| Basic Information | |
|---|---|
| Family ID | F040188 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 162 |
| Average Sequence Length | 46 residues |
| Representative Sequence | EVAIVPGSHGGFNRIDELNDRIAAFIKAHATGKQAAQPAPPPATKR |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 162 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 9.26 % |
| % of genes near scaffold ends (potentially truncated) | 88.89 % |
| % of genes from short scaffolds (< 2000 bps) | 87.65 % |
| Associated GOLD sequencing projects | 120 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.568 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.111 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.778 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.111 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.32% β-sheet: 0.00% Coil/Unstructured: 75.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 162 Family Scaffolds |
|---|---|---|
| PF00296 | Bac_luciferase | 4.32 |
| PF13396 | PLDc_N | 2.47 |
| PF02129 | Peptidase_S15 | 2.47 |
| PF07228 | SpoIIE | 1.85 |
| PF11716 | MDMPI_N | 1.23 |
| PF08044 | DUF1707 | 1.23 |
| PF01757 | Acyl_transf_3 | 1.23 |
| PF10011 | DUF2254 | 1.23 |
| PF05988 | DUF899 | 1.23 |
| PF00248 | Aldo_ket_red | 1.23 |
| PF02780 | Transketolase_C | 1.23 |
| PF00392 | GntR | 1.23 |
| PF00270 | DEAD | 1.23 |
| PF05977 | MFS_3 | 1.23 |
| PF02142 | MGS | 1.23 |
| PF00293 | NUDIX | 1.23 |
| PF00196 | GerE | 1.23 |
| PF08241 | Methyltransf_11 | 0.62 |
| PF02659 | Mntp | 0.62 |
| PF00753 | Lactamase_B | 0.62 |
| PF13649 | Methyltransf_25 | 0.62 |
| PF08352 | oligo_HPY | 0.62 |
| PF00999 | Na_H_Exchanger | 0.62 |
| PF13677 | MotB_plug | 0.62 |
| PF13560 | HTH_31 | 0.62 |
| PF13673 | Acetyltransf_10 | 0.62 |
| PF13395 | HNH_4 | 0.62 |
| PF13460 | NAD_binding_10 | 0.62 |
| PF02782 | FGGY_C | 0.62 |
| PF00561 | Abhydrolase_1 | 0.62 |
| PF13414 | TPR_11 | 0.62 |
| PF12072 | RNase_Y_N | 0.62 |
| PF12893 | Lumazine_bd_2 | 0.62 |
| PF13340 | DUF4096 | 0.62 |
| PF07730 | HisKA_3 | 0.62 |
| PF00384 | Molybdopterin | 0.62 |
| PF07883 | Cupin_2 | 0.62 |
| PF00254 | FKBP_C | 0.62 |
| PF13977 | TetR_C_6 | 0.62 |
| PF01370 | Epimerase | 0.62 |
| PF00326 | Peptidase_S9 | 0.62 |
| PF03466 | LysR_substrate | 0.62 |
| PF00587 | tRNA-synt_2b | 0.62 |
| PF06114 | Peptidase_M78 | 0.62 |
| PF03050 | DDE_Tnp_IS66 | 0.62 |
| PF04149 | DUF397 | 0.62 |
| PF00756 | Esterase | 0.62 |
| PF07729 | FCD | 0.62 |
| PF00730 | HhH-GPD | 0.62 |
| PF13561 | adh_short_C2 | 0.62 |
| PF03795 | YCII | 0.62 |
| PF03710 | GlnE | 0.62 |
| PF12802 | MarR_2 | 0.62 |
| PF00583 | Acetyltransf_1 | 0.62 |
| PF08281 | Sigma70_r4_2 | 0.62 |
| PF02219 | MTHFR | 0.62 |
| PF00440 | TetR_N | 0.62 |
| PF02965 | Met_synt_B12 | 0.62 |
| PF01850 | PIN | 0.62 |
| PF02156 | Glyco_hydro_26 | 0.62 |
| PF01402 | RHH_1 | 0.62 |
| PF12833 | HTH_18 | 0.62 |
| PF04107 | GCS2 | 0.62 |
| PF13302 | Acetyltransf_3 | 0.62 |
| PF01494 | FAD_binding_3 | 0.62 |
| PF02371 | Transposase_20 | 0.62 |
| PF13360 | PQQ_2 | 0.62 |
| PF01740 | STAS | 0.62 |
| PF02666 | PS_Dcarbxylase | 0.62 |
| PF03176 | MMPL | 0.62 |
| PF13581 | HATPase_c_2 | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 162 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 4.32 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 1.23 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.23 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.23 |
| COG1391 | Glutamine synthetase adenylyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 1.23 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.62 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.62 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.62 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.62 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.62 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.62 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.62 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.62 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.62 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.62 |
| COG4124 | Beta-mannanase | Carbohydrate transport and metabolism [G] | 0.62 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.62 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.62 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.62 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.62 |
| COG1971 | Putative Mn2+ efflux pump MntP | Inorganic ion transport and metabolism [P] | 0.62 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.62 |
| COG1410 | Methionine synthase I, cobalamin-binding domain | Amino acid transport and metabolism [E] | 0.62 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.62 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.62 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.62 |
| COG0688 | Phosphatidylserine decarboxylase | Lipid transport and metabolism [I] | 0.62 |
