NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F040227

Metagenome Family F040227

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040227
Family Type Metagenome
Number of Sequences 162
Average Sequence Length 43 residues
Representative Sequence IRLRARVDRLEDAISHFYNVINELRRRVSTLEKKLKPLAKDD
Number of Associated Samples 100
Number of Associated Scaffolds 162

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.77 %
% of genes from short scaffolds (< 2000 bps) 94.44 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.099 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(35.802 % of family members)
Environment Ontology (ENVO) Unclassified
(58.642 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.321 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 55.71%    β-sheet: 0.00%    Coil/Unstructured: 44.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 162 Family Scaffolds
PF04392ABC_sub_bind 2.47
PF00805Pentapeptide 1.23
PF05050Methyltransf_21 1.23
PF01381HTH_3 1.23
PF02518HATPase_c 1.23
PF01527HTH_Tnp_1 1.23
PF04545Sigma70_r4 0.62
PF12697Abhydrolase_6 0.62
PF11026DUF2721 0.62
PF13358DDE_3 0.62
PF00498FHA 0.62
PF13560HTH_31 0.62
PF01590GAF 0.62
PF07110EthD 0.62
PF02136NTF2 0.62
PF04542Sigma70_r2 0.62
PF03797Autotransporter 0.62
PF13432TPR_16 0.62
PF10046BLOC1_2 0.62
PF00756Esterase 0.62
PF03401TctC 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 162 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 2.47
COG1357Uncharacterized conserved protein YjbI, contains pentapeptide repeatsFunction unknown [S] 1.23
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.62
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.62
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.62
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.62
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.10 %
UnclassifiedrootN/A17.90 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000597|AF_2010_repII_A1DRAFT_10032393All Organisms → cellular organisms → Bacteria → Proteobacteria1407Open in IMG/M
3300000956|JGI10216J12902_102721999All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300000956|JGI10216J12902_112622771All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium505Open in IMG/M
3300001867|JGI12627J18819_10492726All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium504Open in IMG/M
3300004479|Ga0062595_102376915All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium525Open in IMG/M
3300005332|Ga0066388_101842720All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1077Open in IMG/M
3300005332|Ga0066388_105695650All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium630Open in IMG/M
3300005437|Ga0070710_11300976All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium541Open in IMG/M
3300005467|Ga0070706_101604404Not Available593Open in IMG/M
3300005468|Ga0070707_100784442All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium916Open in IMG/M
3300005471|Ga0070698_101192582All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium710Open in IMG/M
3300005713|Ga0066905_100687224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium876Open in IMG/M
3300005713|Ga0066905_101372845All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium638Open in IMG/M
3300005764|Ga0066903_100041131All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium5455Open in IMG/M
3300005764|Ga0066903_100260202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae2691Open in IMG/M
3300005764|Ga0066903_101837988All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1158Open in IMG/M
3300005764|Ga0066903_103151079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium892Open in IMG/M
3300005764|Ga0066903_104512548All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium742Open in IMG/M
3300005764|Ga0066903_105581355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi662Open in IMG/M
3300005764|Ga0066903_108233012All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium533Open in IMG/M
