| Basic Information | |
|---|---|
| Family ID | F040133 |
| Family Type | Metagenome |
| Number of Sequences | 162 |
| Average Sequence Length | 42 residues |
| Representative Sequence | CKKVITYYMQEAVNNHMCTIGNQLEKQGQKDLANIIRRL |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 162 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.38 % |
| % of genes from short scaffolds (< 2000 bps) | 91.36 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (47.531 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (43.827 % of family members) |
| Environment Ontology (ENVO) | Unclassified (92.593 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.358 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 162 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 2.47 |
| PF13385 | Laminin_G_3 | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.47 % |
| Unclassified | root | N/A | 47.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10037966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Thalassospira → unclassified Thalassospira → Thalassospira sp. | 2045 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10075695 | Not Available | 1191 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10210696 | Not Available | 536 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10260525 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 524 | Open in IMG/M |
| 3300000325|SI39nov09_100mDRAFT_1032930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → unclassified Methylophaga → Methylophaga sp. | 967 | Open in IMG/M |
| 3300001460|JGI24003J15210_10093754 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300001460|JGI24003J15210_10185532 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 500 | Open in IMG/M |
| 3300001472|JGI24004J15324_10015128 | All Organisms → Viruses → Predicted Viral | 2699 | Open in IMG/M |
| 3300001723|JGI24661J20069_1022637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 721 | Open in IMG/M |
| 3300001743|JGI24515J20084_1001824 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| 3300001743|JGI24515J20084_1007623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 987 | Open in IMG/M |
| 3300002242|KVWGV2_10954017 | Not Available | 533 | Open in IMG/M |
| 3300002483|JGI25132J35274_1059292 | Not Available | 816 | Open in IMG/M |
| 3300002514|JGI25133J35611_10054538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1330 | Open in IMG/M |
| 3300002514|JGI25133J35611_10114542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 776 | Open in IMG/M |
| 3300002514|JGI25133J35611_10194053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 535 | Open in IMG/M |
| 3300002760|JGI25136J39404_1115245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 508 | Open in IMG/M |
| 3300004110|Ga0008648_10130305 | Not Available | 695 | Open in IMG/M |
| 3300005604|Ga0066852_10265398 | Not Available | 580 | Open in IMG/M |
| 3300006019|Ga0066375_10219977 | Not Available | 589 | Open in IMG/M |
| 3300006090|Ga0082015_1065643 | Not Available | 570 | Open in IMG/M |
| 3300006336|Ga0068502_1520601 | Not Available | 548 | Open in IMG/M |
| 3300006751|Ga0098040_1017940 | All Organisms → cellular organisms → Bacteria | 2335 | Open in IMG/M |
| 3300006751|Ga0098040_1188268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → unclassified Methylophaga → Methylophaga sp. | 605 | Open in IMG/M |
| 3300006751|Ga0098040_1228513 | Not Available | 540 | Open in IMG/M |
| 3300006753|Ga0098039_1047582 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 1504 | Open in IMG/M |
| 3300006753|Ga0098039_1050209 | Not Available | 1460 | Open in IMG/M |
| 3300006753|Ga0098039_1238113 | Not Available | 613 | Open in IMG/M |
| 3300006754|Ga0098044_1069499 | All Organisms → Viruses → Predicted Viral | 1473 | Open in IMG/M |
| 3300006789|Ga0098054_1143866 | Not Available | 882 | Open in IMG/M |
| 3300006789|Ga0098054_1194274 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300006789|Ga0098054_1202424 | Not Available | 723 | Open in IMG/M |
| 3300006789|Ga0098054_1245282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → unclassified Methylophaga → Methylophaga sp. | 647 | Open in IMG/M |
| 3300006789|Ga0098054_1254114 | Not Available | 634 | Open in IMG/M |
| 3300006802|Ga0070749_10407068 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 750 | Open in IMG/M |
| 3300006868|Ga0075481_10090567 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300006870|Ga0075479_10323795 | Not Available | 602 | Open in IMG/M |