| COG0685 | 5,10-methylenetetrahydrofolate reductase | Amino acid transport and metabolism [E] | 0.62 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.62 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.62 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.62 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.62 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.62 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.19 % |
| Unclassified | root | N/A | 14.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10016121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5603 | Open in IMG/M |
| 3300001384|JGI20190J14840_1006590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1204 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101111583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis | 677 | Open in IMG/M |
| 3300003219|JGI26341J46601_10223548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus | 506 | Open in IMG/M |
| 3300003368|JGI26340J50214_10012010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2730 | Open in IMG/M |
| 3300004091|Ga0062387_101719808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 510 | Open in IMG/M |
| 3300004092|Ga0062389_101483916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → unclassified Kitasatospora → Kitasatospora sp. MBT63 | 862 | Open in IMG/M |
| 3300004152|Ga0062386_100004613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Cryptosporangiales → Cryptosporangiaceae → Cryptosporangium → Cryptosporangium arvum | 9552 | Open in IMG/M |
| 3300004633|Ga0066395_10245995 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300004635|Ga0062388_100845154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → unclassified Kitasatospora → Kitasatospora sp. MBT63 | 873 | Open in IMG/M |
| 3300005530|Ga0070679_100818252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 875 | Open in IMG/M |
| 3300005563|Ga0068855_102082717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 572 | Open in IMG/M |
| 3300005591|Ga0070761_10730280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 621 | Open in IMG/M |
| 3300005591|Ga0070761_11071196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300005602|Ga0070762_10045762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2398 | Open in IMG/M |
| 3300005712|Ga0070764_10342614 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300005764|Ga0066903_103856525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 805 | Open in IMG/M |
| 3300005764|Ga0066903_107723573 | Not Available | 553 | Open in IMG/M |
| 3300005995|Ga0066790_10031782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2301 | Open in IMG/M |
| 3300006028|Ga0070717_10340187 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300006059|Ga0075017_101304422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300006176|Ga0070765_101810412 | Not Available | 573 | Open in IMG/M |
| 3300006574|Ga0074056_11304880 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300009522|Ga0116218_1160740 | Not Available | 1019 | Open in IMG/M |
| 3300009522|Ga0116218_1302148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 716 | Open in IMG/M |
| 3300009523|Ga0116221_1146647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1029 | Open in IMG/M |
| 3300009525|Ga0116220_10181474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces finlayi | 909 | Open in IMG/M |
| 3300009698|Ga0116216_10275882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1026 | Open in IMG/M |
| 3300009700|Ga0116217_10428688 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300009824|Ga0116219_10811901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 510 | Open in IMG/M |
| 3300009839|Ga0116223_10846247 | Not Available | 522 | Open in IMG/M |
| 3300010043|Ga0126380_10336551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1092 | Open in IMG/M |
| 3300010048|Ga0126373_10298707 | Not Available | 1605 | Open in IMG/M |
| 3300010343|Ga0074044_10158061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1515 | Open in IMG/M |
| 3300010361|Ga0126378_10028854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4934 | Open in IMG/M |
| 3300010361|Ga0126378_10318631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1661 | Open in IMG/M |
| 3300010366|Ga0126379_10550622 | Not Available | 1233 | Open in IMG/M |
| 3300010373|Ga0134128_10953006 | Not Available | 949 | Open in IMG/M |
| 3300010373|Ga0134128_12242762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 601 | Open in IMG/M |
| 3300010376|Ga0126381_101183043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis | 1105 | Open in IMG/M |
| 3300010379|Ga0136449_100217825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3598 | Open in IMG/M |
| 3300010379|Ga0136449_101060105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharothrix → Saccharothrix deserti | 1296 | Open in IMG/M |