3300005764|Ga0066903_108257358All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium532Open in IMG/M
3300005764|Ga0066903_108660600All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium518Open in IMG/M
3300006049|Ga0075417_10651039All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium539Open in IMG/M
3300006175|Ga0070712_100760784All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium829Open in IMG/M
3300006175|Ga0070712_101122956All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium682Open in IMG/M
3300006797|Ga0066659_11269077All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium614Open in IMG/M
3300006904|Ga0075424_100448069All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1377Open in IMG/M
3300007076|Ga0075435_101478662All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium596Open in IMG/M
3300009792|Ga0126374_11321769All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium583Open in IMG/M
3300010043|Ga0126380_10427612Not Available993Open in IMG/M
3300010046|Ga0126384_10111782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Variibacter → Variibacter gotjawalensis2038Open in IMG/M
3300010046|Ga0126384_10599627All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium964Open in IMG/M
3300010048|Ga0126373_12085648Not Available629Open in IMG/M
3300010048|Ga0126373_12986960All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales527Open in IMG/M
3300010303|Ga0134082_10457498Not Available552Open in IMG/M
3300010358|Ga0126370_10110585Not Available1924Open in IMG/M
3300010358|Ga0126370_12000293All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium566Open in IMG/M
3300010358|Ga0126370_12265399All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium537Open in IMG/M
3300010361|Ga0126378_13358921Not Available508Open in IMG/M
3300010362|Ga0126377_10783141Not Available1011Open in IMG/M
3300010366|Ga0126379_10612157Not Available1176Open in IMG/M
3300010376|Ga0126381_104207209All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium558Open in IMG/M
3300010398|Ga0126383_10681814Not Available1105Open in IMG/M
3300010398|Ga0126383_10835216All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1005Open in IMG/M
3300010398|Ga0126383_11215679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium843Open in IMG/M
3300010398|Ga0126383_12074834All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium656Open in IMG/M
3300010400|Ga0134122_10597807All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1019Open in IMG/M
3300012208|Ga0137376_10382630All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300012209|Ga0137379_10714520All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300012211|Ga0137377_10233432All Organisms → cellular organisms → Bacteria1767Open in IMG/M
3300012362|Ga0137361_11272239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7659Open in IMG/M
3300012948|Ga0126375_10079779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1869Open in IMG/M
3300012948|Ga0126375_11290718All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium613Open in IMG/M
3300012948|Ga0126375_11522537All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium573Open in IMG/M
3300012951|Ga0164300_10567188All Organisms → cellular organisms → Bacteria → Proteobacteria663Open in IMG/M
3300012971|Ga0126369_10443297All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1346Open in IMG/M
3300012971|Ga0126369_10591086Not Available1179Open in IMG/M
3300012971|Ga0126369_11000891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium923Open in IMG/M
3300012971|Ga0126369_11347005All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium804Open in IMG/M
3300012971|Ga0126369_13326159All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales527Open in IMG/M
3300016270|Ga0182036_11761340All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium524Open in IMG/M
3300016294|Ga0182041_10050376All Organisms → cellular organisms → Bacteria2814Open in IMG/M
3300016294|Ga0182041_10547576All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1010Open in IMG/M
