| Basic Information | |
|---|---|
| Family ID | F040210 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 162 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKRSLRALLLLVGLVGTFAYAAVPRVPTPSGPMPLCPLSRPNCDA |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 162 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.62 % |
| % of genes near scaffold ends (potentially truncated) | 32.72 % |
| % of genes from short scaffolds (< 2000 bps) | 53.70 % |
| Associated GOLD sequencing projects | 128 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.975 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.877 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.395 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.617 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 27.40% β-sheet: 0.00% Coil/Unstructured: 72.60% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 162 Family Scaffolds |
|---|---|---|
| PF13677 | MotB_plug | 11.11 |
| PF00691 | OmpA | 6.17 |
| PF00571 | CBS | 5.56 |
| PF01618 | MotA_ExbB | 4.94 |
| PF01882 | DUF58 | 4.32 |
| PF00990 | GGDEF | 2.47 |
| PF16697 | Yop-YscD_cpl | 1.85 |
| PF00989 | PAS | 1.85 |
| PF09335 | SNARE_assoc | 1.23 |
| PF08448 | PAS_4 | 1.23 |
| PF13620 | CarboxypepD_reg | 1.23 |
| PF07221 | GlcNAc_2-epim | 1.23 |
| PF10518 | TAT_signal | 0.62 |
| PF00361 | Proton_antipo_M | 0.62 |
| PF02146 | SIR2 | 0.62 |
| PF10066 | DUF2304 | 0.62 |
| PF14534 | DUF4440 | 0.62 |
| PF02517 | Rce1-like | 0.62 |
| PF02321 | OEP | 0.62 |
| PF00158 | Sigma54_activat | 0.62 |
| PF07884 | VKOR | 0.62 |
| PF09656 | PGPGW | 0.62 |
| PF00486 | Trans_reg_C | 0.62 |
| PF00027 | cNMP_binding | 0.62 |
| PF00488 | MutS_V | 0.62 |
| PF00499 | Oxidored_q3 | 0.62 |
| PF13519 | VWA_2 | 0.62 |
| PF00072 | Response_reg | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 162 Family Scaffolds |
|---|---|---|---|
| COG1721 | Uncharacterized conserved protein, DUF58 family, contains vWF domain | Function unknown [S] | 4.32 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 1.23 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 1.23 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 1.23 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.23 |
| COG2942 | Mannose or cellobiose epimerase, N-acyl-D-glucosamine 2-epimerase family | Carbohydrate transport and metabolism [G] | 1.23 |
| COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 0.62 |
| COG0839 | NADH:ubiquinone oxidoreductase subunit 6 (chain J) | Energy production and conversion [C] | 0.62 |
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG1193 | dsDNA-specific endonuclease/ATPase MutS2 | Replication, recombination and repair [L] | 0.62 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG4243 | Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formation | General function prediction only [R] | 0.62 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.98 % |
| Unclassified | root | N/A | 8.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100546919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2247 | Open in IMG/M |
| 3300001131|JGI12631J13338_1025387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 617 | Open in IMG/M |
| 3300001137|JGI12637J13337_1015683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300001471|JGI12712J15308_10008008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2897 | Open in IMG/M |
| 3300001546|JGI12659J15293_10032473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1276 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100076093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3107 | Open in IMG/M |
| 3300003219|JGI26341J46601_10100668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 843 | Open in IMG/M |
| 3300004080|Ga0062385_10017922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2596 | Open in IMG/M |
| 3300004082|Ga0062384_100136886 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300004082|Ga0062384_100260968 | Not Available | 1056 | Open in IMG/M |
| 3300004082|Ga0062384_100311670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 981 | Open in IMG/M |
| 3300004091|Ga0062387_100088446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1628 | Open in IMG/M |
| 3300004091|Ga0062387_100192516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1222 | Open in IMG/M |
| 3300004091|Ga0062387_101311854 | Not Available | 572 | Open in IMG/M |
| 3300004152|Ga0062386_100558827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 933 | Open in IMG/M |
| 3300004152|Ga0062386_101307350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 603 | Open in IMG/M |