| 3300010379|Ga0136449_102024367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 849 | Open in IMG/M |
| 3300010379|Ga0136449_102118268 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300010399|Ga0134127_12773100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 570 | Open in IMG/M |
| 3300010876|Ga0126361_10963610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 772 | Open in IMG/M |
| 3300012357|Ga0137384_11587343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 504 | Open in IMG/M |
| 3300012363|Ga0137390_11959761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 512 | Open in IMG/M |
| 3300012971|Ga0126369_13208496 | Not Available | 535 | Open in IMG/M |
| 3300013104|Ga0157370_11786393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus → Actinoallomurus bryophytorum | 552 | Open in IMG/M |
| 3300014156|Ga0181518_10385671 | All Organisms → cellular organisms → Eukaryota | 680 | Open in IMG/M |
| 3300014158|Ga0181521_10568268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Tsukamurellaceae → Tsukamurella → Tsukamurella pulmonis | 535 | Open in IMG/M |
| 3300014162|Ga0181538_10690493 | Not Available | 529 | Open in IMG/M |
| 3300014493|Ga0182016_10858334 | Not Available | 502 | Open in IMG/M |
| 3300014838|Ga0182030_10147568 | Not Available | 3002 | Open in IMG/M |
| 3300014838|Ga0182030_11473877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 563 | Open in IMG/M |
| 3300015373|Ga0132257_100934813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1088 | Open in IMG/M |
| 3300016270|Ga0182036_10056516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 2493 | Open in IMG/M |
| 3300016750|Ga0181505_10429561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 666 | Open in IMG/M |
| 3300017823|Ga0187818_10545871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia seriolae | 522 | Open in IMG/M |
| 3300017926|Ga0187807_1111804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 862 | Open in IMG/M |
| 3300017934|Ga0187803_10075366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1327 | Open in IMG/M |
| 3300017942|Ga0187808_10065951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1548 | Open in IMG/M |
| 3300017942|Ga0187808_10162719 | Not Available | 986 | Open in IMG/M |
| 3300017942|Ga0187808_10175135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia acidicola | 950 | Open in IMG/M |
| 3300017942|Ga0187808_10517839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 554 | Open in IMG/M |
| 3300017946|Ga0187879_10274356 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300017948|Ga0187847_10167521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1200 | Open in IMG/M |
| 3300017961|Ga0187778_10428047 | Not Available | 871 | Open in IMG/M |
| 3300017970|Ga0187783_10569504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 820 | Open in IMG/M |
| 3300017973|Ga0187780_10275335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1182 | Open in IMG/M |
| 3300017974|Ga0187777_11142756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 568 | Open in IMG/M |
| 3300018001|Ga0187815_10405312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 581 | Open in IMG/M |
| 3300018006|Ga0187804_10483713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
| 3300018008|Ga0187888_1409812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 511 | Open in IMG/M |
| 3300018017|Ga0187872_10342244 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300018043|Ga0187887_10159297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1349 | Open in IMG/M |
| 3300018046|Ga0187851_10084093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2001 | Open in IMG/M |
| 3300018057|Ga0187858_10831581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 545 | Open in IMG/M |
| 3300018062|Ga0187784_11205231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinocatenispora | 600 | Open in IMG/M |
| 3300018085|Ga0187772_10298934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1102 | Open in IMG/M |
| 3300018085|Ga0187772_10612799 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300020580|Ga0210403_11233741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 574 | Open in IMG/M |
| 3300021180|Ga0210396_10660826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 905 | Open in IMG/M |
| 3300021181|Ga0210388_10317080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1370 | Open in IMG/M |
| 3300021181|Ga0210388_10923892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Sphaerisporangium | 751 | Open in IMG/M |
| 3300021181|Ga0210388_11359894 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300021374|Ga0213881_10011105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3692 | Open in IMG/M |
| 3300021388|Ga0213875_10016155 | All Organisms → cellular organisms → Bacteria | 3622 | Open in IMG/M |
