NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F040074

Metagenome / Metatranscriptome Family F040074

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040074
Family Type Metagenome / Metatranscriptome
Number of Sequences 162
Average Sequence Length 46 residues
Representative Sequence MQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEIFKRLA
Number of Associated Samples 130
Number of Associated Scaffolds 162

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 26.54 %
% of genes near scaffold ends (potentially truncated) 63.58 %
% of genes from short scaffolds (< 2000 bps) 79.63 %
Associated GOLD sequencing projects 122
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.383 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(9.877 % of family members)
Environment Ontology (ENVO) Unclassified
(27.160 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.272 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.67%    β-sheet: 0.00%    Coil/Unstructured: 65.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 162 Family Scaffolds
PF03449GreA_GreB_N 31.48
PF01850PIN 3.09
PF03965Penicillinase_R 2.47
PF00072Response_reg 1.85
PF01638HxlR 1.85
PF00849PseudoU_synth_2 1.85
PF13620CarboxypepD_reg 1.23
PF12704MacB_PCD 1.23
PF14026DUF4242 1.23
PF03466LysR_substrate 1.23
PF00990GGDEF 0.62
PF13181TPR_8 0.62
PF01272GreA_GreB 0.62
PF12543DUF3738 0.62
PF16499Melibiase_2 0.62
PF07969Amidohydro_3 0.62
PF02780Transketolase_C 0.62
PF13006Nterm_IS4 0.62
PF09411PagL 0.62
PF028262-Hacid_dh_C 0.62
PF16655PhoD_N 0.62
PF07676PD40 0.62
PF00069Pkinase 0.62
PF13669Glyoxalase_4 0.62
PF01182Glucosamine_iso 0.62
PF01527HTH_Tnp_1 0.62
PF12867DinB_2 0.62
PF07519Tannase 0.62
PF04295GD_AH_C 0.62
PF09423PhoD 0.62
PF04365BrnT_toxin 0.62
PF02211NHase_beta 0.62
PF00873ACR_tran 0.62
PF13857Ank_5 0.62
PF05016ParE_toxin 0.62
PF03551PadR 0.62
PF13489Methyltransf_23 0.62
PF08281Sigma70_r4_2 0.62
PF02545Maf 0.62
PF08327AHSA1 0.62
PF13689DUF4154 0.62
PF03050DDE_Tnp_IS66 0.62
PF02033RBFA 0.62
PF02696SelO 0.62
PF07992Pyr_redox_2 0.62
PF03750Csm2_III-A 0.62
PF13360PQQ_2 0.62
PF02954HTH_8 0.62
PF13643DUF4145 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 162 Family Scaffolds
COG0782Transcription elongation factor, GreA/GreB familyTranscription [K] 32.10
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 3.09
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.47
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 2.47
COG3682Transcriptional regulator, CopY/TcrY familyTranscription [K] 2.47
COG0564Pseudouridine synthase RluA, 23S rRNA- or tRNA-specificTranslation, ribosomal structure and biogenesis [J] 1.85
COG1187Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605Translation, ribosomal structure and biogenesis [J] 1.85
COG03636-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminaseCarbohydrate transport and metabolism [G] 0.62
COG0397Protein adenylyltransferase (AMPylase) SelO/YdiU (selenoprotein O)Posttranslational modification, protein turnover, chaperones [O] 0.62
COG04247-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamilySecondary metabolites biosynthesis, transport and catabolism [Q] 0.62
COG0858Ribosome-binding factor RbfATranslation, ribosomal structure and biogenesis [J] 0.62
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.62
COG2721Altronate dehydrataseCarbohydrate transport and metabolism [G] 0.62
COG2929Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin systemDefense mechanisms [V] 0.62
COG3436TransposaseMobilome: prophages, transposons [X] 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.38 %
UnclassifiedrootN/A0.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001593|JGI12635J15846_10266667All Organisms → cellular organisms → Bacteria → Acidobacteria1090Open in IMG/M
3300002245|JGIcombinedJ26739_100255539All Organisms → cellular organisms → Bacteria1639Open in IMG/M
3300003369|JGI24140J50213_10083855All Organisms → cellular organisms → Bacteria1077Open in IMG/M
3300004479|Ga0062595_100024123All Organisms → cellular organisms → Bacteria2373Open in IMG/M
3300005213|Ga0068998_10122163All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium601Open in IMG/M
3300005328|Ga0070676_11067891All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium609Open in IMG/M
3300005329|Ga0070683_100468566All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1203Open in IMG/M
3300005335|Ga0070666_10386717All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300005436|Ga0070713_102072336All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300005538|Ga0070731_10716625All Organisms → cellular organisms → Bacteria → Acidobacteria665Open in IMG/M
3300005614|Ga0068856_100702530All Organisms → cellular organisms → Bacteria → Acidobacteria1031Open in IMG/M
3300005614|Ga0068856_102146570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. HDW15A568Open in IMG/M
3300005616|Ga0068852_100993642All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300005617|Ga0068859_101978811All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium643Open in IMG/M
3300005841|Ga0068863_100032702All Organisms → cellular organisms → Bacteria4956Open in IMG/M
3300005921|Ga0070766_10428147All Organisms → cellular organisms → Bacteria → Acidobacteria871Open in IMG/M
3300006052|Ga0075029_100333216Not Available975Open in IMG/M
3300006052|Ga0075029_100969575All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6586Open in IMG/M
3300006059|Ga0075017_100168802All Organisms → cellular organisms → Bacteria1568Open in IMG/M
3300006059|Ga0075017_101681535All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300006162|Ga0075030_100777525All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300006638|Ga0075522_10569812All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae519Open in IMG/M
3300007521|Ga0105044_10670557All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300007799|Ga0105049_10083038All Organisms → cellular organisms → Bacteria3098Open in IMG/M
3300009089|Ga0099828_11335739All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300009093|Ga0105240_11044007All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300009177|Ga0105248_10118687All Organisms → cellular organisms → Bacteria2984Open in IMG/M
3300009521|Ga0116222_1508143All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium528Open in IMG/M
3300009545|Ga0105237_10741108All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. dw_53989Open in IMG/M