| 3300004633|Ga0066395_10055509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1771 | Open in IMG/M |
| 3300004635|Ga0062388_100047678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2769 | Open in IMG/M |
| 3300004635|Ga0062388_101649402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Sulfitobacter → Sulfitobacter guttiformis | 653 | Open in IMG/M |
| 3300005445|Ga0070708_100193720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1902 | Open in IMG/M |
| 3300005445|Ga0070708_100387210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1318 | Open in IMG/M |
| 3300005468|Ga0070707_100428149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1284 | Open in IMG/M |
| 3300005471|Ga0070698_100424779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1264 | Open in IMG/M |
| 3300005537|Ga0070730_10076563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2350 | Open in IMG/M |
| 3300005538|Ga0070731_10000512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 50881 | Open in IMG/M |
| 3300005538|Ga0070731_10649995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 701 | Open in IMG/M |
| 3300005591|Ga0070761_10002440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11373 | Open in IMG/M |
| 3300005591|Ga0070761_10180470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1245 | Open in IMG/M |
| 3300005602|Ga0070762_11112919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 544 | Open in IMG/M |
| 3300005995|Ga0066790_10063101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1598 | Open in IMG/M |
| 3300006052|Ga0075029_100027686 | All Organisms → cellular organisms → Bacteria | 3202 | Open in IMG/M |
| 3300006052|Ga0075029_100050164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2414 | Open in IMG/M |
| 3300006052|Ga0075029_100081528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1917 | Open in IMG/M |
| 3300006052|Ga0075029_100113372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1639 | Open in IMG/M |
| 3300006052|Ga0075029_100449942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 844 | Open in IMG/M |
| 3300006086|Ga0075019_10228214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1107 | Open in IMG/M |
| 3300006162|Ga0075030_100011078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7930 | Open in IMG/M |
| 3300006162|Ga0075030_100202867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1596 | Open in IMG/M |
| 3300006176|Ga0070765_100017714 | All Organisms → cellular organisms → Bacteria | 5230 | Open in IMG/M |
| 3300006642|Ga0075521_10008215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3953 | Open in IMG/M |
| 3300006796|Ga0066665_11154232 | Not Available | 590 | Open in IMG/M |
| 3300009088|Ga0099830_10386847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1129 | Open in IMG/M |
| 3300009522|Ga0116218_1545120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 516 | Open in IMG/M |
| 3300009623|Ga0116133_1005324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3246 | Open in IMG/M |
| 3300009630|Ga0116114_1002545 | All Organisms → cellular organisms → Bacteria | 8175 | Open in IMG/M |
| 3300009634|Ga0116124_1155447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 639 | Open in IMG/M |
| 3300009635|Ga0116117_1004458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 3725 | Open in IMG/M |
| 3300009638|Ga0116113_1013359 | Not Available | 1761 | Open in IMG/M |
| 3300009644|Ga0116121_1200131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 635 | Open in IMG/M |
| 3300009672|Ga0116215_1455749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 553 | Open in IMG/M |
| 3300009698|Ga0116216_10002705 | All Organisms → cellular organisms → Bacteria | 11718 | Open in IMG/M |
| 3300010339|Ga0074046_10250643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1099 | Open in IMG/M |
| 3300010341|Ga0074045_10023219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4812 | Open in IMG/M |
| 3300010343|Ga0074044_10596142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 721 | Open in IMG/M |
| 3300010343|Ga0074044_10858606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 593 | Open in IMG/M |
| 3300010359|Ga0126376_13132531 | Not Available | 512 | Open in IMG/M |
| 3300010366|Ga0126379_10009397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6772 | Open in IMG/M |
| 3300011271|Ga0137393_10016180 | All Organisms → cellular organisms → Bacteria | 5333 | Open in IMG/M |
| 3300012189|Ga0137388_10003392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 10290 | Open in IMG/M |
| 3300012202|Ga0137363_11552022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 554 | Open in IMG/M |