| 3300021401|Ga0210393_11194155 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300021404|Ga0210389_10278363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1310 | Open in IMG/M |
| 3300021477|Ga0210398_11328835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 564 | Open in IMG/M |
| 3300021478|Ga0210402_10195510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1857 | Open in IMG/M |
| 3300021560|Ga0126371_12713890 | Not Available | 600 | Open in IMG/M |
| 3300025909|Ga0207705_10571874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 878 | Open in IMG/M |
| 3300025920|Ga0207649_10326443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1129 | Open in IMG/M |
| 3300025949|Ga0207667_11698447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 598 | Open in IMG/M |
| 3300026121|Ga0207683_10712156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 931 | Open in IMG/M |
| 3300026294|Ga0209839_10025538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2278 | Open in IMG/M |
| 3300026496|Ga0257157_1085781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
| 3300027029|Ga0208731_1000951 | All Organisms → cellular organisms → Bacteria | 2158 | Open in IMG/M |
| 3300027297|Ga0208241_1025580 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300027648|Ga0209420_1079837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 945 | Open in IMG/M |
| 3300027692|Ga0209530_1040984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1367 | Open in IMG/M |
| 3300027703|Ga0207862_1113062 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300027812|Ga0209656_10033895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 3000 | Open in IMG/M |
| 3300027824|Ga0209040_10008634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7244 | Open in IMG/M |
| 3300027824|Ga0209040_10259508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 867 | Open in IMG/M |
| 3300027825|Ga0209039_10004404 | All Organisms → cellular organisms → Bacteria | 10312 | Open in IMG/M |
| 3300027853|Ga0209274_10316529 | Not Available | 802 | Open in IMG/M |
| 3300027853|Ga0209274_10722289 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300027855|Ga0209693_10357824 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300027879|Ga0209169_10512315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Sphaerisporangium | 630 | Open in IMG/M |
| 3300027895|Ga0209624_10606005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 726 | Open in IMG/M |
| 3300027905|Ga0209415_10013428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13508 | Open in IMG/M |
| 3300027905|Ga0209415_10193437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1937 | Open in IMG/M |
| 3300027908|Ga0209006_10708550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 823 | Open in IMG/M |
| 3300028791|Ga0307290_10043257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1617 | Open in IMG/M |
| 3300028863|Ga0302218_10297473 | Not Available | 523 | Open in IMG/M |
| 3300028875|Ga0307289_10420138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
| 3300028879|Ga0302229_10517501 | Not Available | 526 | Open in IMG/M |
| 3300028906|Ga0308309_11662807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| 3300029922|Ga0311363_10196979 | All Organisms → cellular organisms → Bacteria | 2458 | Open in IMG/M |
| 3300029943|Ga0311340_11128863 | Not Available | 635 | Open in IMG/M |
| 3300029951|Ga0311371_10436865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 1760 | Open in IMG/M |
| 3300029994|Ga0302283_1093415 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300030007|Ga0311338_10828594 | Not Available | 918 | Open in IMG/M |
| 3300030007|Ga0311338_11474723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 629 | Open in IMG/M |
| 3300030013|Ga0302178_10130847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces sporangiiformans | 1262 | Open in IMG/M |
| 3300030503|Ga0311370_11016913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 922 | Open in IMG/M |
| 3300030906|Ga0302314_10357308 | Not Available | 1647 | Open in IMG/M |
| 3300030906|Ga0302314_11975880 | Not Available | 502 | Open in IMG/M |
| 3300031028|Ga0302180_10625028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 516 | Open in IMG/M |
| 3300031028|Ga0302180_10656814 | Not Available | 500 | Open in IMG/M |
| 3300031236|Ga0302324_100568264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1635 | Open in IMG/M |
| 3300031544|Ga0318534_10214941 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300031544|Ga0318534_10224267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1084 | Open in IMG/M |
| 3300031546|Ga0318538_10087581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1590 | Open in IMG/M |
| 3300031708|Ga0310686_102161548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 5111 | Open in IMG/M |
| 3300031708|Ga0310686_106459021 | Not Available | 1454 | Open in IMG/M |