| 3300006923|Ga0098053_1070222 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 713 | Open in IMG/M |
| 3300006924|Ga0098051_1175326 | Not Available | 563 | Open in IMG/M |
| 3300006927|Ga0098034_1057701 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300006929|Ga0098036_1019126 | All Organisms → cellular organisms → Bacteria | 2175 | Open in IMG/M |
| 3300006929|Ga0098036_1042427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1419 | Open in IMG/M |
| 3300006929|Ga0098036_1050466 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300006947|Ga0075444_10024439 | Not Available | 3081 | Open in IMG/M |
| 3300006947|Ga0075444_10338833 | Not Available | 574 | Open in IMG/M |
| 3300006988|Ga0098064_144692 | Not Available | 558 | Open in IMG/M |
| 3300007508|Ga0105011_1126297 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 928 | Open in IMG/M |
| 3300007963|Ga0110931_1049877 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 1264 | Open in IMG/M |
| 3300007963|Ga0110931_1108317 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 837 | Open in IMG/M |
| 3300008050|Ga0098052_1004734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7784 | Open in IMG/M |
| 3300008050|Ga0098052_1287701 | Not Available | 623 | Open in IMG/M |
| 3300008218|Ga0114904_1026386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Thalassospira → unclassified Thalassospira → Thalassospira sp. | 1651 | Open in IMG/M |
| 3300008219|Ga0114905_1014244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3254 | Open in IMG/M |
| 3300008220|Ga0114910_1039836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Thalassospira → unclassified Thalassospira → Thalassospira sp. | 1547 | Open in IMG/M |
| 3300008220|Ga0114910_1190794 | Not Available | 568 | Open in IMG/M |
| 3300008629|Ga0115658_1043113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Thalassospira → unclassified Thalassospira → Thalassospira sp. | 2929 | Open in IMG/M |
| 3300009026|Ga0102829_1189511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → unclassified Methylophaga → Methylophaga sp. | 666 | Open in IMG/M |
| 3300009076|Ga0115550_1311140 | Not Available | 504 | Open in IMG/M |
| 3300009193|Ga0115551_1300946 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 701 | Open in IMG/M |
| 3300009423|Ga0115548_1171584 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 678 | Open in IMG/M |
| 3300009433|Ga0115545_1042666 | All Organisms → Viruses → Predicted Viral | 1774 | Open in IMG/M |
| 3300009435|Ga0115546_1225683 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 645 | Open in IMG/M |
| 3300009435|Ga0115546_1266773 | Not Available | 586 | Open in IMG/M |
| 3300009467|Ga0115565_10062105 | All Organisms → Viruses → Predicted Viral | 1804 | Open in IMG/M |
| 3300009498|Ga0115568_10507686 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 512 | Open in IMG/M |
| 3300009601|Ga0114914_1066693 | Not Available | 558 | Open in IMG/M |
| 3300009602|Ga0114900_1118744 | Not Available | 708 | Open in IMG/M |
| 3300009602|Ga0114900_1169208 | Not Available | 553 | Open in IMG/M |
| 3300009603|Ga0114911_1169717 | Not Available | 606 | Open in IMG/M |
| 3300009604|Ga0114901_1163584 | Not Available | 662 | Open in IMG/M |
| 3300009605|Ga0114906_1149451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → unclassified Methylophaga → Methylophaga sp. | 807 | Open in IMG/M |
| 3300009605|Ga0114906_1158063 | Not Available | 779 | Open in IMG/M |
| 3300009605|Ga0114906_1300528 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 509 | Open in IMG/M |
| 3300009705|Ga0115000_10470778 | Not Available | 794 | Open in IMG/M |
| 3300010148|Ga0098043_1110041 | Not Available | 799 | Open in IMG/M |
| 3300010149|Ga0098049_1038281 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300010150|Ga0098056_1108330 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 946 | Open in IMG/M |
| 3300010150|Ga0098056_1320246 | Not Available | 510 | Open in IMG/M |
| 3300010155|Ga0098047_10156848 | Not Available | 879 | Open in IMG/M |
| 3300010883|Ga0133547_11345426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2 | 1352 | Open in IMG/M |
| 3300017697|Ga0180120_10438960 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 510 | Open in IMG/M |
| 3300017718|Ga0181375_1030127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → unclassified Methylophaga → Methylophaga sp. | 921 | Open in IMG/M |
| 3300017721|Ga0181373_1047044 | Not Available | 786 | Open in IMG/M |
| 3300017721|Ga0181373_1051028 | Not Available | 751 | Open in IMG/M |