3300016294|Ga0182041_11140057All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium709Open in IMG/M
3300016294|Ga0182041_11872165Not Available557Open in IMG/M
3300016319|Ga0182033_11209892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium677Open in IMG/M
3300016341|Ga0182035_10141913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae1831Open in IMG/M
3300016341|Ga0182035_10416151All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1132Open in IMG/M
3300016341|Ga0182035_11457328All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300016357|Ga0182032_10269949All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1331Open in IMG/M
3300016371|Ga0182034_10890010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium765Open in IMG/M
3300016371|Ga0182034_11912520All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium524Open in IMG/M
3300016387|Ga0182040_10502958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium968Open in IMG/M
3300016387|Ga0182040_10772507Not Available790Open in IMG/M
3300016387|Ga0182040_11366114All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300016404|Ga0182037_10113380All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1977Open in IMG/M
3300016422|Ga0182039_11401823All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium635Open in IMG/M
3300016445|Ga0182038_10064487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2513Open in IMG/M
3300016445|Ga0182038_10964757All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium753Open in IMG/M
3300021560|Ga0126371_11825034Not Available729Open in IMG/M
3300025898|Ga0207692_10095481All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1621Open in IMG/M
3300025910|Ga0207684_11288187All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium602Open in IMG/M
3300025915|Ga0207693_10025710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium4665Open in IMG/M
3300026307|Ga0209469_1044375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1427Open in IMG/M
3300027874|Ga0209465_10368419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia719Open in IMG/M
3300028793|Ga0307299_10169357All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium822Open in IMG/M
3300031544|Ga0318534_10396296All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300031545|Ga0318541_10284245Not Available921Open in IMG/M
3300031545|Ga0318541_10850000All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium509Open in IMG/M
3300031546|Ga0318538_10503776Not Available656Open in IMG/M
3300031546|Ga0318538_10614913All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300031561|Ga0318528_10575051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium604Open in IMG/M
3300031572|Ga0318515_10415500All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium720Open in IMG/M
3300031572|Ga0318515_10495603Not Available652Open in IMG/M
3300031573|Ga0310915_10121830All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1781Open in IMG/M
3300031573|Ga0310915_10140429Not Available1664Open in IMG/M
3300031573|Ga0310915_10322902Not Available1092Open in IMG/M
3300031573|Ga0310915_10985628All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300031668|Ga0318542_10098199All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1410Open in IMG/M
3300031679|Ga0318561_10400061All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium754Open in IMG/M
3300031679|Ga0318561_10518540All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300031680|Ga0318574_10264382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria996Open in IMG/M
3300031719|Ga0306917_10638710All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium837Open in IMG/M
3300031723|Ga0318493_10641727Not Available593Open in IMG/M
3300031736|Ga0318501_10246451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria944Open in IMG/M
3300031736|Ga0318501_10545324All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium634Open in IMG/M
3300031736|Ga0318501_10698200All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium559Open in IMG/M