| 3300012208|Ga0137376_10103186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 2418 | Open in IMG/M |
| 3300012361|Ga0137360_10855902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 783 | Open in IMG/M |
| 3300012683|Ga0137398_10034287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2903 | Open in IMG/M |
| 3300012918|Ga0137396_10186938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1520 | Open in IMG/M |
| 3300012923|Ga0137359_10127224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 2264 | Open in IMG/M |
| 3300012923|Ga0137359_11068534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 691 | Open in IMG/M |
| 3300012925|Ga0137419_10071213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 2317 | Open in IMG/M |
| 3300012927|Ga0137416_12114190 | Not Available | 517 | Open in IMG/M |
| 3300012971|Ga0126369_10177165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 2033 | Open in IMG/M |
| 3300012971|Ga0126369_10487370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1288 | Open in IMG/M |
| 3300014156|Ga0181518_10001535 | All Organisms → cellular organisms → Bacteria | 23607 | Open in IMG/M |
| 3300014157|Ga0134078_10368734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 636 | Open in IMG/M |
| 3300014200|Ga0181526_10004527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10762 | Open in IMG/M |
| 3300014200|Ga0181526_10024264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3955 | Open in IMG/M |
| 3300014489|Ga0182018_10006073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9521 | Open in IMG/M |
| 3300014494|Ga0182017_10405047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 844 | Open in IMG/M |
| 3300014498|Ga0182019_10423719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 911 | Open in IMG/M |
| 3300014502|Ga0182021_10002176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 22840 | Open in IMG/M |
| 3300014838|Ga0182030_10114031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3642 | Open in IMG/M |
| 3300015245|Ga0137409_10525713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1008 | Open in IMG/M |
| 3300017822|Ga0187802_10320515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 606 | Open in IMG/M |
| 3300017929|Ga0187849_1033173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2617 | Open in IMG/M |
| 3300017931|Ga0187877_1381854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 533 | Open in IMG/M |
| 3300017935|Ga0187848_10153692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1012 | Open in IMG/M |
| 3300017938|Ga0187854_10408091 | Not Available | 569 | Open in IMG/M |
| 3300017948|Ga0187847_10000010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 237076 | Open in IMG/M |
| 3300017948|Ga0187847_10001211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 24253 | Open in IMG/M |
| 3300017948|Ga0187847_10002572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 14578 | Open in IMG/M |
| 3300017948|Ga0187847_10002846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 13635 | Open in IMG/M |
| 3300017961|Ga0187778_10162284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1414 | Open in IMG/M |
| 3300017966|Ga0187776_10014421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4269 | Open in IMG/M |
| 3300017972|Ga0187781_11496390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 501 | Open in IMG/M |
| 3300018006|Ga0187804_10156485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 962 | Open in IMG/M |
| 3300018040|Ga0187862_10009333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8471 | Open in IMG/M |
| 3300018043|Ga0187887_10176666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1274 | Open in IMG/M |
| 3300018043|Ga0187887_10746367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 578 | Open in IMG/M |
| 3300018085|Ga0187772_10032616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3105 | Open in IMG/M |
| 3300018085|Ga0187772_10089961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1961 | Open in IMG/M |
| 3300018085|Ga0187772_10093556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1925 | Open in IMG/M |
| 3300018085|Ga0187772_10120813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1708 | Open in IMG/M |
| 3300018088|Ga0187771_10183504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1731 | Open in IMG/M |
| 3300018090|Ga0187770_10005579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7567 | Open in IMG/M |
| 3300018090|Ga0187770_10928648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300018090|Ga0187770_11024370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 665 | Open in IMG/M |