| 3300017725|Ga0181398_1072859 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 824 | Open in IMG/M |
| 3300017728|Ga0181419_1157414 | Not Available | 542 | Open in IMG/M |
| 3300017731|Ga0181416_1085746 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 748 | Open in IMG/M |
| 3300017734|Ga0187222_1152046 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 514 | Open in IMG/M |
| 3300017738|Ga0181428_1095635 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 694 | Open in IMG/M |
| 3300017743|Ga0181402_1130370 | Not Available | 641 | Open in IMG/M |
| 3300017746|Ga0181389_1154150 | Not Available | 609 | Open in IMG/M |
| 3300017746|Ga0181389_1172382 | Not Available | 568 | Open in IMG/M |
| 3300017748|Ga0181393_1141803 | Not Available | 602 | Open in IMG/M |
| 3300017757|Ga0181420_1240941 | Not Available | 516 | Open in IMG/M |
| 3300017769|Ga0187221_1122754 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56 | 782 | Open in IMG/M |
| 3300017773|Ga0181386_1198347 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 604 | Open in IMG/M |
| 3300017775|Ga0181432_1042603 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 1251 | Open in IMG/M |
| 3300020410|Ga0211699_10153491 | Not Available | 869 | Open in IMG/M |
| 3300020447|Ga0211691_10390820 | Not Available | 560 | Open in IMG/M |
| 3300021959|Ga0222716_10036881 | All Organisms → Viruses → Predicted Viral | 3533 | Open in IMG/M |
| 3300021978|Ga0232646_1114360 | Not Available | 909 | Open in IMG/M |
| 3300022068|Ga0212021_1123834 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 529 | Open in IMG/M |
| 3300023110|Ga0255743_10297903 | Not Available | 835 | Open in IMG/M |
| (restricted) 3300024520|Ga0255047_10138682 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 1245 | Open in IMG/M |
| 3300025039|Ga0207878_127815 | Not Available | 577 | Open in IMG/M |
| 3300025042|Ga0207889_1020476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → unclassified Methylophaga → Methylophaga sp. | 618 | Open in IMG/M |
| 3300025046|Ga0207902_1025590 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 708 | Open in IMG/M |
| 3300025046|Ga0207902_1033492 | Not Available | 632 | Open in IMG/M |
| 3300025046|Ga0207902_1040605 | Not Available | 579 | Open in IMG/M |
| 3300025066|Ga0208012_1049187 | Not Available | 617 | Open in IMG/M |
| 3300025069|Ga0207887_1054127 | Not Available | 654 | Open in IMG/M |
| 3300025070|Ga0208667_1070137 | Not Available | 530 | Open in IMG/M |
| 3300025072|Ga0208920_1109197 | Not Available | 500 | Open in IMG/M |
| 3300025078|Ga0208668_1091736 | Not Available | 533 | Open in IMG/M |
| 3300025086|Ga0208157_1096654 | Not Available | 715 | Open in IMG/M |
| 3300025096|Ga0208011_1095367 | Not Available | 636 | Open in IMG/M |
| 3300025099|Ga0208669_1019102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Thalassospira → unclassified Thalassospira → Thalassospira sp. | 1784 | Open in IMG/M |
| 3300025099|Ga0208669_1069748 | Not Available | 770 | Open in IMG/M |
| 3300025103|Ga0208013_1057586 | Not Available | 1041 | Open in IMG/M |
| 3300025108|Ga0208793_1036456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Thalassospira → unclassified Thalassospira → Thalassospira sp. | 1598 | Open in IMG/M |
| 3300025108|Ga0208793_1164652 | Not Available | 577 | Open in IMG/M |
| 3300025118|Ga0208790_1126355 | Not Available | 724 | Open in IMG/M |
| 3300025125|Ga0209644_1058448 | Not Available | 889 | Open in IMG/M |
| 3300025128|Ga0208919_1179496 | Not Available | 644 | Open in IMG/M |
| 3300025141|Ga0209756_1241128 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 668 | Open in IMG/M |
| 3300025168|Ga0209337_1041331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Thalassospira → unclassified Thalassospira → Thalassospira sp. | 2464 | Open in IMG/M |
| 3300025216|Ga0207883_1015376 | Not Available | 1063 | Open in IMG/M |
| 3300025237|Ga0208031_1012477 | Not Available | 1160 | Open in IMG/M |
| 3300025248|Ga0207904_1081450 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 520 | Open in IMG/M |
| 3300025251|Ga0208182_1005290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Thalassospira → unclassified Thalassospira → Thalassospira sp. | 4260 | Open in IMG/M |
| 3300025251|Ga0208182_1073853 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 654 | Open in IMG/M |
| 3300025266|Ga0208032_1056159 | Not Available | 900 | Open in IMG/M |
| 3300025267|Ga0208179_1049016 | Not Available | 961 | Open in IMG/M |
| 3300025268|Ga0207894_1037201 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 861 | Open in IMG/M |