3300031744|Ga0306918_10875069All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium700Open in IMG/M
3300031751|Ga0318494_10375126All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium824Open in IMG/M
3300031763|Ga0318537_10060494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1382Open in IMG/M
3300031764|Ga0318535_10316252All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium698Open in IMG/M
3300031768|Ga0318509_10154288All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1267Open in IMG/M
3300031770|Ga0318521_10818281All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium568Open in IMG/M
3300031780|Ga0318508_1182898All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium599Open in IMG/M
3300031797|Ga0318550_10277417All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300031797|Ga0318550_10282370Not Available805Open in IMG/M
3300031819|Ga0318568_10141582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1465Open in IMG/M
3300031821|Ga0318567_10475127All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium709Open in IMG/M
3300031821|Ga0318567_10757167All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium550Open in IMG/M
3300031833|Ga0310917_10226765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1254Open in IMG/M
3300031833|Ga0310917_10299004All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1088Open in IMG/M
3300031833|Ga0310917_10531938Not Available799Open in IMG/M
3300031846|Ga0318512_10123565All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1233Open in IMG/M
3300031879|Ga0306919_10277254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1267Open in IMG/M
3300031890|Ga0306925_10295131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1744Open in IMG/M
3300031890|Ga0306925_10399334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 2001473Open in IMG/M
3300031890|Ga0306925_10675255All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1083Open in IMG/M
3300031890|Ga0306925_11167021All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium774Open in IMG/M
3300031893|Ga0318536_10203937All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1006Open in IMG/M
3300031893|Ga0318536_10469480Not Available633Open in IMG/M
3300031896|Ga0318551_10220052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1055Open in IMG/M
3300031896|Ga0318551_10619232All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales625Open in IMG/M
3300031897|Ga0318520_10803107All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium590Open in IMG/M
3300031910|Ga0306923_10043676Not Available4912Open in IMG/M
3300031910|Ga0306923_10701496All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1126Open in IMG/M
3300031912|Ga0306921_10791508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1083Open in IMG/M
3300031912|Ga0306921_10993922Not Available947Open in IMG/M
3300031942|Ga0310916_11076962All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium668Open in IMG/M
3300031946|Ga0310910_11412192All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium535Open in IMG/M
3300031947|Ga0310909_10164237All Organisms → cellular organisms → Bacteria1832Open in IMG/M
3300031954|Ga0306926_10090813Not Available3732Open in IMG/M
3300031954|Ga0306926_10850007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1096Open in IMG/M
3300031954|Ga0306926_12466893Not Available571Open in IMG/M
3300031954|Ga0306926_12599323All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium552Open in IMG/M
3300032025|Ga0318507_10182627Not Available903Open in IMG/M
3300032025|Ga0318507_10545475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300032035|Ga0310911_10172630All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1223Open in IMG/M
3300032042|Ga0318545_10149420All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium830Open in IMG/M
3300032043|Ga0318556_10045122All Organisms → cellular organisms → Bacteria → Proteobacteria2113Open in IMG/M
3300032043|Ga0318556_10166515All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1141Open in IMG/M