| 3300031708|Ga0310686_109073483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 570 | Open in IMG/M |
| 3300031708|Ga0310686_111248476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 881 | Open in IMG/M |
| 3300031708|Ga0310686_114529122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1153 | Open in IMG/M |
| 3300031708|Ga0310686_114538529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1033 | Open in IMG/M |
| 3300031708|Ga0310686_119295820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1066 | Open in IMG/M |
| 3300031715|Ga0307476_10858165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 671 | Open in IMG/M |
| 3300031770|Ga0318521_10763983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300031778|Ga0318498_10329437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 683 | Open in IMG/M |
| 3300031799|Ga0318565_10173868 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300031823|Ga0307478_10589768 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300032090|Ga0318518_10437709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 670 | Open in IMG/M |
| 3300032160|Ga0311301_10490286 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
| 3300032160|Ga0311301_10871710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1219 | Open in IMG/M |
| 3300032160|Ga0311301_11568858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 804 | Open in IMG/M |
| 3300032174|Ga0307470_11233190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 609 | Open in IMG/M |
| 3300032515|Ga0348332_10086867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 848 | Open in IMG/M |
| 3300032770|Ga0335085_10553855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1302 | Open in IMG/M |
| 3300032828|Ga0335080_10851069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 939 | Open in IMG/M |
| 3300032828|Ga0335080_11434598 | Not Available | 685 | Open in IMG/M |
| 3300032892|Ga0335081_11272511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 832 | Open in IMG/M |
| 3300032954|Ga0335083_11192468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 590 | Open in IMG/M |
| 3300033290|Ga0318519_10260202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica | 1006 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 11.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.11% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.02% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 6.17% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.56% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.32% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.47% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.23% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.23% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.62% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.62% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.62% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.62% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.62% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001384 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300027029 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029994 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_100161219 | 3300001356 | Peatlands Soil | VPGSHGGFNRINELNDRIAAFIKAQAISKPADQPPHPTGT* |
| JGI20190J14840_10065901 | 3300001384 | Arctic Peat Soil | EIAIVPGSHGGFNRIDELNDRIAAFIEAQATGKQAVQPAQPPATKR* |
| JGIcombinedJ26739_1011115832 | 3300002245 | Forest Soil | MPHAQVAIVPGSHGGFNRINELNDRIAAFIKAQATSKPADQPPHPTGT* |
| JGI26341J46601_102235482 | 3300003219 | Bog Forest Soil | HAEVAIVPGSHGGFNRIDELNDRIAAFIQAHTTDKQTAQPAQPPTTKR* |
| JGI26340J50214_100120101 | 3300003368 | Bog Forest Soil | LMPHAEVAIVPGSHGGFNRIDELNDRIAAFIEAHTTDKQQTAHPAQPPTTKR* |
| Ga0062387_1017198082 | 3300004091 | Bog Forest Soil | QVAIVPGSHGGFNRIDELNDRIAAFIKGQATDKQAAQPAPPPATTR* |
| Ga0062389_1014839161 | 3300004092 | Bog Forest Soil | VAIVPGSHGGFNRIDELNDRIVAFIEAHATDEQASQPGTAAGS* |
| Ga0062386_1000046131 | 3300004152 | Bog Forest Soil | PGSHGGFNRIDELNDRIAAFIKAQATGNQAAQPPTRNGSC* |
| Ga0066395_102459951 | 3300004633 | Tropical Forest Soil | VAVVPGSHGGFNRIDELNDRIAAFIKAQATGNQAAQSAPPPATKR* |
| Ga0062388_1008451541 | 3300004635 | Bog Forest Soil | PHAEVAIVPGSHGGFNRIDELNDRIVAFIEAHATDEQASQPGTAAGS* |
| Ga0070679_1008182521 | 3300005530 | Corn Rhizosphere | AEVAIVPGSHGGFNRIDKLNSRITAFIQANATGRHAVQPTQPSATER* |
| Ga0068855_1020827172 | 3300005563 | Corn Rhizosphere | PGSHGGFNRIDELNDRIAAFIKSHATGKQAAQPAPPPATKR* |
| Ga0070761_107302802 | 3300005591 | Soil | VAIVPGNHGGFNRIDALNDQMVAFIEAHPADEQAAQPTQLPTTKR* |
| Ga0070761_110711961 | 3300005591 | Soil | AEVAIVPGSHGGFNRIDDLNDRITAFIKAHATSKQTAQPTQPRRG* |
| Ga0070762_100457625 | 3300005602 | Soil | ARGSLMPHAEVAIVPGSHGGFNRIDELNDRIAAFIEAQATSQQASRPAG* |
| Ga0070764_103426142 | 3300005712 | Soil | GSLMPHAEVAVVPGSHGGFNRTDELNNRIAAFIKARATGNQAAQPAPPPATNR* |