| 3300025274|Ga0208183_1106895 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 508 | Open in IMG/M |
| 3300025280|Ga0208449_1057613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → unclassified Methylophaga → Methylophaga sp. | 1019 | Open in IMG/M |
| 3300025287|Ga0207903_1065561 | Not Available | 631 | Open in IMG/M |
| 3300025293|Ga0208934_1013003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Thalassospira → unclassified Thalassospira → Thalassospira sp. | 1798 | Open in IMG/M |
| 3300025293|Ga0208934_1042493 | Not Available | 848 | Open in IMG/M |
| 3300025301|Ga0208450_1032116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → unclassified Methylophaga → Methylophaga sp. | 1403 | Open in IMG/M |
| 3300025301|Ga0208450_1049210 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 1044 | Open in IMG/M |
| 3300025301|Ga0208450_1087200 | Not Available | 699 | Open in IMG/M |
| 3300025822|Ga0209714_1116475 | Not Available | 719 | Open in IMG/M |
| 3300025873|Ga0209757_10047020 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 1263 | Open in IMG/M |
| 3300025873|Ga0209757_10145505 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 741 | Open in IMG/M |
| 3300026268|Ga0208641_1162972 | Not Available | 599 | Open in IMG/M |
| 3300027714|Ga0209815_1048311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 1558 | Open in IMG/M |
| 3300027771|Ga0209279_10010018 | All Organisms → Viruses → Predicted Viral | 3317 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10235018 | Not Available | 883 | Open in IMG/M |
| 3300028018|Ga0256381_1010915 | Not Available | 1476 | Open in IMG/M |
| 3300028192|Ga0257107_1239085 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 509 | Open in IMG/M |
| 3300028448|Ga0256383_109697 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 773 | Open in IMG/M |
| 3300032278|Ga0310345_10132638 | All Organisms → Viruses → Predicted Viral | 2209 | Open in IMG/M |
| 3300032360|Ga0315334_10611992 | Not Available | 940 | Open in IMG/M |
| 3300032373|Ga0316204_10278688 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 1304 | Open in IMG/M |
| 3300032820|Ga0310342_101097288 | Not Available | 937 | Open in IMG/M |
| 3300032820|Ga0310342_101912510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → unclassified Methylophaga → Methylophaga sp. | 709 | Open in IMG/M |
| 3300033742|Ga0314858_059919 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 934 | Open in IMG/M |
| 3300033742|Ga0314858_065788 | Not Available | 896 | Open in IMG/M |
| 3300033742|Ga0314858_139049 | Not Available | 622 | Open in IMG/M |
| 3300034374|Ga0348335_021974 | All Organisms → Viruses → Predicted Viral | 3036 | Open in IMG/M |
| 3300034374|Ga0348335_142697 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 669 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 43.83% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 17.90% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 8.02% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.56% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.70% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.70% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.47% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.85% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.85% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.23% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.23% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.23% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.23% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.62% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.62% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.62% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.62% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.62% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.62% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.62% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.62% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Fluids | 0.62% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000325 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 100m | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001723 | Marine viral communities from the Deep Pacific Ocean - MSP-144 | Environmental | Open in IMG/M |
| 3300001743 | Marine viral communities from the Pacific Ocean - LP-38 | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300002760 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 | Environmental | Open in IMG/M |