| 3300018468|Ga0066662_10259019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1428 | Open in IMG/M |
| 3300019082|Ga0187852_1226221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 764 | Open in IMG/M |
| 3300019888|Ga0193751_1001997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12631 | Open in IMG/M |
| 3300020579|Ga0210407_10958858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 654 | Open in IMG/M |
| 3300021180|Ga0210396_10045185 | All Organisms → cellular organisms → Bacteria | 4047 | Open in IMG/M |
| 3300021405|Ga0210387_10112932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 2286 | Open in IMG/M |
| 3300021407|Ga0210383_10035869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 4141 | Open in IMG/M |
| 3300025474|Ga0208479_1074930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 640 | Open in IMG/M |
| 3300026304|Ga0209240_1295264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 502 | Open in IMG/M |
| 3300026490|Ga0257153_1001601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4215 | Open in IMG/M |
| 3300027334|Ga0209529_1003432 | Not Available | 2418 | Open in IMG/M |
| 3300027528|Ga0208985_1093910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 577 | Open in IMG/M |
| 3300027545|Ga0209008_1109842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 614 | Open in IMG/M |
| 3300027546|Ga0208984_1049751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 893 | Open in IMG/M |
| 3300027562|Ga0209735_1000753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5620 | Open in IMG/M |
| 3300027609|Ga0209221_1113557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 691 | Open in IMG/M |
| 3300027824|Ga0209040_10019369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4476 | Open in IMG/M |
| 3300027846|Ga0209180_10098815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1662 | Open in IMG/M |
| 3300027846|Ga0209180_10772535 | Not Available | 517 | Open in IMG/M |
| 3300027854|Ga0209517_10077259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 2332 | Open in IMG/M |
| 3300027874|Ga0209465_10000823 | All Organisms → cellular organisms → Bacteria | 14218 | Open in IMG/M |
| 3300027903|Ga0209488_11174106 | Not Available | 519 | Open in IMG/M |
| 3300027911|Ga0209698_10004841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 14672 | Open in IMG/M |
| 3300028646|Ga0302159_10023143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1378 | Open in IMG/M |
| 3300028800|Ga0265338_10058364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3406 | Open in IMG/M |
| 3300029913|Ga0311362_10103203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3763 | Open in IMG/M |
| 3300029923|Ga0311347_10014945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5124 | Open in IMG/M |
| 3300029987|Ga0311334_10033630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3593 | Open in IMG/M |
| 3300030052|Ga0302217_10018237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1486 | Open in IMG/M |
| 3300030399|Ga0311353_10011478 | All Organisms → cellular organisms → Bacteria | 10434 | Open in IMG/M |
| 3300030503|Ga0311370_10059276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5583 | Open in IMG/M |
| 3300030580|Ga0311355_10127171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2780 | Open in IMG/M |
| 3300030707|Ga0310038_10032169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 3120 | Open in IMG/M |
| 3300030882|Ga0265764_109687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 597 | Open in IMG/M |
| 3300030991|Ga0073994_10030408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2659 | Open in IMG/M |
| 3300031236|Ga0302324_101100486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1069 | Open in IMG/M |
| 3300031249|Ga0265339_10016751 | All Organisms → cellular organisms → Bacteria | 4361 | Open in IMG/M |
| 3300031258|Ga0302318_10369185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 721 | Open in IMG/M |
| 3300031344|Ga0265316_10013735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7178 | Open in IMG/M |
| 3300031446|Ga0170820_17108374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 2106 | Open in IMG/M |
| 3300031524|Ga0302320_10193595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2933 | Open in IMG/M |
| 3300031708|Ga0310686_117931556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3814 | Open in IMG/M |
| 3300031718|Ga0307474_10144154 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300031753|Ga0307477_10000107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 122380 | Open in IMG/M |