3300032063|Ga0318504_10173873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria999Open in IMG/M
3300032063|Ga0318504_10347465All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium704Open in IMG/M
3300032064|Ga0318510_10514356All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium519Open in IMG/M
3300032066|Ga0318514_10371765Not Available758Open in IMG/M
3300032068|Ga0318553_10776085All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium501Open in IMG/M
3300032076|Ga0306924_10395908All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1581Open in IMG/M
3300032076|Ga0306924_11109958All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium861Open in IMG/M
3300032090|Ga0318518_10250942All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium908Open in IMG/M
3300032094|Ga0318540_10144456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1138Open in IMG/M
3300032094|Ga0318540_10529662Not Available568Open in IMG/M
3300032261|Ga0306920_102230758All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium760Open in IMG/M
3300033289|Ga0310914_10518166All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1078Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil35.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil16.05%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil8.64%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.56%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.47%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.23%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.62%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.62%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.62%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026307Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A1DRAFT_1003239313300000597Forest SoilRQRPYKRLSARVDCLEDAISHFYNVINELRRRVSTLEKELKPLAKDEQRRPARTH*
JGI10216J12902_10272199913300000956SoilTYIRLRARVDRLEDAINHFYNVINEWRRRVSTLEKKSNPLAKKR*
JGI10216J12902_11262277113300000956SoilRAYIRLYARVDRLEDAISHFYNVINELRKRVSTLEKKLKPLAKDD*
JGI12627J18819_1049272623300001867Forest SoilMRLCARVDCLEDAISHFYNVTKELRDRVSTLEKKLNPLAKQDWTN*
Ga0062595_10237691513300004479SoilLPSRQRTYRRLHVRVDRLEDAISHFYKVINELRRRVSTLEKKL*
Ga0066388_10184272013300005332Tropical Forest SoilARVDRLEDAISHFYNVINELRRRVSTLEKKWKPLAKDELH*
Ga0066388_10569565013300005332Tropical Forest SoilRLYARVDRLEDTISHFYNVINELRRRVSTLEKKSKPLAKKDE*
Ga0070710_1130097633300005437Corn, Switchgrass And Miscanthus RhizosphereARVDRLEDAISHFYNVINELRERVSTLETKSNPLAKDEWIN*
Ga0070706_10160440423300005467Corn, Switchgrass And Miscanthus RhizosphereRQRTYIRLRARVDHLEDAISHFYNVINELRRRVSTLEKKSKPLAKR*
Ga0070707_10078444213300005468Corn, Switchgrass And Miscanthus RhizospherePSRQRTYIRLYARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKR*
Ga0070698_10119258223300005471Corn, Switchgrass And Miscanthus RhizosphereLPSRQRTYIRLRARVDHLEDAISHFYNVINELRRRVSTLEKKPKP*
Ga0066905_10068722433300005713Tropical Forest SoilARVDRLEDAISHFYNVINELRRRVSALEKKSKPLAKR*
Ga0066905_10137284513300005713Tropical Forest SoilRAYIRLYARVDRLEDAISHFYNVINQLRKRVSALEKKLKPLAKDD*
Ga0066903_10004113113300005764Tropical Forest SoilQRTYIRLYARVDRLEDAISHFYNVINELRRRVSTLEKKLKSAKDAWIH*
Ga0066903_10026020243300005764Tropical Forest SoilVDRLEDAISHFYNVINELRRRVSTLEKKLKPLAKDD*
Ga0066903_10183798813300005764Tropical Forest SoilPSRQRTYVRLRVRVDRLEDAISHFYNVINELRRRVSTLEKKLKPLAKDD*
Ga0066903_10315107913300005764Tropical Forest SoilVNARIDSLEDSISHFYKVINELRERVSMTEKKLNALAEDNRTS*
Ga0066903_10451254813300005764Tropical Forest SoilTYIRLSARVDRLEDAMSHFYNVINELRRRVSTLEKKSKPLAKDDWAVYP*
Ga0066903_10558135513300005764Tropical Forest SoilFFVARKRARVDRLEDAISHVYNVINELRRRVSRLEKKSKPLAKDD*
Ga0066903_10823301223300005764Tropical Forest SoilMRLYARVDRLEDAISHFYNVINELRERVSTLEKKLERLAKDELH*
Ga0066903_10825735823300005764Tropical Forest SoilTYIRLHARIDRLEDTISHFYNVVNELRTRVSTLEKKSKPLAKDD*
Ga0066903_10866060023300005764Tropical Forest SoilNARIDRLEDTITHFYNVINELRRRVSTLEKKSKPLVKDE*