| 3300004110 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_100m_DNA | Environmental | Open in IMG/M |
| 3300005604 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63 | Environmental | Open in IMG/M |
| 3300006019 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_NADW_ad_2500m_LV_A | Environmental | Open in IMG/M |
| 3300006090 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP124 | Environmental | Open in IMG/M |
| 3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300006988 | Marine viral communities from Cariaco Basin, Caribbean Sea - 24B_WHOI_OMZ_CsCl | Environmental | Open in IMG/M |
| 3300007508 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300008629 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009601 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017718 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaG | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020447 | Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159) | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021978 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Perseverance_CTD_V16A_01_btl17 _150kmer | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025039 | Marine viral communities from the Pacific Ocean - LP-41 (SPAdes) | Environmental | Open in IMG/M |
| 3300025042 | Marine viral communities from the Pacific Ocean - LP-47 (SPAdes) | Environmental | Open in IMG/M |
| 3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
| 3300025066 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025216 | Marine viral communities from the Deep Pacific Ocean - MSP-109 (SPAdes) | Environmental | Open in IMG/M |
| 3300025237 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025248 | Marine viral communities from the Deep Pacific Ocean - MSP-118 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
| 3300025267 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes) | Environmental | Open in IMG/M |
| 3300025268 | Marine viral communities from the Deep Pacific Ocean - MSP-114 (SPAdes) | Environmental | Open in IMG/M |
| 3300025274 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025287 | Marine viral communities from the Deep Pacific Ocean - MSP-131 (SPAdes) | Environmental | Open in IMG/M |
| 3300025293 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300026268 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027771 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027868 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22 | Environmental | Open in IMG/M |
| 3300028018 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 1600m | Environmental | Open in IMG/M |
| 3300028192 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m | Environmental | Open in IMG/M |
| 3300028448 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 300m | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100379664 | 3300000115 | Marine | AYYMHEAIKNHMCTIGNQLEQQGHKDLAKIIRRL* |
| DelMOSum2011_100756951 | 3300000115 | Marine | HAFRDRTKMVIAYYIQEGIKNHICTVCNELEKQGHKDLANIIRRL* |
| DelMOSum2011_102106961 | 3300000115 | Marine | IAYYIQEGIKNHICTVCNELEKQGHKDLANIIRRL* |
| DelMOSpr2010_102605251 | 3300000116 | Marine | RARTKMVVAHYIQEGIKNHTCTICXELEKQGQTDLANIIRRL* |
| SI39nov09_100mDRAFT_10329303 | 3300000325 | Marine | VAEMATDRLISVADTAPNEIKAQAHAFKNVCHQVIVYYMQEAIKNHMCTIGNQLESQGHKDLANIIRRL* |
| JGI24003J15210_100937541 | 3300001460 | Marine | MVVAHYIQEGIKNHTCTICNELEKQGHKDLANIIRRL* |
| JGI24003J15210_101855322 | 3300001460 | Marine | IKAQAHAFKDRTKMVVAHYIQEGIKNHLCTVCNELEKQGHKDLANIIRRI* |
| JGI24004J15324_100151281 | 3300001472 | Marine | AHYIQEGIKNHTCTICNELEKQGHKDLANIIRRL* |
| JGI24661J20069_10226371 | 3300001723 | Deep Ocean | VIAYYMKEAVNNHICTICNQLEAQGHKDLANXXRRL* |
| JGI24515J20084_10018241 | 3300001743 | Marine | QKVIVYYMQEAVNNHMCTIGNQLEKQGQKDLANIIRRL* |
| JGI24515J20084_10076233 | 3300001743 | Marine | VIAYYMQEAVNNHMCTICNLLEKQGQKDLANIIRRL* |
| KVWGV2_109540171 | 3300002242 | Marine Sediment | AQAHAFKNQCHTVVTYYMKEAIKNHMCTIGNQLEKQGHSDLANIIRRL* |
| JGI25132J35274_10592921 | 3300002483 | Marine | HIFKDAARKVITHYMHEAIKNHICTVCNQLEQQGHKDLANIIRRL* |
| JGI25133J35611_100545381 | 3300002514 | Marine | PIKAQAHVFRELCQKVIAYYMKEAVNNHICTICNQLEKQGHKDLANIIRRL* |
| JGI25133J35611_101145423 | 3300002514 | Marine | HVFRELCQKVIAYYMKEAVNNHICTICNQLEKQGHKDLANIIRRL* |
| JGI25133J35611_101940532 | 3300002514 | Marine | AHVFKETCKKVIAYYMQEAVNNHICTVCNQLEKQGQKDLANIIRRL* |
| JGI25136J39404_11152451 | 3300002760 | Marine | ERCRKIIEYYMQEAVNNHMCTIGNKLDKQGQKDLANIIRRL* |