| 3300031823|Ga0307478_11787771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 505 | Open in IMG/M |
| 3300031902|Ga0302322_100072794 | All Organisms → cellular organisms → Bacteria | 3491 | Open in IMG/M |
| 3300032770|Ga0335085_10001090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 62958 | Open in IMG/M |
| 3300032770|Ga0335085_10772225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1060 | Open in IMG/M |
| 3300032782|Ga0335082_10003102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 18007 | Open in IMG/M |
| 3300032783|Ga0335079_10009608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 11015 | Open in IMG/M |
| 3300032893|Ga0335069_10352782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1737 | Open in IMG/M |
| 3300032955|Ga0335076_10016066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7515 | Open in IMG/M |
| 3300032955|Ga0335076_11209342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300033755|Ga0371489_0003789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 17631 | Open in IMG/M |
| 3300033826|Ga0334847_034554 | Not Available | 574 | Open in IMG/M |
| 3300034282|Ga0370492_0471028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 509 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 8.02% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.41% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.79% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.70% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.09% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.09% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.47% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.47% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.85% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.23% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.62% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.62% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.62% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.62% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.62% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001131 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030052 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300033826 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1005469193 | 3300000364 | Soil | MKRSLRALVLLLGLVGTYVWAAVPRVPAPDGGPIPLCPPKRGWNC* |
| JGI12631J13338_10253872 | 3300001131 | Forest Soil | MKRSFRALLLLVGLVGTFAYAAIPKATTHGGPVPLCDPWKNSNCPDDVR* |
| JGI12637J13337_10156832 | 3300001137 | Forest Soil | MKRSLRALLLLVGLVGTFAYAAVPGVPTPSGPMPLCPPSHPVCDA* |
| JGI12712J15308_100080084 | 3300001471 | Forest Soil | MKRSLRALLLLVGLVGTLAYAAAPSFSGPMPLCPPMHPLCDA* |
| JGI12659J15293_100324732 | 3300001546 | Forest Soil | MKRSLRALLLLVGLVGTFAYAAIPKAPAPDGPMPLCWPPKPNCNN* |
| JGIcombinedJ26739_1000760933 | 3300002245 | Forest Soil | MKRSLRALLLLVGXVGTFAYAAVPRDIPRSGPMPLCDPWRNP |
| JGI26341J46601_101006682 | 3300003219 | Bog Forest Soil | MKRSLRALLLLVGLVGTFAYAAIPKAPAPDGPMPLCWPPRPNCDN* |
| Ga0062385_100179222 | 3300004080 | Bog Forest Soil | MKRSLRALLLLVGLVGTFAYAAIPKVTTHSGPMPLCDPWKNPNCSN* |
| Ga0062384_1001368861 | 3300004082 | Bog Forest Soil | MKRSLRALLLLVGLVGTFAYAAVPKAPAPTGPMPLCPPSRPMCDA* |
| Ga0062384_1002609683 | 3300004082 | Bog Forest Soil | MKRSLRALLLLVGLVGTFAYAAAPGMSSGGPMPLCPPTRPRCVW* |
| Ga0062384_1003116703 | 3300004082 | Bog Forest Soil | MKRSLRALLLLVGLVGTFAYAAVPKTTTHSGPIPLCDPWKNPNCTQ* |
| Ga0062387_1000884462 | 3300004091 | Bog Forest Soil | MKRSLRALLLLVGLLGTFAYASIPRGPAQDGPFPCPTKGPKCDV* |
| Ga0062387_1001925161 | 3300004091 | Bog Forest Soil | MKRSVRALLLLVGLVGTFAYAAAPKSLTGGPMPLCPPKNPDCDQLVVK* |
| Ga0062387_1013118541 | 3300004091 | Bog Forest Soil | MKRSLRALLLLVGLVGTFAFAAIPRVPTQDGPFPCPNRGPK |
| Ga0062386_1005588273 | 3300004152 | Bog Forest Soil | MKRSVRALLLLVGLVGTFAYAAAPKSLTGGPMPLCPPKHPDCDELVIK* |
| Ga0062386_1013073501 | 3300004152 | Bog Forest Soil | MKRSLRALLLLVGLVGTFAYAAIPKVPTHDGPAPLCDPWREPGCSLPPA* |
| Ga0066395_100555094 | 3300004633 | Tropical Forest Soil | MKRSLRALILLVGLVGTYVYAAVPRVPAPDGGPIPVCPPKKGWNCQGQ* |
| Ga0062388_1000476782 | 3300004635 | Bog Forest Soil | MKRSLRALLLLVGLVGTFAYASIPRPIAQDGPIPLCDPWRNPACTQQQ* |
| Ga0062388_1016494021 | 3300004635 | Bog Forest Soil | MKRSLRALLLLVGLVGTFAYAAIPKAPAPDGPMPLCYPPKPDCDN* |
| Ga0070708_1001937202 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRSLRALVLLLGLVGTYVWAAVPRVPAPDGGPIPVCPPKRGWNC* |
| Ga0070708_1003872101 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRSLRALILLLGLVGTYVWAAVPRVPAPDGGPIPLCPPKKGWNC* |
