIKVLIDQ* |
| Ga0137379_104359181 | 3300012209 | Vadose Zone Soil | FDRIAAQIAAGDLPVERVVTSRVGVDGTPDAFALLASGAADEIKVLVDQ* |
| Ga0137378_110363591 | 3300012210 | Vadose Zone Soil | DRIAAQIAAGDLPVERVVTGNIPLDGAQDAFARLASGVADEIKVLIDQ* |
| Ga0137377_108371592 | 3300012211 | Vadose Zone Soil | IAAQIAAGDLPVERIVTSNVTMDDAPDAFARLASGAADEIKVLIDQ* |
| Ga0150985_1150245452 | 3300012212 | Avena Fatua Rhizosphere | DFDRIAAQIAAGRLPVERVVTSSATLDGAPDAFERLASGAADEIKVLIDQ* |
| Ga0157335_10311222 | 3300012492 | Arabidopsis Rhizosphere | DRVVTSEVELDGAPDAFARLASGAADEIKVLIDQ* |
| Ga0157296_103150562 | 3300012905 | Soil | IAAGDLPVDRVVTSEVELDGAPDAFARLASGAADEIKVLIDQ* |
| Ga0157295_101134051 | 3300012906 | Soil | PVERVVTSHVELDGAPDAFERLASGAADEIKVLIDQ* |
| Ga0157301_102076121 | 3300012911 | Soil | CYWVYDFDRIAAQIAAGDLPVERVETGRVDLEGAPEAFARLASGTADEIKVLIDQ* |
| Ga0137395_107470942 | 3300012917 | Vadose Zone Soil | QIGAGSLPVERVVTSSVTLDDAPDAFARLASGAADEIKVLVNQ* |
| Ga0164298_114557171 | 3300012955 | Soil | IGTGSLPVERVITSTVTLDGAPDAFARLASGGADEIKVLVDQ* |
| Ga0164303_105334531 | 3300012957 | Soil | DFDRIAAQIAAGDLPVERVITSQVGLTEAPEAFERLASGTADEIKVLVNQ* |
| Ga0164299_107996591 | 3300012958 | Soil | ERVVTRTVGLDDAPDIFAQLASGTADEIKVLVDQ* |
| Ga0134110_104937612 | 3300012975 | Grasslands Soil | VVRVVTSNVTLDAAPDAFARLASGAADEIKVLIDQ* |
| Ga0164309_118750502 | 3300012984 | Soil | DLPVERVVTRTVPLDEAPDVFAELASGSADEIKVLIDQ* |
| Ga0164304_108973822 | 3300012986 | Soil | VYDFDRIVAQIAAGDLPVERIVTRTVPLDDAPDVFAQLASGKADEIKVLIDQ* |
| Ga0164307_114745772 | 3300012987 | Soil | RIAAQIGTGRLPVERVIRSTVTLDGAPDAFARLPSGGADEIKVLVDQ* |
| Ga0157374_119893662 | 3300013296 | Miscanthus Rhizosphere | FDRVAAQIAAGDLPVERDITSNVGLSDAPDAFARLASGTADEIKVLVDQ* |
| Ga0157378_114680362 | 3300013297 | Miscanthus Rhizosphere | VERIVTRTARLDDAPDVFAQLASGKADEIKVLIDQ* |
| Ga0157378_129900542 | 3300013297 | Miscanthus Rhizosphere | VEAQNAAGDLPVERVVTSHVELDGAPDAFERLASGAADEIKVLIDQ* |
| Ga0163162_100522177 | 3300013306 | Switchgrass Rhizosphere | QIAAGDLPVERIVTRTARLNDAPDVFAQLASGKADEIKVLIDQ* |
| Ga0163162_112530921 | 3300013306 | Switchgrass Rhizosphere | IAAQIGAGSLPVERVVTSSVALDDAPDAFARLASGAADEIKVLVEQ* |
| Ga0163162_119628983 | 3300013306 | Switchgrass Rhizosphere | LPVERVVTSSGTLDGAPDAFARLASGAADEIKVLIGQ* |
| Ga0157375_123048942 | 3300013308 | Miscanthus Rhizosphere | AAGDLPVERVVTSHVGLDDAPDAFERLASGAADEIKVLIDQ* |
| Ga0182008_109946542 | 3300014497 | Rhizosphere | AAGSLPVERVITSNVGVDEAPDAFARLASGAADEIKVLVDQRGGQR* |
| Ga0157377_108289971 | 3300014745 | Miscanthus Rhizosphere | GSLPVERVVTSSVALDDAPDAFARLASGAADEIKVLVEQ* |
| Ga0157379_103764261 | 3300014968 | Switchgrass Rhizosphere | TWCYWVYDFDRIAAQIAAGDLPVERVVTSTHSLDEAPDAFAMLASGSADEIKVLIDQQGETR* |
| Ga0132258_112025331 | 3300015371 | Arabidopsis Rhizosphere | GALPVERVVTSHVELDGAPDAFERLASGAADEIKVLIDH* |
| Ga0132256_1031386312 | 3300015372 | Arabidopsis Rhizosphere | AAQIAAGDLPVERVVTRTIGLDDAPDAFAELASGTADEIKVLIDQ* |