| Ga0008648_101303053 | 3300004110 | Marine | HAFKNVCHQVIVYYMQEAIKNHMCTIGNQLEQQGHKDLANIIRRL* |
| Ga0066852_102653981 | 3300005604 | Marine | MIITYYMKEAINNHMCTIGNQLESQGHKDLANIIRRL* |
| Ga0066375_102199772 | 3300006019 | Marine | FVIAYYMKEAINNHICTICNQLEAQGHKDLANIIRRL* |
| Ga0082015_10656432 | 3300006090 | Marine | ITYYMKEAINNHMCKISNQLESQGHKDLANIIRRL* |
| Ga0068502_15206011 | 3300006336 | Marine | VITYYMQEAVNNHMCTIGNQLEKQGQKDLANIIRRL* |
| Ga0098040_10179404 | 3300006751 | Marine | QAFKKSCYFIITFYMKEAIKNHMCTIGNELESQGHKDLANIIRRL* |
| Ga0098040_11882681 | 3300006751 | Marine | KKTCHTVITYYMQEAIKNHMCTIGNKLEQQGHKDLAEIIRRL* |
| Ga0098040_12285131 | 3300006751 | Marine | QAHAFKNSCHVIIAFYMREAIKNHMCTIGNQLEAQGNKDLAEIIRRL* |
| Ga0098039_10475821 | 3300006753 | Marine | PIRAQAHAFKVACKKVITYYMQEAVNNHMCTICNQLEKQGQKDLANIIRRL* |
| Ga0098039_10502094 | 3300006753 | Marine | ITYYMKEAINNHMCTIGNQLEAQGHKDLANIIRRL* |
| Ga0098039_12381131 | 3300006753 | Marine | QAHAFKNKCHRIITYYMQQAINNHMCTISNKLESQGHKDLANIIRRL* |
| Ga0098044_10694993 | 3300006754 | Marine | FRELCQKVIAYYMQEAVNNHICTVCNQLEKQGQKDLANIIRRL* |
| Ga0098054_11438663 | 3300006789 | Marine | QAHAFREACKNVITYYMNEAIKNHMCTICNQLEKQGQKDLANIIRRL* |
| Ga0098054_11942743 | 3300006789 | Marine | AFREACKKVIMYYMDEAVKNHMCTICNQLEQQGQKDLANIIRRL* |
| Ga0098054_12024243 | 3300006789 | Marine | AFREACKKVIMYYMDEAVKNHMCTICNQLEQQGHKDLANIIRRL* |
| Ga0098054_12452823 | 3300006789 | Marine | CHFIIAYYMREAIKNHMCTIGNQLEQQGHKDLAEIIRRL* |
| Ga0098054_12541141 | 3300006789 | Marine | TGYMQKAVEGHVCTICNALEKQGHRDLAEIIRRL* |
| Ga0070749_104070683 | 3300006802 | Aqueous | AFRDRTKWVIAHYIQEGIKNHTCTICNELEKQGQTDLANIIRRL* |
| Ga0075481_100905673 | 3300006868 | Aqueous | ITYYMNEAIKNHVCTICNELEKQGQKDLANIIRRL* |
| Ga0075479_103237951 | 3300006870 | Aqueous | QAHAFREACKHIITYYMNEAIKNHVCTICNELEKQGQKDLANIIRRL* |
| Ga0098053_10702223 | 3300006923 | Marine | RAQAHAFKKMCHTVITYYMQQAVNNHICTICNLLEKQGQKDLANIIRRL* |
| Ga0098051_11753261 | 3300006924 | Marine | MVKAQAHAFRDRCKWIIQFYVNEGIKNHICTVCNELEKQGHKDLSNIIRRL* |
| Ga0098034_10577011 | 3300006927 | Marine | AFKNQCRFIIGYYMKEAINNHICTICNQLEAQGHKDLANIIRRL* |
| Ga0098036_10191261 | 3300006929 | Marine | KHIITYYMREAVKNHVCTICNELEKQGQKDLANIIRRL* |
| Ga0098036_10424274 | 3300006929 | Marine | AFKNLCYKIIAYYMHEAIKNHMCTIGNQLEQQGHKDLAEIIRRL* |
| Ga0098036_10504663 | 3300006929 | Marine | LLTGYMQKAVEGHVCTICNALEKQGHRDLAEIIRRL* |
| Ga0075444_100244391 | 3300006947 | Marine | AQAHAFRDKCKMVITFYVQEGIKNHICTVCNQLEQQGHKDLANIIRRL* |
| Ga0075444_103388332 | 3300006947 | Marine | FVIAYYMKEAVNNHICTICNQLEAQGHKDLANIIRRL* |
| Ga0098064_1446921 | 3300006988 | Marine | ITYYMKEAIKNHMCTIGNQLEAQGHKDLAEIIRRL* |
| Ga0105011_11262971 | 3300007508 | Marine | VITYYMQEAIKNHMCTIGNKLEQQGHKDLAEIIRRL* |
| Ga0110931_10498773 | 3300007963 | Marine | REQAHVFKETCKKVIAYYMQEAVNNHICTVCNQLEKQGQKDLANIIRRL* |
| Ga0110931_11083171 | 3300007963 | Marine | RCKWIIQYYVNEGIKNHICTVCNELEKQGQKDLANIIRRL* |
| Ga0098052_10047341 | 3300008050 | Marine | KIIMYYMHEAVKNHICTICNQLEQQGHKDLANIIRRL* |
| Ga0098052_12877012 | 3300008050 | Marine | FKELCQKVIVYYMKEVVNNHICTICNQLEKQGQQDLANIIRRL* |
| Ga0114904_10263861 | 3300008218 | Deep Ocean | IIVYYMQEAVNNHMCTICNLLEKQGQKDLANIIRRL* |
| Ga0114905_10142441 | 3300008219 | Deep Ocean | QAHAFEKVCKKVIAYYMQQAVNNHICTICNLLEKQGHKDLATIIRRL* |
| Ga0114910_10398361 | 3300008220 | Deep Ocean | IAYYMHEAIKNHMCTIGNQLEQQGHKDLAEIIRRL* |
| Ga0114910_11907941 | 3300008220 | Deep Ocean | TQANAFRELCQKVIAYYMQEAVNNHICTVCNQLEKQGQKDLANIIRRL* |
| Ga0115658_10431131 | 3300008629 | Marine | KTCQLVITYYMKEAIKNHMCTIGNQLEAQGNKDLAEIIRRL* |
| Ga0102829_11895111 | 3300009026 | Estuarine | HAFKNLCYKIIVYYMHEAIKNHMCTIGNQLEQQGHKDLAEIIRRL* |
| Ga0115550_13111402 | 3300009076 | Pelagic Marine | AHYIQEGIKNHMCTICNELEKQGQTDLANIIRRL* |
| Ga0115551_13009461 | 3300009193 | Pelagic Marine | RARTKMVVAHYIQEGIKNHMCTICNELEKQGQTDLANIIRRL* |
| Ga0115548_11715843 | 3300009423 | Pelagic Marine | FRDRTKMVIAYYIQEGIKNHICTVCNELEKQGHKDLANIIRRL* |
| Ga0115545_10426661 | 3300009433 | Pelagic Marine | AQAHAFRARTKMVVAHYIQEGIKNHMCTICNELEKQGQTDLANIIRRL* |
| Ga0115546_12256831 | 3300009435 | Pelagic Marine | AHAFKDRTKMVITYYVKEGIKNHICTVCNELEKQGHKDLANIIRRI* |
| Ga0115546_12667731 | 3300009435 | Pelagic Marine | RTKMVITYYVKEGIKNHICTVCNELEKQGHKDLANIIRRL* |
| Ga0115565_100621054 | 3300009467 | Pelagic Marine | KDAARQVIGYYMREAIKNHICTVCNQLEQPGHKDLANIIRRL* |
| Ga0115568_105076861 | 3300009498 | Pelagic Marine | EQAHLFKNATQKVIFYYMNEAVKNHICTICNQLEKQGHKDLANIIRRL* |