| Ga0066903_1038565252 | 3300005764 | Tropical Forest Soil | GSLMPHAEVAVVLGSHGGFNRVDELNDRIAAFIKAQATGKQATQPARPPAS* |
| Ga0066903_1077235732 | 3300005764 | Tropical Forest Soil | MTPIPPAAAADVAIVPGSHGGFNRIDELNDRIAAFIQAQATGKQADQPAPPPAAS* |
| Ga0066790_100317825 | 3300005995 | Soil | VPGSHGGFNRIGELNDRIVAFIEAQAAGEQAAQPAQPQANRK* |
| Ga0070717_103401871 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | SLMPHAEVAIVPGSHGGFNRIDELNDRIAAFITAQATAKQAGQPTATGT* |
| Ga0075017_1013044222 | 3300006059 | Watersheds | SLMPHAEVAIVPGSHGGFNRIDELNDRITAFIKTRATGKQAAQPTRPPTAER* |
| Ga0070765_1018104122 | 3300006176 | Soil | MPHAEVAIVPGSHGGFNRIDELNDRIAAFIEAQGAGQQAVQPAQPPATKR* |
| Ga0074056_113048802 | 3300006574 | Soil | IVPGSHGGFNRISELNNRIAAFINAQATDKQAARPAPPPATRRQDPP* |
| Ga0116218_11607402 | 3300009522 | Peatlands Soil | GSHGGFNRINELNDRIAAFIKAQATDEQAAQPTRPPTTKR* |
| Ga0116218_13021481 | 3300009522 | Peatlands Soil | LMPHAEVAIVPGSHGGFNRIDELNDRIAAFIKGQATDKQAAQPAPPPATKR* |
| Ga0116221_11466472 | 3300009523 | Peatlands Soil | PGSHGGFNRIDELNDRIAAFIEAHPTDRQAAPPAQPPAGS* |
| Ga0116220_101814741 | 3300009525 | Peatlands Soil | NRIDELNDRIAAFIEAHATGKQAAQPTRPPTTKR* |
| Ga0116216_102758823 | 3300009698 | Peatlands Soil | AEVAIVPGSHGGFNRIDELNDRIAAFIKAQATGDQAAQPPTRNGSS* |
| Ga0116217_104286882 | 3300009700 | Peatlands Soil | GFSRISELNDRITAFIKARATGNQAAQPTPPPAAQR* |
| Ga0116219_108119011 | 3300009824 | Peatlands Soil | SLMPHAQVAIVPGSHGGFNRISELNDRITAFIKAQATSKQTAQPTQPPATNR* |
| Ga0116223_108462471 | 3300009839 | Peatlands Soil | HGGFNRISELNDRITAFIKAQATSKQTAQPTQPPATNR* |
| Ga0126380_103365511 | 3300010043 | Tropical Forest Soil | AVVPGSHGGFHRIDELNNQIAAFIKAHPTGQHTVQPSRPPATER* |
| Ga0126373_102987071 | 3300010048 | Tropical Forest Soil | MPHAEVAIVPRSHGGFNRIGEMNDRIAAFIKAHATGNKAAQPAQPQANEK* |
| Ga0074044_101580614 | 3300010343 | Bog Forest Soil | VPGSHGGFNRIDELNDRIAAFIEAHTTDKQQTAHPAQPPTTKR* |
| Ga0126378_100288543 | 3300010361 | Tropical Forest Soil | MTPIPPAAAADVAIVPGSHGGFNRIDELNNRIAAFIQAQATGKQADQPAPPPAAS* |
| Ga0126378_103186312 | 3300010361 | Tropical Forest Soil | MPHAEVAIVPGSHSGFDRIAAFIKAQATGKQATQPTRPPATKR* |
| Ga0126379_105506223 | 3300010366 | Tropical Forest Soil | VAIVPGSHGGFNRIDELNNRIAAFIQAQATGKQADQPAPPPAAS* |
| Ga0134128_109530062 | 3300010373 | Terrestrial Soil | NRIDEPNDRIVAFIKAQAAGEQAAQPARPQAAEK* |
| Ga0134128_122427622 | 3300010373 | Terrestrial Soil | MPHAEVAIVPGSHGGFNRIDELNDRIAAFITAQATAKQAGQPTATGT* |
| Ga0126381_1011830433 | 3300010376 | Tropical Forest Soil | MPHAQVAIVPGSHGGFNRIDELNDQIAAFIQAHTAGNQAVQPARPPTPER* |
| Ga0136449_1002178255 | 3300010379 | Peatlands Soil | MPHAQVAIVPGSHGGFNRINELNDRIAAFIKAQAISKPADQPPHPTGT* |
| Ga0136449_1010601051 | 3300010379 | Peatlands Soil | PSAEVAIVPGSHGGFNRIDELNDRIAAFIKGHATGKQASQPAPPPATKR* |
| Ga0136449_1020243671 | 3300010379 | Peatlands Soil | PAEAQARGSLMPHAEVAIVPGSHGGFNRIDELNDRIAAFIKGQATDKQAAQPAPPPATKR |
| Ga0136449_1021182681 | 3300010379 | Peatlands Soil | AVVPGSHGGFNRIDELNDRITAFIKAHATGSQAAQPTPPPAAQR* |
| Ga0134127_127731002 | 3300010399 | Terrestrial Soil | HGGFNRIDELNDRIAAFIKAHATEKRAAQPARPPAAPRHRR* |
| Ga0126361_109636102 | 3300010876 | Boreal Forest Soil | MPHAEVAIVPGSHGGFNRIDELNDRIAAFIKGQATDKQAAQPAPPPATKR* |
| Ga0137384_115873432 | 3300012357 | Vadose Zone Soil | VPGSHGGFNRTGELNDRIVAFIKAQAAGKQAAQPARPQASKK* |
| Ga0137390_119597611 | 3300012363 | Vadose Zone Soil | PHAEVAIVPGSHGGFNRITELNDRIAAFIQAQATGKQAAQPAPPPATN* |
| Ga0126369_132084961 | 3300012971 | Tropical Forest Soil | NRIDELNDRIAAFIKAHATDEQAGQPTRPATTKR* |
| Ga0157370_117863932 | 3300013104 | Corn Rhizosphere | GSHGGFNRIDELNDRIVAFIKAQAAGEQAAQPARPQAAEK* |
| Ga0181518_103856711 | 3300014156 | Bog | IVPGSHGGFSRIDELNDRITAFIKAHATGNQAAQPAPPPAALRE* |
| Ga0181521_105682681 | 3300014158 | Bog | SLMPHAEVAVVPGSHGGFSRIDEVNDRIAAFIKAHATGSQAAEPEPARGPDGTC* |
| Ga0181538_106904933 | 3300014162 | Bog | RIDELNDRITAFIKAHATGNQAAQPAPPPAALRE* |
| Ga0182016_108583341 | 3300014493 | Bog | IVPGSHGGFNRIDELNDRIAAFIEAQATDKQAAQPTRPPTTKG* |
| Ga0182030_101475681 | 3300014838 | Bog | HAEVAIVPGSHGGFNRIDELNNRIAAFIEAHATGKQAAQPADTDN* |
| Ga0182030_114738771 | 3300014838 | Bog | PHWRNACQVAIVPGSHGGFNRIDELNDRIAAFIKGQATDQQAALPAPPPATKR* |
| Ga0132257_1009348132 | 3300015373 | Arabidopsis Rhizosphere | PHAQVAIVPGSHGGFNRIDELNDRIAAFIQAQATGNQAAQPTRPPAPER* |
| Ga0182036_100565163 | 3300016270 | Soil | VPGSHGGFNRIDELNDRVAAFIKAQPAGQQAARPAQPPAQ |
| Ga0181505_104295611 | 3300016750 | Peatland | AEAHARGTLMPHAEVAIVPGSHGGFNRIDELNDQIAAFIHAQASGNQAAQPARPPAPER |
| Ga0187818_105458712 | 3300017823 | Freshwater Sediment | VAIVPGSHGGFSRIDELNDRIAAFIEAHPTDRQAAPPAQPPAGS |
| Ga0187807_11118043 | 3300017926 | Freshwater Sediment | EVAIVPGSHGGFNRIDELNDRIAAFIKAHATGKQAAQPAPPPATKR |
| Ga0187803_100753661 | 3300017934 | Freshwater Sediment | SLMPRAEVAVVPGSHGGFNRINELNDRIAAFIKAQATDTQAAQPARPQRDAQSRDRSE |
| Ga0187808_100659511 | 3300017942 | Freshwater Sediment | MPRAEVAVVPGSHGGFNRINELNERIAAFIKAQATDTQAAQPARPQRDAQSRDRSE |