| Ga0070707_1004281492 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRSLRALLLLVGLVGTFAYAAVPGVPTPSGPMPLCPPSQPVCDA* |
| Ga0070698_1004247791 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | KSTMKRSLRALLLLVGLVGTFAYAAVPGVPTPSGPMPLCPPSQPVCDA* |
| Ga0070730_100765633 | 3300005537 | Surface Soil | MKRSLRALLLLVGLVGTFAYAAAPKVSTPGGPIPLCPPGHPLCDE* |
| Ga0070731_1000051214 | 3300005538 | Surface Soil | MKRSLRALLLLVGLVGTLAYGAIPREPLRSGPMPLCPPSRPVCDQ* |
| Ga0070731_106499952 | 3300005538 | Surface Soil | MKRSLRALLLLVGLVGTFAYAAIPKAPTPGGPMPLCPPSRPNCDN* |
| Ga0070761_100024407 | 3300005591 | Soil | MKRALRALLLLVGLVGTFAYASIPRVPAQDGPIPLCDPWKNPACTE* |
| Ga0070761_101804702 | 3300005591 | Soil | MKRSLRALLLLVGLVGTLAYASVPRVPTHDGPIPLCDPWKNPD |
| Ga0070762_111129192 | 3300005602 | Soil | MKRSLRALLLLVGLLGTFAYAAIPKAPAPDGPMPLCWPPKPNCNN* |
| Ga0066790_100631011 | 3300005995 | Soil | MKRSLRALLLLVGLVGTLAFAAVPKTTPQSGPVPLCDPWHNPNCSF* |
| Ga0075029_1000276862 | 3300006052 | Watersheds | MKRSLRALMLLVGLVGTFAYAAIPQSPAPSGPLQLCPPSRPNCDA* |
| Ga0075029_1000501643 | 3300006052 | Watersheds | MKRSLRALLLLVGLVGTFAYAAVPKAPAPSGPIALCPPSRPNCDA* |
| Ga0075029_1000815282 | 3300006052 | Watersheds | MKRSLRALLLLVGLVGTFAYAAIPRVPTPGGPMPLCPPSHPACEE* |
| Ga0075029_1001133722 | 3300006052 | Watersheds | MKRSVRALLLLVGLVGTFAYAAAPKSLTGGPVPLCPPKHPDCDQLVIK* |
| Ga0075029_1004499422 | 3300006052 | Watersheds | MKRSLRALLLLVGLVGTFAYAAIPRVPTHVDPFPCDIFKHPNCTN* |
| Ga0075019_102282142 | 3300006086 | Watersheds | MKRSLRALLLLVGLVGTFAYAAIPRVPPQEIGPMPLCPPKIPNCDS* |
| Ga0075030_1000110788 | 3300006162 | Watersheds | MKRSLRALLLLVGLVGTFAYGAIPRVHPQDGGPMPLCGPKEPHCTS* |
| Ga0075030_1002028672 | 3300006162 | Watersheds | MKRSLRALLLLVGLVGTFAYAAVPKTLSNVGPVPLCPPGKDCGN* |
| Ga0070765_1000177144 | 3300006176 | Soil | MKRSLRALLLLVGLVGTFAYASVPKAPAPSGPIPLCPPSRPMCDA* |
| Ga0075521_100082154 | 3300006642 | Arctic Peat Soil | MKRSLRALLLLVGLVGTFAYAAIPKVTTNNGPMPLCPLKHPNCDQ* |
| Ga0066665_111542321 | 3300006796 | Soil | MKRSLRALVLLVGLAGTYVLAAVPRVPAPDGGPIPMCPKKGWNCEP* |
| Ga0099830_103868472 | 3300009088 | Vadose Zone Soil | MKRSLRALLLLVGLVGTFAYAAVPRVPSPSGPIPLCNPWRQNC |
| Ga0116218_15451201 | 3300009522 | Peatlands Soil | MKRSLRALLLLVGLVGTFAYAAIPRVPTPEGPMPLCPPRNPRCDAVVARFT* |
| Ga0116133_10053242 | 3300009623 | Peatland | MTRSLRTLLLLVGLVGTFAYAAVPRVPTHDAPVPLCDPWQDPSCQVPG* |
| Ga0116114_10025452 | 3300009630 | Peatland | MKRSLRALLLLVGLVGTFAYAGIPRVPTHDGPAPLCPPSHPLCGA* |
| Ga0116124_11554472 | 3300009634 | Peatland | MKRSLRALLLLVGLVGTFAYAAIPKVPPQDGPAPLCDPWRDPNCS |
| Ga0116117_10044584 | 3300009635 | Peatland | MKRSLRALLLLVGLVGTFAFAAVPKHTHGPIAICPIANPDCGD* |
| Ga0116113_10133593 | 3300009638 | Peatland | SLRALLLLVGLVGTFAFAAVPKHTHGPIAICPIANPDCGD* |
| Ga0116121_12001311 | 3300009644 | Peatland | MKRSLRALLLLVGLVGTFAYAAIPKVPPQDGPAPLCDPWRDPNCSMPPA* |
| Ga0116215_14557491 | 3300009672 | Peatlands Soil | MKRSLRALLLLVGLVGTFAYAAIPRVPTPSGPFPCPPRGPKCDEVV |
| Ga0116216_100027057 | 3300009698 | Peatlands Soil | MKRSLRALLLLVGLVGTFAYAAIPRVPTPSGPFPCPPRGPKCDEVVARMT* |
| Ga0074046_102506431 | 3300010339 | Bog Forest Soil | MKRSLRALLLLVGLVGTFAYAAIPRIPAQDGPMPLCDP |
| Ga0074045_100232196 | 3300010341 | Bog Forest Soil | MKRSLRALLLMVGLVGTFAYAAVPKVPTHDGPAPLCDPWSQNCTLPPA* |
| Ga0074044_105961421 | 3300010343 | Bog Forest Soil | MKRSLRALLLLVGLVGTLAYGSIPRVPPQSGPAPLCDPW |
| Ga0074044_108586061 | 3300010343 | Bog Forest Soil | MKRSLRALLLLVGLVGTFAYAAAPRISAGGPMPLCP |
| Ga0126376_131325311 | 3300010359 | Tropical Forest Soil | MKRSLRALLLLVGLVGTYAYGAIPRVSPHEIGPMPMCPPSRPNCG |
| Ga0126379_100093979 | 3300010366 | Tropical Forest Soil | MKRSLRALILLLGLVGTYVYAAVPRVPAPDGGPIPLCPPKRPQACM* |
| Ga0137393_100161801 | 3300011271 | Vadose Zone Soil | MKRSLRALLLLVGLVGTFAYAAVPRVPSPSGPIPLCN |
| Ga0137388_100033923 | 3300012189 | Vadose Zone Soil | MKRSLRALLLLVGLVGTFAYAAVPRVPSPSGPMPLCPLSKPNCDA* |
| Ga0137363_115520221 | 3300012202 | Vadose Zone Soil | MKRSLRALLLLVGLVGTFAYAAVPRVPSPSGPIPLCNPWRQ |
| Ga0137376_101031862 | 3300012208 | Vadose Zone Soil | MKRSLRALILLLGLAGTYVWAAVPRVPAPDGGPIPLCPPKRGWNC* |
| Ga0137360_108559021 | 3300012361 | Vadose Zone Soil | MKRSLRALVLLLGLVGTYVWAAVPRVPAPDGGPIPVCPPK |
| Ga0137398_100342873 | 3300012683 | Vadose Zone Soil | MKRSLRALLLLVGLVGTFAYAAVPSTPAPSGPIALCPPSRPNCGA* |
| Ga0137396_101869382 | 3300012918 | Vadose Zone Soil | MKRSLRALLLLVGLVGTFAYAAVPRVPTPGGPIPLCNPWKQNCGG* |
| Ga0137359_101272243 | 3300012923 | Vadose Zone Soil | MKRSLRALLLLVGLVGTFAYAAVPRVPTPGGPIPLCNPW |
| Ga0137359_110685342 | 3300012923 | Vadose Zone Soil | MKRSLRALLLLVGLVGTFAYAALPRDPARSGPMPLCNPWKQ |
| Ga0137419_100712133 | 3300012925 | Vadose Zone Soil | MKRSLRALLLLVGLVGTFAYAAVPRVPTPGGPIPLCNPWRQNCTG* |