| Ga0114914_10666931 | 3300009601 | Deep Ocean | HMIITYYMKEAINNHMCTIGNKLEAQGHKDLADIIRRL* |
| Ga0114900_11187443 | 3300009602 | Deep Ocean | IIVYYMQEAVNNHMCTICNLLEKQGHKDLANIIRRL* |
| Ga0114900_11692082 | 3300009602 | Deep Ocean | CQKVIAYYMQEAVNNHICTVCNQLEKQGQKDLANIIRRL* |
| Ga0114911_11697171 | 3300009603 | Deep Ocean | IMYYMQEAIKNHMCTICNKLEKQGHDDLAKIIRRL* |
| Ga0114901_11635841 | 3300009604 | Deep Ocean | KTAPAPIREQAHVFKETCKKVITYYMQEAVNNHMCTIGNQLEKQGQKDLANIIRRL* |
| Ga0114906_11494513 | 3300009605 | Deep Ocean | IAYYMQEAIKNHMCTIGNQLEQQGHKDLAEIIRRL* |
| Ga0114906_11580633 | 3300009605 | Deep Ocean | FRDRCKMVIAFYIQEGINNNLCTIFNQLEQQGHSDLAQIIRRL* |
| Ga0114906_13005282 | 3300009605 | Deep Ocean | AHAFRDKCKWIIQFYVREGINNHICTVCNELEKQGHSDLANIIRRL* |
| Ga0115000_104707781 | 3300009705 | Marine | TKMVVAHYIQEGIKNHTCTICNELEKQGHKDLANIIRRL* |
| Ga0098043_11100411 | 3300010148 | Marine | QAHAFKNQCHTVITYYMNEAIKNHMCTIGNQLEKQGHTDLANIIRRL* |
| Ga0098049_10382814 | 3300010149 | Marine | HAFREACKKVITYYMHEAVKNHVCTICNELEKQGQHDLANIIRRL* |
| Ga0098056_11083303 | 3300010150 | Marine | RCKWIIQFYVNEGIKNHICTVCNELEKQGHKDLANIIRRL* |
| Ga0098056_13202462 | 3300010150 | Marine | KKIIMYYMHEAVKNHICTICNQLEQQGHKDLANIIRRL* |
| Ga0098047_101568483 | 3300010155 | Marine | VKAQAHAFRDRCKWIIQFYVNEGIKNHVCTVCNELEKQGHKDLANIIRRL* |
| Ga0133547_113454261 | 3300010883 | Marine | KMVVAHYIQEGIKNHTCTICNELEKQGHKDLANIIRRL* |
| Ga0180120_104389602 | 3300017697 | Freshwater To Marine Saline Gradient | HAFRARTKMVIAHYIQEGIKNHTCTICNELEKQGHKDLANIIRRL |
| Ga0181375_10301271 | 3300017718 | Marine | QAHAFKTLCYKVVTYYMQEAIKNHMCTIGNQLEQQGHKDLANIIRRL |
| Ga0181373_10470443 | 3300017721 | Marine | IVMYYMQEAVKNHICTICNQLEQQGQKDLANIIRRL |
| Ga0181373_10510283 | 3300017721 | Marine | NSCQVIIAHYMREAIKNHMCTIGNQLESQGHKDLANIIRRL |
| Ga0181398_10728593 | 3300017725 | Seawater | PAPIRAQAHAFREACKKVITYYMNEAVKNHVCTICNELEKQGQHDLANIIRRL |
| Ga0181419_11574142 | 3300017728 | Seawater | QVIIAHYMREAIKNHMCTIGNQLEAQGHKDLAEIIRRL |
| Ga0181416_10857461 | 3300017731 | Seawater | ARTKMVVAHYIQEGIKNHTCTICNELEKQGQTDLANIIRRL |
| Ga0187222_11520462 | 3300017734 | Seawater | FREACKKVVIYYMHEAVKNHVCTICNELEKQGQHDLANIIRRL |
| Ga0181428_10956351 | 3300017738 | Seawater | QAHAFKDRTKMVITYYVKEGIKNHICTVCNELEKQGHKDLANIIRRI |
| Ga0181402_11303703 | 3300017743 | Seawater | VVTYYMKEAIKNHMCTIGNQLEQQGHSDLANIIRRL |
| Ga0181389_11541501 | 3300017746 | Seawater | VITYYVKEGIKNHICTVCNELEKQGHKDLANIIRRI |
| Ga0181389_11723822 | 3300017746 | Seawater | VKVLEFYMREAIKNHMCTIGNQLEAQGHKDLAEIIRRL |
| Ga0181393_11418031 | 3300017748 | Seawater | DRTKMVITYYVKEGIKNHICTVCNELEKQGHKDLANIIRRI |
| Ga0181420_12409411 | 3300017757 | Seawater | QVIVYYMQEAIKNHMCTIGNQLESQGHKDLANIIRRL |
| Ga0187221_11227541 | 3300017769 | Seawater | VEIKAQAHAFRARTKMVVAHYIQEGIKNHTCTICNELEKQGQTDLANIIRRL |
| Ga0181386_11983471 | 3300017773 | Seawater | EIKAQAHAFRARTKMVVAHYIQEGIKNHTCTICNELEKQGQTDLANIIRRL |
| Ga0181432_10426031 | 3300017775 | Seawater | CKKVITYYMQEAVNNHMCTIGNQLEKQGQKDLANIIRRL |
| Ga0211699_101534911 | 3300020410 | Marine | RCKSVIAFYVKEGIQNHICTACNQLEQQGHKDLANIIRRL |
| Ga0211691_103908201 | 3300020447 | Marine | KVITHYMQEAVRNHICTVCNELEKQGHKDLANIIRRL |
| Ga0222716_100368811 | 3300021959 | Estuarine Water | TKMVVAYYIQEGVKNHICTVCNELEKQGHKDLANIIRRI |
| Ga0232646_11143601 | 3300021978 | Hydrothermal Vent Fluids | IAYYMQEAVNNHMCTIGNQLEKQGQKDLANIIRRL |
| Ga0212021_11238341 | 3300022068 | Aqueous | RTKMVIAYYIKEGIENHLCTVCNELEKQGHKDLANIIRRL |
| Ga0255743_102979031 | 3300023110 | Salt Marsh | KHVITYYMNEAVKNHVCTICNELEKQGQKDLANIIRRL |
| (restricted) Ga0255047_101386823 | 3300024520 | Seawater | DDAPAPLRAQAHAFRDACKQVIMYYMQEAVKNHMCTICNKLEQQGQTDLANIIRRL |
| Ga0207878_1278151 | 3300025039 | Marine | HAFKDRCRFVIAYYMKEAINNHICTICNQLEAQGHKDLANIIRRL |
| Ga0207889_10204761 | 3300025042 | Marine | HTVITYYMQEAIKNHMCTIGNKLEQQGHKDLAEIIRRL |
| Ga0207902_10255901 | 3300025046 | Marine | AFKNACHKIIVYYMQEAINNHMCTIGNQLKKQGQQDLANIIRRL |
| Ga0207902_10334921 | 3300025046 | Marine | AFKNACYKIIVYYMQEAVNNHMCTICNQLEKQGQADLANIIRRL |
| Ga0207902_10406051 | 3300025046 | Marine | KCQKVIVYYMQEAINNHMCTIGNQLEKQGQQDLANIIRRL |
| Ga0208012_10491872 | 3300025066 | Marine | RKIIEYYMQEAVNNHMCTIGNKLDKQGQKDLANIIRRL |
| Ga0207887_10541271 | 3300025069 | Marine | FKKTCHTVISYYMQEAIKNHMCTIGNQLEAQGHKDLAEIIRRL |
| Ga0208667_10701372 | 3300025070 | Marine | KNIVSYYMQEAIKNHMCTIGNQLEQQGQKDLANIIRRL |
| Ga0208920_11091972 | 3300025072 | Marine | AQAHAFKNRCHMIITYYMQQAINNHMCTIGNKLESQGRKDLANIIRRL |
| Ga0208668_10917361 | 3300025078 | Marine | AFKNKCRMIITYYMKEAINNHMCTIGNQLESQGHKDLANIIRRL |