| Ga0187808_101627193 | 3300017942 | Freshwater Sediment | GSHGGFNRIDALNDRITAFLKLHATGEHAVQQALPPATER |
| Ga0187808_101751351 | 3300017942 | Freshwater Sediment | AEVAVVPGSHGGFNRIDELNDRIAAFIKAHATGKQAAQPAPPPATKR |
| Ga0187808_105178391 | 3300017942 | Freshwater Sediment | ARGSLMPHAEVAIVPGSHGGFNRIDELNDRIAAFIEATDKQAAQPAATDD |
| Ga0187879_102743562 | 3300017946 | Peatland | QARARGSRMPHAEVAIVPGSHGGFSRIDEVNDRIGAFIKANATGNQAAQPTPPPAAQR |
| Ga0187847_101675211 | 3300017948 | Peatland | RARGSLLPHAEVAIVPGSHGGFGRIDELNDRIAAFIEAHATDEQTSQPRQPPTTN |
| Ga0187778_104280471 | 3300017961 | Tropical Peatland | PGSHGGFNRIDELNDRIAAFIKAQATGNQVARPARPPTTRR |
| Ga0187783_105695042 | 3300017970 | Tropical Peatland | HMPDAQVAIVPGSHGGFDRITELNERMAAFIKAQATDEQAAQPTRDLQ |
| Ga0187780_102753352 | 3300017973 | Tropical Peatland | GSHGGFDRINELNDRIAAFIKAQATDNQTLEPFRSVP |
| Ga0187777_111427561 | 3300017974 | Tropical Peatland | GGFNRIDELNDRIAAFIKGHATGKQAAQPAPPPAAKR |
| Ga0187815_104053121 | 3300018001 | Freshwater Sediment | VAIVPGSHGGFNRIDELNDRIAAFIEAHATGKQAAQPAQPPTTDR |
| Ga0187804_104837131 | 3300018006 | Freshwater Sediment | RARGSLMPHAEVAIVPGSHGGFNRIDELNDRIAAFIKAQATGNQAARPPTRNGSC |
| Ga0187888_14098121 | 3300018008 | Peatland | MPNAQVAIVPGSHGGFNRIDEVNDRITAFIKAHATGNQAAQPTPPPAAQ |
| Ga0187872_103422442 | 3300018017 | Peatland | ASRMPHAEIAVVPGSHGGFNRIDELNDQITAFIKAHATGNQAAQPTPPPAAQR |
| Ga0187887_101592971 | 3300018043 | Peatland | AEVAIVPGSHGGFGRIDELNDRIAAFIEAHATDEQTSQPRQPPTTKR |
| Ga0187851_100840931 | 3300018046 | Peatland | PHAEVAIVPGSHGGFSRIDELNDRIAAFIEAHATDEQTSQPRQPPTTN |
| Ga0187858_108315811 | 3300018057 | Peatland | HAEVAIVPGSHGGFSRIDEVNDRIAAFIKAHATGSQAAQPAPPPAALRE |
| Ga0187784_112052312 | 3300018062 | Tropical Peatland | PGSHGGFNRIDELNDRIAAFVAAHATGQQATQPAQPPAAER |
| Ga0187772_102989343 | 3300018085 | Tropical Peatland | PGSHGGFDRINELNDRIAAFIEAHATGKRAVQPGAAADIQDL |
| Ga0187772_106127992 | 3300018085 | Tropical Peatland | VPGSHGGFNRIDELNDRIAAFIKAQATAKQASQPAQPPTTKR |
| Ga0210403_112337411 | 3300020580 | Soil | PRAEVAVIPGSHGGFNRIDELNDRMAAFIKAHAGDKQPGEAAPANRLGEGS |
| Ga0210396_106608262 | 3300021180 | Soil | MPHAEVAIVPGSHGGFNRISELNDRIVAFIKARATRKQASQSARPSAVQP |
| Ga0210388_103170801 | 3300021181 | Soil | TGPGSHGGFNRIDELNDRIAAFIKAHATSKQTAQPTQPRRG |
| Ga0210388_109238922 | 3300021181 | Soil | VVPGSHGGFNRIDELNDRIAAFIKGHAADKQAAQPAPPPATKR |
| Ga0210388_113598941 | 3300021181 | Soil | LMPHAEVAVVPGSHGGFNRIDELNDRIAAFIEAHATDKQAAQPTTEG |
| Ga0213881_100111051 | 3300021374 | Exposed Rock | GGFNRINELNDRITAFIKAQATGQQAAQPTRPPRSSG |
| Ga0213875_100161551 | 3300021388 | Plant Roots | ASLMPRAKVAIVPGSHGGFNRINELNDRITAFIKAQATGQQAAQPTRPPRSSG |
| Ga0210393_111941551 | 3300021401 | Soil | IPHAEVAIVPGSHGGFNRIDELNDRIAAFIEAHATDKQAAQPTTEG |
| Ga0210389_102783632 | 3300021404 | Soil | MPHAEVAVVPGSHGGFNRINELNDRIAAFIKAHAAGQQADQPTRPPTTKR |
| Ga0210398_113288352 | 3300021477 | Soil | LPNAEVAVVPGSHGGFSDIGDVNNRIVAFINAHAVGQQAAQPTRPPATKI |
| Ga0210402_101955101 | 3300021478 | Soil | AEARARGSLMPHAEVAIVPGSHGGFNRIDELNDRIAGFIEARQTPGYPAGREM |
| Ga0126371_127138901 | 3300021560 | Tropical Forest Soil | HGGFHRIDELNDRIAAFIKAHASGRHAVQPAQPSAAER |
| Ga0207705_105718741 | 3300025909 | Corn Rhizosphere | HAEVAIVPGSHGGFNRIDELNSRITAFIQANATGRRAVQPTQPSATER |
| Ga0207649_103264433 | 3300025920 | Corn Rhizosphere | LVKKVAVVHGSHGGSSRVDALNDRIAAFIKAHRSNRQAAPDHLAT |
| Ga0207667_116984472 | 3300025949 | Corn Rhizosphere | IVPGSHGGFNRIDELNDRIAAFIKSHATGKQAAQPAPPPATKR |
| Ga0207683_107121561 | 3300026121 | Miscanthus Rhizosphere | GGFNRIDELNDRIAAFIKAHATEKRAAQPARPPAAPRHRR |
| Ga0209839_100255385 | 3300026294 | Soil | VPGSHGGFNRIGELNDRIVAFIEAQAAGEQAAQPAQPQANRK |
| Ga0257157_10857812 | 3300026496 | Soil | IVPGSHGGFNRISELNDRIAAFIQAQATGKQAAEPTPPPATS |
| Ga0208731_10009512 | 3300027029 | Forest Soil | MPHAEIAIVPGSHGGFNRIDELNDRIAAFIEAHATGKQAAQPAVPPATKR |
| Ga0208241_10255804 | 3300027297 | Forest Soil | GSHGGFNRIDELNDRIAAFIKAHATSKQAAQPTQPRRG |
| Ga0209420_10798372 | 3300027648 | Forest Soil | PGSHGGFNRIDELNDRIAAFIKAHATSKQTAQPTQPRRG |
| Ga0209530_10409841 | 3300027692 | Forest Soil | LIPHAEVAIVPGSHGGFNRIDELNDRMVAFIEAHATDEQAAQPTQPPTTDPKVRHQPGRR |
| Ga0207862_11130621 | 3300027703 | Tropical Forest Soil | MPHAQVAIVPGSHGGFNRIDELNDRIAAFIKAQATETQAAQPTRPPTPKR |
| Ga0209656_100338952 | 3300027812 | Bog Forest Soil | MPHAEVAIVPGSHGGFNRIDELNDRIAAFIEAHTTDKQQQQTAQPAQPPTTKR |
| Ga0209040_100086341 | 3300027824 | Bog Forest Soil | GSLMPHAEVAIVPGSHGGFNRIDELNDRIAAFIQAHTTDKQTAQPAQPPTTKR |
| Ga0209040_102595081 | 3300027824 | Bog Forest Soil | GSLMPHAEVAIVPGSHGGFNRIDELNDRIAAFIEAHTTDKQQTAHPAQPPTTKR |
| Ga0209039_100044043 | 3300027825 | Bog Forest Soil | MPHAEVAIVPGSHGGFNRIDELNDRIAAFIEAHTTDKQQTAHPAQPPTTKR |
| Ga0209274_103165291 | 3300027853 | Soil | VPGNHGGFNRIDALNDQMVAFIEAHPADEQAAQPTQLPTTKR |
| Ga0209274_107222891 | 3300027853 | Soil | EVAIVPGSHGGFNRIDELNDRIAAFIEAHTTDRQAAQPAPPPATKR |
| Ga0209693_103578242 | 3300027855 | Soil | QVAIVPGSHGGFNRIDELNDRIAAFIQAHAAGEQAAQPTRRPAAQRQDRSLLG |