| Ga0132257_1028091732 | 3300015373 | Arabidopsis Rhizosphere | VERVVTSTVTLDGAPDAFERLASGAADEIKVLVDQ* |
| Ga0132257_1030568922 | 3300015373 | Arabidopsis Rhizosphere | LPVERVVTSSVALDDAPDAFARLASGAADEIKVLVEQ* |
| Ga0182039_109091151 | 3300016422 | Soil | AAQIAAGDLPVERVVTSNTTLDAAPDAFERLASGAADEIKVLIDQ |
| Ga0187821_103041331 | 3300017936 | Freshwater Sediment | VERVITSTVVLDDAPDAFARLASGAADEIKVLVAQ |
| Ga0184637_105945461 | 3300018063 | Groundwater Sediment | WVYDFDRIAAQIGAGDLPVERAVTSNVILDDAPDAFARLASGTADEIKVLIDHEE |
| Ga0184633_103321732 | 3300018077 | Groundwater Sediment | AAQIAAGDLPVEQAVTSNVILDDAPDAFARLASGTADEIKVLIDHEE |
| Ga0184639_103980551 | 3300018082 | Groundwater Sediment | AGDLPVERAVTSNVILDDAPDAFARLASGTADEIKVLIDHEE |
| Ga0066669_119272622 | 3300018482 | Grasslands Soil | AARVAAGRLAVERVVTGNVTLDGAPDAFARLASGAADEIKVLIDQ |
| Ga0173481_105966071 | 3300019356 | Soil | VYDFDRIAAQIAAGDLPVERVVTGRVDLDGAPEAFARLASGTADEIKVLIDQ |
| Ga0193747_10422831 | 3300019885 | Soil | DFERIAAQIAAGDLPVERVVTSSVTLDDAPDAFALLASGEADEIKVLVNQ |
| Ga0193751_11654462 | 3300019888 | Soil | VERVVTSSVTLDGAQDAFARLASGTADEIKVLVDQ |
| Ga0206353_116080813 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VERVVTSTVSLDGAPAAFAMLSSGTADEIKVLVEQ |
| Ga0210378_102933882 | 3300021073 | Groundwater Sediment | GAGDLPVERAVTSNVILDDAPDAFARLASGTADEIKVLIDHEE |
| Ga0247797_10069303 | 3300023057 | Soil | PVDRVVTSEVELDGAPDAFARLASGAADEIKVLIDQ |
| Ga0247754_10089293 | 3300023102 | Soil | FERIAAQIAAGDLPVDRVVTSEVDLDGAPDAFARLASGAADEIKVLIDQ |
| Ga0207684_112146981 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | YDFDRIAAQIEAGDLPVERAVTSNVILDDAPDAFARLASGTADEIKVLIDHEE |
| Ga0207654_110670691 | 3300025911 | Corn Rhizosphere | PVERVVTSQVDLDGAPDAFARLASGAADEIKVLVDQ |
| Ga0207671_115354452 | 3300025914 | Corn Rhizosphere | LPVERVVTSTVSLDGAPDAFAMLASGTADEIKVLVEQ |
| Ga0207663_116342171 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AARSLPVERVITSKVALDDSPDAFERLASGAADEIKILVEQ |
| Ga0207649_107599522 | 3300025920 | Corn Rhizosphere | TLPVERVVTSTVALDDAPGAFERLASGSADEIKVLVDQ |
| Ga0207649_110438732 | 3300025920 | Corn Rhizosphere | AQIAAGDLPVERVITSNVDLDQAPDAFARLASGSADEIKVLVDQ |
| Ga0207646_114729782 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LPVERVVTSSVTLDGAPDAFARLVSGAADEIKVLIDQ |
| Ga0207694_107086091 | 3300025924 | Corn Rhizosphere | AAGDLPVERVITGSRTLDDAPDAFASLASGKADEIKVLINQ |
| Ga0207694_114174351 | 3300025924 | Corn Rhizosphere | PVERIVTRTVPLDDAPDVFAQLASGKADEIKVLIDQ |
| Ga0207659_104048522 | 3300025926 | Miscanthus Rhizosphere | VERVVTGRVDLDGAPEAFARLASGTADEIKVLIDQ |
| Ga0207690_103818412 | 3300025932 | Corn Rhizosphere | AAGDLPVERVITSNVDLDQAPDAFARLASGSADEIKVLVDQ |
| Ga0207690_113600141 | 3300025932 | Corn Rhizosphere | AGDLPVERVVTRTIGLGDAPDAFAALASGTADEIKVLIDQ |
| Ga0207667_114246462 | 3300025949 | Corn Rhizosphere | DRIAAHIAAGDLPVERVVTSEVDLDGAPDAFARLASGAADEIKVLVDQ |