| Ga0208157_10966541 | 3300025086 | Marine | CKHIITYYMNEAVKNHVCTICNELEKQGQKDLANIIRRL |
| Ga0208011_10953671 | 3300025096 | Marine | YFIITFYMKEAIKNHMCTIGNELESQGHKDLANIIRRL |
| Ga0208669_10191021 | 3300025099 | Marine | HQVIVYYMQEAIKNHMCTIGNQLESQGHKDLANIIRRL |
| Ga0208669_10697481 | 3300025099 | Marine | AHAFRDACKNIVSYYMQEAIKNHMCTIGNQLEQQGQKDLANIIRRL |
| Ga0208013_10575861 | 3300025103 | Marine | KKTCQFVITYYMKEAIKNHMCTIGNQLEAQGHKDLAEIIRRL |
| Ga0208793_10364564 | 3300025108 | Marine | NSCQVIIAHYMREAIKNHMCTIGNQLEAQGHKDLAEIIRRL |
| Ga0208793_11646521 | 3300025108 | Marine | HAFKNACRQIIAYYMQEAIKNHMCTICNQLEKQGHNDLANIIRRL |
| Ga0208790_11263551 | 3300025118 | Marine | CQVIIAHYMCEAIKNHMCTIGNQLEAQGHKDLAEIIRRL |
| Ga0209644_10584483 | 3300025125 | Marine | EATQKVISYYMNEAIKNHICTICNQLEKQGHKDLANIIRRL |
| Ga0208919_11794962 | 3300025128 | Marine | PIRAQAHAFREACKKVITYYMHEAVKNHVCTICNELEKQGQHDLANIIRRL |
| Ga0209756_12411283 | 3300025141 | Marine | CRQIIMYYMQEAIKNHMCTICNKLEEQGHSDLANIIRRL |
| Ga0209337_10413311 | 3300025168 | Marine | AFKNSCQVIIAYYMREAIKNHMCTIGNQLEAQGQKDLAEIIRRL |
| Ga0207883_10153763 | 3300025216 | Deep Ocean | DPIRLQAHAFKEKCQKVIVYYMQEAVNNHMCTLCNQLEKQGQQDLATIIRRL |
| Ga0208031_10124771 | 3300025237 | Deep Ocean | VINFYMKEAIKNHMCTIGNQLEQQGHKDLANIIRRL |
| Ga0207904_10814501 | 3300025248 | Deep Ocean | KTAPAPIREQAHVFKETCKKVIAYYMQEAVNNHMCTIGNQLEKQGQKDLANIIRRL |
| Ga0208182_10052904 | 3300025251 | Deep Ocean | VITYYMQEAVNNHMCTIGNQLEKQGQKDLANIIRRL |
| Ga0208182_10738531 | 3300025251 | Deep Ocean | SDTAPMEIKAQAHAFRARTKMVVAHYIQEGIKNHMCTICNELEKQGQTDLANIIRRL |
| Ga0208032_10561593 | 3300025266 | Deep Ocean | KMVIAYYIKEGIENHLCTVCNELEKQGHKDLANIIRRL |
| Ga0208179_10490163 | 3300025267 | Deep Ocean | KTAPAPIREQAHVFKETCKKVITYYMQEAVNNHMCTIGNQLEKQGQKDLANIIRRL |
| Ga0207894_10372013 | 3300025268 | Deep Ocean | IVYYMQEAVNNHMCTICNALEKQGQKDLANIIRRI |
| Ga0208183_11068952 | 3300025274 | Deep Ocean | KMVVAHYIQEGIKNHTCTICNELEKQGHTDLANIIRRL |
| Ga0208449_10576131 | 3300025280 | Deep Ocean | HIITYYMQEAIKNHMCTIGNQLEQQGHKDLAEIIRRL |
| Ga0207903_10655612 | 3300025287 | Deep Ocean | AHAFRDACKQVISFYIQEGIKNHMCTICNQLEQQGHKDLANIIRRL |
| Ga0208934_10130031 | 3300025293 | Deep Ocean | IIVYYMQEAVNNHMCTICNLLEKQGQKDLANIIRRL |
| Ga0208934_10424931 | 3300025293 | Deep Ocean | ITYYMQEAVTNHVCTVCNILEKQGHKDLANIIRRL |
| Ga0208450_10321163 | 3300025301 | Deep Ocean | KNLCQHIITYYMQEAIKNHMCTIGNQLEQQGHKDLAEIIRRL |
| Ga0208450_10492103 | 3300025301 | Deep Ocean | RAFRELCQKVIKYYMQEAINNHICTVCNQLEKQGHKDLANIIRRL |
| Ga0208450_10872001 | 3300025301 | Deep Ocean | TQANAFRELCQKVIAYYMQEAVNNHICTVCNQLEKQGQKDLANIIRRL |
| Ga0209714_11164753 | 3300025822 | Pelagic Marine | DATRQVIGYYMREAIKNHICTVCNQLEQQGHKDLANIIRRL |
| Ga0209757_100470203 | 3300025873 | Marine | TCHTVITYYMQEAIKNHMCTIGNKLEQQGHKDLAEIIRRL |
| Ga0209757_101455051 | 3300025873 | Marine | MVIVYYMKEVVNNHICTICNQLEKQGQQDLANIIRRL |
| Ga0208641_11629721 | 3300026268 | Marine | CLFIITYYMKEAIKNHMCTIGNELESQGHKDLANIIRRL |
| Ga0209815_10483111 | 3300027714 | Marine | KDRTKMVIAYYIKEGIENHLCTVCNQLEKQGHKDLANIIRRL |
| Ga0209279_100100184 | 3300027771 | Marine | PAPIREQAHVFKETCKKVIAYYMQEAVNNHMCTIGNQLEKQGQKDLANIIRRL |
| (restricted) Ga0255053_102350181 | 3300027868 | Seawater | VAYYIQEGVKNHICTVCNELEKQGHKDLANIIRRI |
| Ga0256381_10109152 | 3300028018 | Seawater | IREQAHAFEEVCKKVIAYYMQQAVNNHICTICNLLEKQGQKDLANIIRRL |
| Ga0257107_12390851 | 3300028192 | Marine | DMATDKIISISDTAPAPIREQAHVFKETCKKVIAYYMQEAVNNHMCTICNLLEKQGQKDLANIIRRL |
| Ga0256383_1096973 | 3300028448 | Seawater | FEKVCKKVIVYYMQEAVNNHICTVCNQLEKQGQKDLANIIRRL |
| Ga0310345_101326381 | 3300032278 | Seawater | VIMYYMQEAVNNHICTICNQLENQGQKDLANIIRRL |
| Ga0315334_106119921 | 3300032360 | Seawater | AQAHAFKNKCHLIITHYIQEAIKNHMCTIGNQLEAQGNKDLAEIIRRL |
| Ga0316204_102786881 | 3300032373 | Microbial Mat | PIRAQAHAFREACKHIITYYMNEAIKNHVCTICNELEKQGQKDLANIIRRL |
| Ga0310342_1010972881 | 3300032820 | Seawater | PAPIREQAHVFKETCKKVITYYMQEAVNNHMCTIGNQLEKQGQKDLANIIRRL |
| Ga0310342_1019125103 | 3300032820 | Seawater | CRTVITYYMQEAIKNHMCTIGNQLEQQGHKDLAEIIRRL |
| Ga0314858_059919_2_121 | 3300033742 | Sea-Ice Brine | CKQVISFYIQEGIKNHMCTIYNQLEKQGHKDLANIIRRL |
| Ga0314858_065788_23_178 | 3300033742 | Sea-Ice Brine | MIKAQAHAFKDRTKMVVAHYIQEGIKNHLCTVCNELEKQGHKDLANIIRRI |
| Ga0314858_139049_508_621 | 3300033742 | Sea-Ice Brine | MVIAYYVQEGIKNHICTVCNELEKQGHKDLANIIRRL |
| Ga0348335_021974_1_111 | 3300034374 | Aqueous | VVADYIQEGIKNHTCTICNELEKQGQTDLANIIRRL |
| Ga0348335_142697_1_156 | 3300034374 | Aqueous | MIKAQAHAFRDRTKMVIAYYIQEGIKNHICTVCNELEKQGHKDLANIIRRL |
| ⦗Top⦘ |