Ga0075417_1065103913300006049Populus RhizosphereARVDRLEDAISHFYNVINELRRRVSTLEKQLKPSAKMTKRW*
Ga0070712_10076078433300006175Corn, Switchgrass And Miscanthus RhizosphereRQRTYIRLRARVDHLEDAISHFYNVINELRKRVSKLEKKSKPLAKDD*
Ga0070712_10112295633300006175Corn, Switchgrass And Miscanthus RhizosphereRLRARVDHLEDAISHFYNVINELRRRVSTLEKKPKP*
Ga0066659_1126907713300006797SoilQRTYRHLYVRVDRLEDAISHFYNAINELRGRVSTLEKKLKRPPGGSP*
Ga0075424_10044806913300006904Populus RhizosphereRLRARVDHLEDAISHFYNVINELRRRVSTLEKKLKPLAKDDRTN*
Ga0075435_10147866213300007076Populus RhizosphereRLRARVDHLEDAISHFYNVINELRRRVSTLEKKSQPLAKR*
Ga0126374_1132176913300009792Tropical Forest SoilYIRLRARVDHLEDAISHFYNVINELRRRVSTLEKKLKPLAKDD*
Ga0126380_1042761213300010043Tropical Forest SoilDRLEDAISHFYNVINDLRRRVSTLEKKSKPLAKR*
Ga0126384_1011178213300010046Tropical Forest SoilLSARVDRLEDAISHFYNVINELRRRVSALEKKSKRL*
Ga0126384_1059962723300010046Tropical Forest SoilLSARVDRLEDAISHFYNVINELRRRVSTLEKKLKPFSQKPLH*
Ga0126373_1208564823300010048Tropical Forest SoilSRQRAYIRLHARVDSLEDAIGHFHNVIYELHTRVSTLEKKLKPLAKDD*
Ga0126373_1298696013300010048Tropical Forest SoilTYIRLYARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKDE*
Ga0134082_1045749833300010303Grasslands SoilQRTYRFLHVRVDGFEDAISHFYNVINELRRRVSTLEKKSKPLAKKR*
Ga0126370_1011058513300010358Tropical Forest SoilHLEDAISHFYNVINELRRRVSTLEKKLKPLAKDELH*
Ga0126370_1200029323300010358Tropical Forest SoilSRQRILYARVDRLEDAISHFYNVINELRERVSTLEKKLKPLVKDDWIN*
Ga0126370_1226539923300010358Tropical Forest SoilRLYARVDRLEDAISHFYNVINELRRRVSTLEKKLKPLAKDDRTN*
Ga0126378_1335892113300010361Tropical Forest SoilNARVDRLEDTISHFYNVINELRRRVSALEKKSKPKRRVD*
Ga0126377_1078314123300010362Tropical Forest SoilRTYIRLYARVDRLEDAISHFYNVINELRKRVSMLEKKLKPLAKR*
Ga0126379_1061215723300010366Tropical Forest SoilARVDRLEDVISHLYNVINELRRRVSTLEKKLTAKDDWIH*
Ga0126381_10420720923300010376Tropical Forest SoilRQRTYTRLSARVDRLEDTISHFYNVIDELRRRVSMLEKKLKPLAKDD*
Ga0126383_1068181433300010398Tropical Forest SoilDSQGTFIRLYARVDRLKDAISHFYNVINELRRRVSTLEKKSKPLAKDD*
Ga0126383_1083521613300010398Tropical Forest SoilRTYIRLYARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLPKDE*
Ga0126383_1121567933300010398Tropical Forest SoilDRLEDAISHFYNVINELRRRVSTLEKKLKPLAKDD*
Ga0126383_1207483423300010398Tropical Forest SoilIRLRARVDRLEDAISHFYNVINELRRRVSTLEKKLKPLAKDD*
Ga0134122_1059780713300010400Terrestrial SoilRLHARVDRLEDAVSHFYKVINELRERVSTLETKSNPLAKDEWIN*
Ga0137376_1038263013300012208Vadose Zone SoilLRARVDHLEDAISHFYNVINELRKRVSKLEKKSKPSAKDD*
Ga0137379_1071452013300012209Vadose Zone SoilRTYIRLRARVEALEDAISHFYNVINELRGRVSTLEKKLKRPPGGSID*
Ga0137377_1023343253300012211Vadose Zone SoilDHLEDAISHFYNVINELRKRVSKLEKKSKPSAKDD*
Ga0137361_1127223913300012362Vadose Zone SoilRLHVRVDRLEDAISHFYNVINELRRRVSTLEKKSKPFSQKR*
Ga0126375_1007977913300012948Tropical Forest SoilPARQRSYIRLNARVDRLEDTISHFYNVINELHRRVSTLEKKSKPLAKRRVD*
Ga0126375_1129071813300012948Tropical Forest SoilQARVDRLEDAISHFYNVITELRRRVSTLEKKSKPLAKR*
Ga0126375_1152253733300012948Tropical Forest SoilRARVDRLEDAISHFYNVINELRRRVSTLEKKLKPLAKED*
Ga0164300_1056718813300012951SoilRSYIRLHARVDRLEDAVSHFYKVINELRERVSTLETKSNPLAKDEWIN*
Ga0126369_1044329743300012971Tropical Forest SoilYIRLRARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKR*
Ga0126369_1059108643300012971Tropical Forest SoilRTYIRLRARVDHLEDAISHFYNVINELRRRVSTLEKKLKPLAKDELH*
Ga0126369_1100089143300012971Tropical Forest SoilRTYIRLRARVDHLEDAISHFYNVINELRRRVSTLEKKLKPLPKRSLH*
Ga0126369_1134700533300012971Tropical Forest SoilRQRTYIRLYARVDRLEDAISHFYNVINELRRRVSTLEKKLKPLAKDDRTN*
Ga0126369_1332615913300012971Tropical Forest SoilIRLYARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKDE*
Ga0182036_1176134023300016270SoilGSFFVARKRARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKND
Ga0182041_1005037663300016294SoilSRQRTYTRLRARVDRLEDAISHFYNVINELRERVSTLEKKLKPLAKNWIN
Ga0182041_1054757613300016294SoilGTFIRLYARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKND
Ga0182041_1114005713300016294SoilRARVDRLEDAISHFYNVINELRRRVSRLEKELKPLAKR
Ga0182041_1187216513300016294SoilVDGLEDAISHFYNVINELRRRVSTLEKKSKPLAKR