| Ga0209169_105123151 | 3300027879 | Soil | VPGSHGGFNRIDELNDRIAAFIKGQATDKQAAQPAPPPATKR |
| Ga0209624_106060053 | 3300027895 | Forest Soil | VPGSHGGFNRISELNDRIAAFIKAQMTDPEAAQPIQPPTSRQ |
| Ga0209415_100134287 | 3300027905 | Peatlands Soil | MPHAQVAIVPGSHGGFNRINELNDRIAAFIKAQAISKPADQPPHPTGT |
| Ga0209415_101934371 | 3300027905 | Peatlands Soil | IVPGSHGGFNRIDELNDRIAAFIEAHPTDRQAAPPAQPPAGS |
| Ga0209006_107085502 | 3300027908 | Forest Soil | ARGRLMPHAEVAVVPGSHGGFNRIDELNDRVAAFIKGQASDQPAAEPARA |
| Ga0307290_100432571 | 3300028791 | Soil | EVAIVPGSHGGFNRINELNDRIAAFIQAHATGKQAAQPTPPPATSAGAVADSG |
| Ga0302218_102974731 | 3300028863 | Palsa | ASLMQHTDVAIVPGSHGGFNRIDELNDRIAAFIEAQATDKQAAQPTLPPTTKG |
| Ga0307289_104201381 | 3300028875 | Soil | HAEVAIVPGSHGGFNRINELNDRIAAFIQAHATGKQAAQPTPPPATSAGAVADSG |
| Ga0302229_105175011 | 3300028879 | Palsa | RIDELNDRIAAFIKAHGTAEQPAQRAQRAQPPAASR |
| Ga0308309_116628071 | 3300028906 | Soil | MPHAEVAIVPGSHGGFNRIDELNDRIAAFIEAQGAGQQAVQPAQPPATKR |
| Ga0311363_101969791 | 3300029922 | Fen | DRASLMQHTDVAIVPGSHGGFNRIDELNDRIAAFIEAQATDKQAAQPTLPPTTKG |
| Ga0311340_111288632 | 3300029943 | Palsa | GGFNRINELNDRIAAFIEAQATDKQAAQPTRPPTTKG |
| Ga0311371_104368651 | 3300029951 | Palsa | EVAIVPGSHGGFTRTDELNDRIAAFIEAHAADEQASQPTQPPTTKR |
| Ga0302283_10934151 | 3300029994 | Fen | HAEVAIVPGSHGGFNRIDELNDRIAAFIEAQATDKQAAQPTLPPTTKG |
| Ga0311338_108285942 | 3300030007 | Palsa | SLMPRAEVAVVPGSHGGFNRIGELNERIAAFIKAQAPGEQAARQISKK |
| Ga0311338_114747231 | 3300030007 | Palsa | RGSHGGFNRIDELNDRIAAFIEAHATGKQTSQPAQPPTT |
| Ga0302178_101308472 | 3300030013 | Palsa | RARGSLMPHAEVAVVPGSHGGFNRIDELNDRIAAFIKGQATDKQAAKPAHA |
| Ga0311370_110169131 | 3300030503 | Palsa | RARGGLIPHAEVAIVPGSHGGFNRIDELNDRMVAFIEAHATDEQAAQPTQPPTTNR |
| Ga0302314_103573081 | 3300030906 | Palsa | ASLMPHAEIAIVPGSHGGFNRINELNDRIAAFIEAHATDKQVAQPADTDK |
| Ga0302314_119758802 | 3300030906 | Palsa | GSHGGFNRIDELNDRIVAFIEAHPADEQAARPTQPPATKR |
| Ga0302180_106250282 | 3300031028 | Palsa | ARGSLMLHAEVAVVPGSHGGFNRIGELNERIAAFIKAQAPGEQAARQISKK |
| Ga0302180_106568142 | 3300031028 | Palsa | GFSRIDELNDRIAAFIEAHATDEQTSQPRQPPTTN |
| Ga0302324_1005682641 | 3300031236 | Palsa | AEVAIVPGSHGGFSRIDELNDRIAAFIEAHATDEQTSQPRQPPTTN |
| Ga0318534_102149411 | 3300031544 | Soil | MPHAEVAVVPGSHGGFNRIDELNDRIAAFIKAHATDKQAAQPAPPPATKR |
| Ga0318534_102242672 | 3300031544 | Soil | VASPADMAIRHAEVAIVPGSHGGFNRIDDLNDRIAAFIKTHPADQQAARPAQPPAVER |
| Ga0318538_100875812 | 3300031546 | Soil | MAIRHAEVAIVPGSHGGFNRIDDLNDRIAAFIKTHPADQQAARPAQPPAVER |
| Ga0310686_1021615487 | 3300031708 | Soil | GSHGGFNRIDELNDRIVAFIEARAADEQPAQPGTAVDN |
| Ga0310686_1064590211 | 3300031708 | Soil | MSPGSNGGFNRIGELNDRIVAFIKAQAAGKQAAQPAQPQVGKK |
| Ga0310686_1090734831 | 3300031708 | Soil | RARGSGMPDAEVVIGPGSHGGFNRVDELNDRIAAFIEAQATGKQAAQPGQPPATKR |
| Ga0310686_1112484762 | 3300031708 | Soil | PGSHGGFNRIDELNDRIAAFIKAQATGDQAAKPPTRNGSS |
| Ga0310686_1145291222 | 3300031708 | Soil | GSHGGFNRIDELNDRIAAFIEAQATGKQAAQPARRPGN |
| Ga0310686_1145385293 | 3300031708 | Soil | IVPGSHGGFNRIDELNDRIAAFIEATDKQAAQPAATDD |
| Ga0310686_1192958202 | 3300031708 | Soil | PGSHGGFNRIDELNDRIAAFIEAQATDKQESQPPVPPPTTKR |
| Ga0307476_108581652 | 3300031715 | Hardwood Forest Soil | VPGSHGGFNRIDELNDRIAAFIRSHATGTQAAQPAPPPATKR |
| Ga0318521_107639832 | 3300031770 | Soil | IMPHAKVAIVPGSHGGFNRIDELNDRIAAFIEAQAVGKPAAWPARPPTTKR |
| Ga0318498_103294371 | 3300031778 | Soil | LMPHAQVAIVPGSHGGFNRIDELNDRIAAFIQAQATDEQAAQPTRPPAPER |
| Ga0318565_101738683 | 3300031799 | Soil | PHAEVAIVPGSHGGFNRIGELNDRIAAFIKGQATDKQAAQPAPPPATKR |
| Ga0307478_105897683 | 3300031823 | Hardwood Forest Soil | VPGSHGGFNRIGELNDRIAAFIKAHAAGEQAAQPAQSPTGKPVGPQPGSMP |
| Ga0318518_104377093 | 3300032090 | Soil | VAIVPGSHGGFNRIDELNQRIAAFINGQATGKPADQPAHRADT |
| Ga0311301_104902861 | 3300032160 | Peatlands Soil | AVVPGSHGGFNRIDELNDRITAFIKAHATGSQAAQPTPPPAAQR |
| Ga0311301_108717103 | 3300032160 | Peatlands Soil | HAEVAIVSGSHGGFNRIDELNDRIAAFIEAHATGKQAAQPTRPPTTKR |
| Ga0311301_115688581 | 3300032160 | Peatlands Soil | HGGFNRIDELTDRIAAFIEAHATGKQAAQPARPPTTKR |
| Ga0307470_112331902 | 3300032174 | Hardwood Forest Soil | VPDGTGEQVAIVPGSHGGFNRINELNDRITAFIQAHATGKRAAQPTPPPATSAGAVADSG |
| Ga0348332_100868671 | 3300032515 | Plant Litter | HGGFNRIDELNDRIAAFIKAHATSKQTAQPTQPRRG |
| Ga0335085_105538553 | 3300032770 | Soil | RGSLMPHAQVAIVPGSHGGFNRIDELNDRIAAFIKAPATSKPTDQPAHPTGP |
| Ga0335080_108510691 | 3300032828 | Soil | SLMPHAEVAVVPGSHGGFNRIGELNDRIAAFIQAQATGKQAVQPASPPAAS |
| Ga0335080_114345981 | 3300032828 | Soil | RARGSLMPHAEVAVVPGSHGGFNRVDELNDRIAAFIEAQATGNQAAQPAPPPAT |
| Ga0335081_112725111 | 3300032892 | Soil | PGSHGGFDRIDELNDRIAAFINAHATGKQAAQPARPPAAEQ |
| Ga0335083_111924682 | 3300032954 | Soil | RGSLMPHSQVAIVPGSHGGFNRIDELNDRIAAFIQAQAVGEQAAPPARPPAPER |
| Ga0318519_102602022 | 3300033290 | Soil | TPAEAHARGSLMPRAEIAVVPGSHGGFNRINELNDRIAAFIKAQATDKQAAQPVPPPAAK |
| ⦗Top⦘ |