| Ga0137416_121141901 | 3300012927 | Vadose Zone Soil | MKRSLRALLLLLGLAGTYVVAAVPRVPAPDGGPIPLCPPKKGWNCEP* |
| Ga0126369_101771653 | 3300012971 | Tropical Forest Soil | MRRSLRALILLVGLVGTYVYAAVPRVPAPDGGPIPVCPPKKGWNCQGQ* |
| Ga0126369_104873701 | 3300012971 | Tropical Forest Soil | MKRSLRALLLLVGLVGTFAYAAIPRGPVQDGSPMPWCHPNKPNCGA* |
| Ga0181518_100015356 | 3300014156 | Bog | MKRSLRALLLLVGLVGTFAYAAAPRVPTRGWMPLCPPSNPNCDA* |
| Ga0134078_103687342 | 3300014157 | Grasslands Soil | MKRSLRALVLLLGLVGTYVWAAVPRVPAPDGGPIPLCPPK |
| Ga0181523_100488192 | 3300014165 | Bog | MKRSLRALLLLVGLVGTFAYAAIPRVPTQDGPFPCPSRGPKCDDDVAITSHLKS* |
| Ga0181526_100045277 | 3300014200 | Bog | MKRSLRALILLVGLVGTLAYASVPRIPTQEGPIPFCPPSHPLCDA* |
| Ga0181526_100242641 | 3300014200 | Bog | MKRSLRALLLLVGLVGTFAYAAAPSVTTRGWMPLCPPERPNCNQ* |
| Ga0182018_100060732 | 3300014489 | Palsa | MKRSLRALLLLVGLVGTFAYAAAPRVATRGWTPLCPLSNPYCSQ* |
| Ga0182017_104050471 | 3300014494 | Fen | MKRSLRALILLVGVLGTYVYAAIPRDGGPLPLCAPNNPTCIP |
| Ga0182019_104237192 | 3300014498 | Fen | MKRSLWALVLLVGLVGTFAYAAIPRASSPSGPYPCI |
| Ga0182021_1000217614 | 3300014502 | Fen | MKRSLRALILLLGLVGTYVYAAVPRVPAPDGGPIPLCPPKKPNCTYGGN* |
| Ga0182030_101140312 | 3300014838 | Bog | MKRSLRTLLLLVGLVGTFAYAAVPRVPTHDAPVPLCDPWHDPSCQVPG* |
| Ga0137409_105257132 | 3300015245 | Vadose Zone Soil | MKRSLRALLLLVGLVGTLAYAAVPRVPSPSGPMPL |
| Ga0187802_103205151 | 3300017822 | Freshwater Sediment | MKIQMKRSLRALLLLVGLVGTFAYAAIPKVPTHDGPMPLCDP |
| Ga0187849_10331731 | 3300017929 | Peatland | MKRSLRALLLLVGLVGTFAYAAVPRVPTPGGPFPCPPNHPQCDSL |
| Ga0187877_13818541 | 3300017931 | Peatland | MKRSLRALLLLVGLVGTFAYAGIPRVPTHDGPAPLCPPSHPLCGA |
| Ga0187848_101536922 | 3300017935 | Peatland | MKRSLRAIILLVGLVGTLAYAAAPGVPTPSGPILWCP |
| Ga0187854_104080912 | 3300017938 | Peatland | MKRSLRALLLLVGLVGTFAYAAAPRVPTRGWMPLCP |
| Ga0187847_10000010153 | 3300017948 | Peatland | MKRSLRALLLLVGLVGTFAYAAVPKTTTHSGPVALCDPWKVPNCQY |
| Ga0187847_100012118 | 3300017948 | Peatland | MKRSLRALLLLVGLVGTFAFAAVPKHTHGPIAICPIANPDCGD |
| Ga0187847_1000257210 | 3300017948 | Peatland | MKRSLRALLLMVGLVGTFAYAAVPKVPTHDGPAPLCDPWSQNCTLPPA |
| Ga0187847_1000284612 | 3300017948 | Peatland | MTRSLRTLLLLVGLVGTFAYAAVPRVPTHDAPVPLCDPWQDPSCQVPG |
| Ga0187778_101622841 | 3300017961 | Tropical Peatland | MKRSLRALLLLVGLVGTFAYAAMPRVPTPHGPMPLCPPDHPNCDE |
| Ga0187776_100144215 | 3300017966 | Tropical Peatland | MKRSLRALILLVGLVGTYVYAAVPRVPAPDGGPLPLCPPKNPKGWNCDQS |
| Ga0187781_114963901 | 3300017972 | Tropical Peatland | MKITRTVRALLLLVGLVGTFAYAAVPKAPAPDGPI |
| Ga0187804_101564851 | 3300018006 | Freshwater Sediment | MKCSLRALLLLVGLVGTFAYAVVPKVTPHSGPFPSC |
| Ga0187862_1000933315 | 3300018040 | Peatland | MKRSLRALLLLVGLVGTFAYAAAPRVPTRGWMPLCPPSNPNCDA |
| Ga0187887_101766661 | 3300018043 | Peatland | MKRSFRALLLLVGLVGTFAYAAIPKVPTHGGPTPL |
| Ga0187887_107463671 | 3300018043 | Peatland | MTRSLRALLILVGLVGTFAYAAVPKVPSHDAPVPLCDPWRDPNCSMPP |
| Ga0187772_100326165 | 3300018085 | Tropical Peatland | MKRSLRALLLLVGLVGTFAYAAIARTHGPIAICPPSAPSCDAAVR |
| Ga0187772_100899613 | 3300018085 | Tropical Peatland | MKRSLRALLLLVGLVGTFAYAATRTHGPVAICPPSSPSCDIAVR |
| Ga0187772_100935561 | 3300018085 | Tropical Peatland | MKRSLRALLLMVGLVGTFAYAAVPKITFHDGPMPLCPPSNPDCPDKMPLPW |
| Ga0187772_101208132 | 3300018085 | Tropical Peatland | MKRSLRAFVLLVGLVGAFAYAAIPKAPADGPMPLCPPHHPNCDDTP |
| Ga0187771_101835042 | 3300018088 | Tropical Peatland | MKRSLRALLLLVGLVATFAYATVPRTPTPAGPIPLCPPGHPDCDE |
| Ga0187770_100055798 | 3300018090 | Tropical Peatland | MKRSLRALLLLVGLVATFAYAAIPRTPTPSGPIPLCPPSNPNC |
| Ga0187770_109286482 | 3300018090 | Tropical Peatland | MKIQMKRSLRALLLLAGLVGTFAYASVPKFQDGPMPL |
| Ga0187770_110243702 | 3300018090 | Tropical Peatland | MKRSLRAFVLLVGLVGAFAYAAIPKAPADGPMPLCPPHHP |
| Ga0066662_102590193 | 3300018468 | Grasslands Soil | MKRSLRALILLVGLAGTYVLAAVPRGPAQEGGPIPVCPPKKGWNCDPLQPNLPTNQR |
| Ga0187852_12262211 | 3300019082 | Peatland | MKRSLRALLLLVGLVGAFAYAASPRVPTPEGPFPCAPNRPHCD |
| Ga0193751_10019977 | 3300019888 | Soil | MKRSLRALLLLVGLVGTFAYAAVPRVPTPSGPMPLCPLSRPNCDA |
| Ga0210407_109588581 | 3300020579 | Soil | MKRSLRALLLLVGLVGTFAYAAVPKAPAPSGPIPLC |
| Ga0210396_100451852 | 3300021180 | Soil | MKRSLRALLLLVGLLGTFAYAAIPKAPAPDGPMPLCWPPKPNCNN |
| Ga0210387_101129322 | 3300021405 | Soil | MKRSLRALLLLVGLVGTFAYAAIPKAPTPGGPMPLCPPSHPNCGD |
| Ga0210383_100358695 | 3300021407 | Soil | MKRSLRALLLLVGLVGTFAYAATPKVITHSGPIPLCDPWRNPNCTQ |
| Ga0208479_10749301 | 3300025474 | Arctic Peat Soil | MKRSIRALLLLVGLVGTFAYASVPRVPTPSGPVAICPPS |
| Ga0209240_12952641 | 3300026304 | Grasslands Soil | MKRSLRALLLLVGLVGTFAYAAVPRVPTPGGPIPLCNPWKQNCGG |