Ga0182033_1120989213300016319SoilLEDAISHFYNVINELRRRVSTLEKKLKPFSQKPLH
Ga0182035_1014191353300016341SoilYIRLYARVDRLEDTISHFYNVINELRERVSTLEKKLKPLAKNWIN
Ga0182035_1041615133300016341SoilYIRLYARVDRLEDTISHFYNVINELRERVSTLEKKLKPLAKDDRIN
Ga0182035_1145732813300016341SoilVRVDGLEDAISHFYNVINELRRRVSTLEKKSKPLAKR
Ga0182032_1026994923300016357SoilYTRLRARVDRLEDAISHFYNVINELRRRVSTLEKKLKPLTKDD
Ga0182034_1089001013300016371SoilTYKRLSARVDRLEDAISHFYNVINELRRRVSTLEKKLKPFSQKPLH
Ga0182034_1191252033300016371SoilKRLSARVDALEDAISHFYNVIDELRRRVSTLEKKLKPLAKDD
Ga0182040_1050295833300016387SoilQPTYKRLSARVDRLEDAISHFYNVINELRRRVSTLEKKLKPFSQKPLH
Ga0182040_1077250713300016387SoilHARVDHLEDAISHFYNVINELRRRVSTLEKKLKPLAKDELH
Ga0182040_1136611433300016387SoilDCLEEAISHFYNVINELRRRVSTLEKKLKPLAKDGGGG
Ga0182037_1011338063300016404SoilRLHARVDRLEDAISHFYNVINELGGRVSRLENKLSNQSA
Ga0182039_1140182313300016422SoilTLPSRQRTYTRLRARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKR
Ga0182038_1006448713300016445SoilPSRQRTYTRLRARVDRLEDAISHFYNVINELRERVSTLEKKLKPLAKNWIN
Ga0182038_1096475713300016445SoilVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKDDRTN
Ga0126371_1182503423300021560Tropical Forest SoilQRTYTRLRARVDLLEDAISHFYNVVNELRRRVSTLEKKLLLKPLAKR
Ga0207692_1009548123300025898Corn, Switchgrass And Miscanthus RhizosphereQRSYIRLHARVDRLEDAISHFYNVINELRERVSTLEKKLNPLAKDEWIN
Ga0207684_1128818723300025910Corn, Switchgrass And Miscanthus RhizosphereRLRARVDHLEDAISHFYNVINELRKRVSKLEKKSKPSAKDD
Ga0207693_10025710103300025915Corn, Switchgrass And Miscanthus RhizosphereLHARVDRLEDAISHFYNVINELRERVSTLEKKLNPLAKDEWIN
Ga0209469_104437543300026307SoilRQRTHIRLHGRVDRLEDAISHFYNVINELRRRVSTLEKKLKPLAKDDRTNTESLKL
Ga0209465_1036841933300027874Tropical Forest SoilVDRLKDAISHFYNVINELRRRVSTREKKSKPLAKDD
Ga0307299_1016935713300028793SoilDRQRSHIHLHARVDRLEDAISHFYNVINELRERVSTLEKKLNPPAKDEWIN
Ga0318534_1039629633300031544SoilYIRLYARVDRLGDAMSHFYDVINELRRRVSTLEKKSKPLAKR
Ga0318541_1028424513300031545SoilIRLRARVDRLEDAISHFYNVVNELRRRVSMLEKKKSKPLAKR
Ga0318541_1085000033300031545SoilIRLRARVDHLEDAISHFYNVINELRSRVSRLEKKLKPFSQRPLH
Ga0318538_1050377623300031546SoilSGDRLEDAISHFYNVVNELRRRVSMLEKKKSKPLAKR
Ga0318538_1061491313300031546SoilTYIRLYARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKR
Ga0318528_1057505113300031561SoilRTYIRLYARVDRLEDAISHFYDVINVLRRRVSTLEKKSKPLAKDGRTIN
Ga0318515_1041550033300031572SoilYTRLYARVDRLEDAISHFYNVINELRRRVSTLEKKLKPLAKDD
Ga0318515_1049560313300031572SoilSRSGDRLEDAISHFYNVVNELRRRVSMLEKKKSKPLAKR
Ga0310915_1012183013300031573SoilIRLYARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKND
Ga0310915_1014042973300031573SoilTLPSRQRTYIRLHARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKR
Ga0310915_1032290213300031573SoilVDHLEDAISHFYNVINELRRRVSMLEKKSKPLAKDE
Ga0310915_1098562813300031573SoilRARVDCLEDAISHFYNVINELRRRVSTLEKKLKPLAKDGGGG
Ga0318542_1009819923300031668SoilRVDHLEDAISHFYNVINELRGRVSTLEKKLKLAKDDWIH
Ga0318561_1040006133300031679SoilTEAARQRTYIRLRARVDHLEDASSHFYNVINELRRRVSTLEKKLKPLGKDD
Ga0318561_1051854033300031679SoilSRQRTYRFLHVRVDGLEDAISHFYNVINELRRRVSTLEKKSKPLAKR
Ga0318574_1026438213300031680SoilRVHARVDSLEDAIGHFHNVIYELHTRVSTLEKKSKPLAKDD
Ga0306917_1063871013300031719SoilRTYIRLQARVDRLEDAISHFYNVINELRRRVSTLEKKLKPLAKDD
Ga0318493_1064172723300031723SoilLEDAISHFYNVINELRRRVSTLEKKLKPLAKDELH
Ga0318501_1024645113300031736SoilYIRLYARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKR
Ga0318501_1054532413300031736SoilRLYARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKDDRTN
Ga0318501_1069820013300031736SoilRQLTYTRLRARVDRLEDAISHFYNVINELRRRVSTLEKKSKALAKR
Ga0306918_1087506913300031744SoilHLYARVDRLEDAISHFYNVINEFRKRVSTLEKKLKPLAKDD
Ga0318494_1037512613300031751SoilYIRLSARVNRLEDAISHFYDVINELRRRVSTLEKKSKPLAKR
Ga0318537_1006049443300031763SoilYIRLYARVDRLEDAIGHFYKVINELRKRVSTLEKKLKPLAKDDRTH
Ga0318535_1031625223300031764SoilDIRLHARVDHLEDAISHFYNVINELRRRVSTLEKKLKPLAKDELH
Ga0318509_1015428813300031768SoilNIRLYARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKDDRTN
Ga0318521_1081828113300031770SoilYIRLRARVDRLEDAISHFYNVINELRRRVSTLEKN