| Ga0207668_121571942 | 3300025972 | Switchgrass Rhizosphere | CYWVYDFDRIAAQIAAGDLPVERVVTRTIGLGDAPDAFAALASGTADEIKVLIDQ |
| Ga0207640_113926001 | 3300025981 | Corn Rhizosphere | DRIAAQIAAGSLPVERVVTSTVTLDDAPAAFAMLASGTADEIKVLVEQ |
| Ga0207658_103636571 | 3300025986 | Switchgrass Rhizosphere | CYWVYDFERIAAQIAAGDLPVERVITGSRTLDDAPDAFASLASGKADEIKVLINQ |
| Ga0207708_116525411 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | ERIAAQIAAGDLPVERVVTGSGTLDEAPDAFARLASGKADEIKVLIDQ |
| Ga0207683_117080212 | 3300026121 | Miscanthus Rhizosphere | VERVVTSHVGLDDAPDAFELLASGTADEMKILIDQ |
| Ga0207698_119779132 | 3300026142 | Corn Rhizosphere | YWVYDFDRIVAQIAAGDLPVERIVTRTVPLDDAPDVFAQLASGKADEIKVSIDQ |
| Ga0209027_12351171 | 3300026300 | Grasslands Soil | YGFERIAAQIATGRLPVEKIITSTVGLDDAPESFAQLASGSASEIKVLVDQ |
| Ga0209471_12725401 | 3300026318 | Soil | DFGRIAAQIAAGNLPVERVVTSSHTLDDAPDAFARLASGAADEIKVLIEQ |
| Ga0209178_13873751 | 3300027725 | Agricultural Soil | IGRLPVEKIITSTVGLDDAPESFAQLASGSASEIKVLVDQ |
| Ga0247662_10556902 | 3300028293 | Soil | TWCYWVYDFDRVAAQIAGGGLPVERVITGTVGLDDAPDAFERLASGTADEIKVLVAQ |
| Ga0268265_118011982 | 3300028380 | Switchgrass Rhizosphere | YWVYDFDRVAAQIAAGDLPVERVVTSHVELDGAPDAFERLASGAADEIKVLIDQ |
| Ga0247828_110312692 | 3300028587 | Soil | YWVYDFDRIAAQIAAGDLPVERVVTRRVDLDGAPDAFADLASGTADEIKVLVAQ |
| Ga0307298_102712891 | 3300028717 | Soil | LPVERIVTSSVTLDGAPDAFARLASGAADEIKVLINQ |
| Ga0307318_101197862 | 3300028744 | Soil | GDLPVERAVTSNVILDDAPDAFARLASGTADEIKVLIDHEE |
| Ga0307320_104680162 | 3300028771 | Soil | VERIVTSSVTLDGAPDAFARLASGAADEIKVLINQ |
| Ga0307287_102624482 | 3300028796 | Soil | GSLPVERIVTSSVTLDGAPDAFARLASGAADEIKVLINQ |
| Ga0307503_106582321 | 3300028802 | Soil | AQIGAGTLPVERVITSSVDLDGAPDAFARLASGAADEIKVLVDQ |
| Ga0307305_100595593 | 3300028807 | Soil | PVERVVTSSGALDGAPDAFARLASGAADEIKVLIDQ |
| Ga0307292_101474831 | 3300028811 | Soil | AQIAAGDLPVERVVTSSVTLDDAPDAFALLASGEADEIKVLVNQ |
| Ga0307286_102585742 | 3300028876 | Soil | RAVTSNVILDDAPDAFARLASGTADEIKVLIDHEE |
| Ga0307308_101383682 | 3300028884 | Soil | AAQIAAGDLPVERVVTSSVTLDEAPDAFALLASGEADEIKVLVNQ |
| Ga0247827_107297771 | 3300028889 | Soil | WVYDFDRIVAQIAAGDLPVERIVTRTVPLDDAPDVFAQLASGKADEIKVLIDQ |
| Ga0302321_1027401842 | 3300031726 | Fen | WCYWVYDFERIAAQIAAGDLPVERVVTSSVTLDEAPDAFARLASGTADEIKVLVNQ |
| Ga0311367_117937072 | 3300031918 | Fen | TWCYWVYDFERIAAQIAAGDLPVERVVTSSVTLDEAPDAFARLASGTADEIKVLVNQ |
| Ga0307409_1002025341 | 3300031995 | Rhizosphere | FDRVASQIAAGNLPVERVITSSVGLDESPDAFARLASGSADEIKVLVDQ |
| Ga0307409_1020217381 | 3300031995 | Rhizosphere | AQIAAGDLPVERVVTRRVDLDGAPDAFADLASGTADEIKVLVTQ |
| Ga0310899_103115841 | 3300032017 | Soil | RIAAQIAAGDLPVERIVTRTARLDDAPDVFAQLASGKADEIKVLIDQ |
| Ga0308173_122789982 | 3300032074 | Soil | TWCYWVYDFDRIAAQIGAGSLPVERVITGTVGLDDAPDAFERLASGAADEIKVVVRQ |
| ⦗Top⦘ |