| Ga0257153_10016013 | 3300026490 | Soil | MKRSLRALLLLVGLVGTFAYAAVPSTPAPSGPIALCPPSRPNCGA |
| Ga0209529_10034323 | 3300027334 | Forest Soil | MKRSFRALLLLVGLVGTFAYAAIPKATTHGGPVPLCDPWKNSNCPDDVR |
| Ga0208985_10939101 | 3300027528 | Forest Soil | MKRSLRALLLLVGLLGTFAYAAIPKAPAPDGPMPLCWPPK |
| Ga0209008_11098422 | 3300027545 | Forest Soil | MKRTLRALLLLLGLVGTFAYAAIPKAPAPDGPMPLCWPPKPNCNN |
| Ga0208984_10497511 | 3300027546 | Forest Soil | MKRSLRALLLLVGLVGTFAYGAVPRSPAPSGPMPLCPPGRPNCGA |
| Ga0209735_10007536 | 3300027562 | Forest Soil | MKRSLRALLLLVGLVGTFAYAAVPGVPTPSGPMPLCPPSHPVCDA |
| Ga0209221_11135571 | 3300027609 | Forest Soil | MKRSLRALLLLVGLVGTLAYASVPRVPTHDGPIPLCDPWKNP |
| Ga0209040_100193694 | 3300027824 | Bog Forest Soil | MKRSLRALLLLVGLVGTFAYAAIPRVPPHDGPMPLCAPSKPKCEM |
| Ga0209180_100988151 | 3300027846 | Vadose Zone Soil | MKRSLRALLLLVGLVGTFAYAAVPRVPSPSGPIPLCNP |
| Ga0209180_107725351 | 3300027846 | Vadose Zone Soil | MKRSLRALLLLVGLVGTFAYAAVPRVPSPSGPIPLC |
| Ga0209517_100772593 | 3300027854 | Peatlands Soil | MKRSLRALLLLVGLVGTFAYAAIPRVPTPEGPMPLCPPRNPRCDAVVARFT |
| Ga0209465_1000082313 | 3300027874 | Tropical Forest Soil | MKRSLRALILLLGLVGTYVYAAVPRVPAPDGGPIPLCPPKRPQACM |
| Ga0209488_111741061 | 3300027903 | Vadose Zone Soil | MKRSLRALLLLLGLAGTYVVAAVPRVPAPDGGPIPLCPPKKGWNCEP |
| Ga0209698_100048413 | 3300027911 | Watersheds | MKRSLRALLLLVGLVGTFAYGAIPRVHPQDGGPMPLCGPKEPHCTS |
| Ga0302159_100231432 | 3300028646 | Fen | MKRSLRALILLLGLVGTYVYAAVPRVPAPDGGPIPLCPPKKPNCTYGGN |
| Ga0265338_100583642 | 3300028800 | Rhizosphere | MKRSLKALLLLIGLVGTFAYAAVPQVPTPGGPIAICPPSRPKCDA |
| Ga0311362_101032033 | 3300029913 | Bog | MKRSLRALLLLVGLVGTLAFAAVPKVTTQSGPMPLCPPSHPVCDQ |
| Ga0311347_100149454 | 3300029923 | Fen | MKRSLRALLLLVGLVGTFAYAAIPKAPAPDGPMPLCPPKHPNCDQ |
| Ga0311334_100336301 | 3300029987 | Fen | MKRSLRALLLLVGLVGTFAYAAIPKAPAPDGPMPL |
| Ga0302217_100182371 | 3300030052 | Fen | MKRSLRALILLLGLVGTYVYAAVPRVPAPDGGPIPLCP |
| Ga0311353_100114783 | 3300030399 | Palsa | MKRSLRALLLLVGLVGTFAYATLPRVPARSGPVPLCDPTVNPHCPMPGIR |
| Ga0311370_100592762 | 3300030503 | Palsa | MKRSLRALLLLVGLVGTFAYAAAPSVATRGWMPLCPPSNPNCSN |
| Ga0311355_101271711 | 3300030580 | Palsa | MKRSLRALLLLVGLVGTFAYATLPRVPARSGPVPLCDPTVNPHCPMPG |
| Ga0310038_100321692 | 3300030707 | Peatlands Soil | MKRSLRALLLLVGLVGTFAYAAIPRVPTPSGPFPCPPRGPKCDEVVARMT |
| Ga0265764_1096871 | 3300030882 | Soil | MKRSLRALLLLVGLLGTFAYAAIPKAPAPDGPMPLCW |
| Ga0073994_100304082 | 3300030991 | Soil | MKRSLRALLLLVGLVGTFAYAAVPRDIPRSGPMPLCDPWRNPHCSLVR |
| Ga0302324_1011004862 | 3300031236 | Palsa | MKRSLRALLLLVGLVGTFAYAAAPRVATRGWTPLCPP |
| Ga0265339_100167514 | 3300031249 | Rhizosphere | MKRSLRALLLLVGLVGTFAYAAIPKAPAPSGPFPCPTKANCDA |
| Ga0302318_103691851 | 3300031258 | Bog | MKRSLRALLLLVGLVGTLAFAAVPKVTTQSGPMPL |
| Ga0265316_100137354 | 3300031344 | Rhizosphere | MKRSLRALLLLVGLVGTYAYAAVPRVQTPGGPIAICPPSRPNCDA |
| Ga0170820_171083741 | 3300031446 | Forest Soil | MKRSLRALLLLVGLVGTFAYAAVPSTPAPSGPIALCPPSRPNC |
| Ga0302320_101935954 | 3300031524 | Bog | MKRSLRTLLLLVGLVGTFAYAAVPRVPTHDAPVPLCDPWHDPSCQVPG |
| Ga0310686_1179315565 | 3300031708 | Soil | MKRSFRALLLLVGLLGTFAYAAMPKAPAPDGPMPLCYPPKPNCDN |
| Ga0307474_101441543 | 3300031718 | Hardwood Forest Soil | MKRSLRAILLLAGLLTTFAYGAVPKTTTHGGPMPLCDPNRPKCDAVVGQ |
| Ga0307477_1000010743 | 3300031753 | Hardwood Forest Soil | MKRSLRALLLLVGLVGTFAYAAVPRDPPRSGPMPLCPPTHPLCNA |
| Ga0307478_117877711 | 3300031823 | Hardwood Forest Soil | MKRSLRALLLLVGLVGTFAYAAIPKAPAPDGPMPLCWPP |
| Ga0302322_1000727942 | 3300031902 | Fen | MKRSLRALILLVGLAGTYVLAAVPRVPAPDGGPIPVCPPKKGWNCEP |
| Ga0335085_1000109052 | 3300032770 | Soil | MKRSLRALILLVGLVGTFVYAAVPRVPAPDGGPLPLCPPKNPKGWNCDES |
| Ga0335085_107722252 | 3300032770 | Soil | MKRSLRALLLLVGLLGTFAYAAIPQAPVREGGPMPMCPPKKPACDL |
| Ga0335082_1000310212 | 3300032782 | Soil | MKRSLRALILLVGLVGTYVYAAVPRVPAPDGGPIPLCPPKRGWNC |
| Ga0335079_100096082 | 3300032783 | Soil | MKIQMKRSLRALLLLVGLVGTFAYAAVPKIIHQDGPMPLCPPNHKCDDNNIR |
| Ga0335070_100012065 | 3300032829 | Soil | MKRSLRALLLLVGLVGTFAYAAVPKAPAPEGPMPLCWPPRGGPYCPQ |
| Ga0335069_103527824 | 3300032893 | Soil | MKRSLRALILLLGLVGTYVYASVPRVPAPDGGPIPVCPPKRPQACM |
| Ga0335076_100160662 | 3300032955 | Soil | MKRSLRALLLLVGLVGTFAYAAIPKAPAPEGPMPLCWPPKPNCDE |
| Ga0335076_112093422 | 3300032955 | Soil | MKRSLRALLLLVGLVGTFACAAIARTHGPIAICPPS |
| Ga0371489_0003789_1054_1188 | 3300033755 | Peat Soil | MKRSLRALILLVGLVGTLAYAAIPKAPTPSGPFPCGRDHPYCDE |
| Ga0334847_034554_102_239 | 3300033826 | Soil | MKRSLRALLLLVGLVGTLAYAAVPAVPTPGGPVPLCPPSRPACDA |
| Ga0370492_0471028_2_112 | 3300034282 | Untreated Peat Soil | MKRSLRALLLLVGLVGTFAYASVPKVVTQQGPTPLCD |
| ⦗Top⦘ |