Ga0318508_118289813300031780SoilPSRQRTYIRLRARVDHLEDAISHFYNVINELRRRVPTLEKKSKPLAKR
Ga0318550_1027741733300031797SoilYIRLYARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKDDRTN
Ga0318550_1028237013300031797SoilSCQRTYIHLYARVHGLEDAISHFYNVINELRRRVSTLEKKLKPLAKDD
Ga0318568_1014158243300031819SoilYIRLYARVDRLEDAISHFYDVINELRRRVSTLEKKSKPLAKR
Ga0318567_1047512723300031821SoilTYTRLRARVDRLEDAISHFYNVINELRERVSTLEKKLKPLAKDDRIN
Ga0318567_1075716723300031821SoilPTYKRLSARVDRLEDAISHFYNVINELRRRVSTLEKKLKPLAKAELH
Ga0310917_1022676543300031833SoilRLRARVDRLEDAISHFYNVINELRRRVSTLEKKSKALAKR
Ga0310917_1029900423300031833SoilLEDAINHFYYVMNELRRRVSTLEKKLKPLAKDELH
Ga0310917_1053193833300031833SoilARQRTYIRLRARVDHLEDAISHFYNVINELRRRVSMLEKKSKPLAKDE
Ga0318512_1012356543300031846SoilAYIRLYARVDRLEDAIGHFYKVINELRKRVSTLEKKLKPLAKDDRTH
Ga0306919_1027725433300031879SoilGTFIRLYARVDRLKDAISHFYNVINELRRRVSTREKKSKPLAKDD
Ga0306925_1029513133300031890SoilRVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKND
Ga0306925_1039933413300031890SoilRTYTRLRARVDRLEDAISHFYNVINELRRRVSTLEKN
Ga0306925_1067525513300031890SoilRLSVRVDRLEDAINHFYNVINELRRRVSTLEKKLKPLAKDELH
Ga0306925_1116702113300031890SoilARVDRLEDAISHFYNVINELRRRVSTLEKKLKPFSQKPLH
Ga0318536_1020393713300031893SoilPARQPTYKRLSARVDRLEDAISHFYNVINELRRRVSTLEKKLKPLAKAELH
Ga0318536_1046948013300031893SoilRTYIRLRARVDHLEDASSHFYNVINELRRRVSTLEKKLKPLGKDD
Ga0318551_1022005233300031896SoilRTYIRLHSRVDRLEDAISHFYNVINELRKRVSALEKKLKPSAKDDRTIN
Ga0318551_1061923213300031896SoilRSPLGSFFVARKRARVDRLEDAISHFYNVINELRRRVSRLEKKLNPLAKR
Ga0318520_1080310713300031897SoilYIRLYARVDRLEDTISHFYNVINELRRRVSTLEKKLKPLAKDD
Ga0306923_1004367613300031910SoilLHVRVDGLEDAISHFYNVINELRRRVSTLEKKSKPLAKR
Ga0306923_1070149653300031910SoilLRARVDCLEDAISHFYNVINELRRRVSTLEKKLKPLAKDGGGG
Ga0306921_1079150813300031912SoilLPSRQRTYTRLYARVDRLEDAISHFYNVINELRRRVSTLEKKLKPLAKDD
Ga0306921_1099392233300031912SoilDRDELVSKLERAVVHFYNVINELRRRVSTLEKKLKPLAKDD
Ga0310916_1107696223300031942SoilYKRLSARVDRLEDAISHFYNVINELRRRVSTLEKKLKPLAKAELH
Ga0310910_1141219223300031946SoilTLPSRQRTYIRLYARVDRLEDAISHFYDVINELRRRVSTLEKKSKPLAKR
Ga0310909_1016423713300031947SoilRQRTYTRLYARVDRLEDAISHFYNVINELRRRVSTLEKKLKPLAKDD
Ga0306926_1009081313300031954SoilRLYARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKR
Ga0306926_1085000713300031954SoilPSRQRTYTRLRARVDRLEDAISHFYNVINELRRRVSTLEKKSKALAKR
Ga0306926_1246689333300031954SoilRTYIRLHARVDRLEDEISHLYNVINELRRRVSTLEKKLRPLAKDELH
Ga0306926_1259932313300031954SoilRLRARVDHLEDAISHFYNVINELRRRVSTLEKKLKPLAKDD
Ga0318507_1018262723300032025SoilPSRSGDRLEDAISHFYNVVNELRRRVSMLEKKKSKPLAKR
Ga0318507_1054547513300032025SoilLYARVDRLEDAISHFYDVINVLRRRVSTLEKKSKPLAKDGRTIN
Ga0310911_1017263013300032035SoilPSRQRTYTRLRARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKR
Ga0318545_1014942023300032042SoilIRLSARVDRLEDAISHFYDVINELRRRVSTLEKKSKPLAKT
Ga0318556_1004512213300032043SoilIRLRARVDHLEDAISHFYNVINELRGRVSTLEKKLKLAKDDWIH
Ga0318556_1016651533300032043SoilYIRLHARVDSLEDAIGHFHNVIYELHTRVSTLEKKSKPLAKDD
Ga0318504_1017387313300032063SoilRKILDTTAISHFYNVINDLRRRVSTLEKKLKPLAKDD
Ga0318504_1034746513300032063SoilRTYTRLRARVDRLEDAISHFYNVINELRRRVSRLEKELKPLAKR
Ga0318510_1051435613300032064SoilLYARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKR
Ga0318514_1037176533300032066SoilRAYIRLHARVDSLEDAIGHFHNVIYELHTRVSTLEKKSKPLAKDD
Ga0318553_1077608533300032068SoilYIRLRARVDHLEDAISHFYNVINELRSRVSRLEKKLKPFSQRPLH
Ga0306924_1039590813300032076SoilRLRARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKR
Ga0306924_1110995813300032076SoilTLPSRQRTYTRLRARVDRLEDAISHFYNVINELRRRVSTLEKKSKALAKR
Ga0318518_1025094213300032090SoilARLRARVDRLEDAISHFYNVINELRSRVSRLEKKLKPFSQRPLH
Ga0318540_1014445613300032094SoilRDYIRLYARVDRLEDAIGHFYKVINELRKRVSTLEKKLKPLAKDDRTH
Ga0318540_1052966223300032094SoilVDRLEDAISHFYNVINELRRRFSTLEKKSKLLAKD
Ga0306920_10223075813300032261SoilTYKRLSARVDRLEDAISHFYNVINELRRRVSTLEKKLKPLAKAELH
Ga0310914_1051816633300033289SoilYARVDRLEDAISHFYNVINELRRRVSTLEKKSKPLAKND


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.