3300009551|Ga0105238_10222127All Organisms → cellular organisms → Bacteria1865Open in IMG/M
3300009764|Ga0116134_1080104All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1202Open in IMG/M
3300010341|Ga0074045_10116301All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1838Open in IMG/M
3300010379|Ga0136449_100029934All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia13242Open in IMG/M
3300010379|Ga0136449_104452731All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300011069|Ga0138592_1044969All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium501Open in IMG/M
3300012353|Ga0137367_10222824All Organisms → cellular organisms → Bacteria → Acidobacteria1361Open in IMG/M
3300012362|Ga0137361_11385886All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300012925|Ga0137419_11660635All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales544Open in IMG/M
3300012925|Ga0137419_11673421All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300013297|Ga0157378_11212726All Organisms → cellular organisms → Bacteria → Proteobacteria794Open in IMG/M
3300014162|Ga0181538_10414859All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium716Open in IMG/M
3300014168|Ga0181534_10451052All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300014168|Ga0181534_10765030All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300014169|Ga0181531_10010443All Organisms → cellular organisms → Bacteria5342Open in IMG/M
3300014169|Ga0181531_10878535All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300014199|Ga0181535_10430264All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300014200|Ga0181526_10081932All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia vietnamiensis2057Open in IMG/M
3300014200|Ga0181526_10579221All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium709Open in IMG/M
3300014201|Ga0181537_10058222All Organisms → cellular organisms → Bacteria2617Open in IMG/M
3300014491|Ga0182014_10236027All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium968Open in IMG/M
3300014491|Ga0182014_10389665All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium697Open in IMG/M
3300014492|Ga0182013_10320900All Organisms → cellular organisms → Bacteria → Acidobacteria860Open in IMG/M
3300014492|Ga0182013_10429897All Organisms → cellular organisms → Bacteria → Acidobacteria702Open in IMG/M
3300014493|Ga0182016_10104769All Organisms → cellular organisms → Bacteria1994Open in IMG/M
3300014493|Ga0182016_10436750All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium768Open in IMG/M
3300014499|Ga0182012_10114592All Organisms → cellular organisms → Bacteria → Acidobacteria1999Open in IMG/M
3300014499|Ga0182012_10238559All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1254Open in IMG/M
3300014499|Ga0182012_10334508All Organisms → cellular organisms → Bacteria → Acidobacteria1013Open in IMG/M
3300014501|Ga0182024_12674007All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium534Open in IMG/M
3300014501|Ga0182024_12891496All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300014501|Ga0182024_12925869All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300014838|Ga0182030_10047954All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6887Open in IMG/M
3300014838|Ga0182030_10145274All Organisms → cellular organisms → Bacteria → Proteobacteria3037Open in IMG/M
3300014838|Ga0182030_10491795All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1229Open in IMG/M
3300014838|Ga0182030_10804222All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium859Open in IMG/M
3300014839|Ga0182027_10844761All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4953Open in IMG/M
3300017792|Ga0163161_10717486All Organisms → cellular organisms → Bacteria → Acidobacteria834Open in IMG/M
3300017927|Ga0187824_10131180All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium822Open in IMG/M
3300017946|Ga0187879_10166634All Organisms → cellular organisms → Bacteria → Acidobacteria1242Open in IMG/M
3300017948|Ga0187847_10149364All Organisms → cellular organisms → Bacteria → Acidobacteria1277Open in IMG/M
3300017988|Ga0181520_10681502All Organisms → cellular organisms → Bacteria → Acidobacteria704Open in IMG/M
3300018030|Ga0187869_10252791All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium853Open in IMG/M
3300018034|Ga0187863_10827885All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300018040|Ga0187862_10003116All Organisms → cellular organisms → Bacteria16395Open in IMG/M
3300021181|Ga0210388_10357525All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1284Open in IMG/M
3300021433|Ga0210391_10103603All Organisms → cellular organisms → Bacteria2242Open in IMG/M
3300021433|Ga0210391_10949039All Organisms → cellular organisms → Bacteria → Acidobacteria670Open in IMG/M
3300021433|Ga0210391_11077832All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300021477|Ga0210398_11056162All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300022872|Ga0224526_1008148All Organisms → cellular organisms → Bacteria2719Open in IMG/M
3300024295|Ga0224556_1192084All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium500Open in IMG/M
3300025576|Ga0208820_1053794All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1112Open in IMG/M
3300025703|Ga0208357_1027635All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2049Open in IMG/M
3300025903|Ga0207680_10447776All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300025909|Ga0207705_11016400All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300025912|Ga0207707_10081560All Organisms → cellular organisms → Bacteria → Acidobacteria2824Open in IMG/M
3300025913|Ga0207695_11136634All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300025914|Ga0207671_10734023All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. dw_53785Open in IMG/M
3300025924|Ga0207694_11020377All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300025928|Ga0207700_11552320All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300025931|Ga0207644_11390605All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium589Open in IMG/M
3300025986|Ga0207658_12015205All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium525Open in IMG/M
3300026078|Ga0207702_10617885All Organisms → cellular organisms → Bacteria → Acidobacteria1064Open in IMG/M
3300026078|Ga0207702_11536721All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300026088|Ga0207641_10063097All Organisms → cellular organisms → Bacteria → Acidobacteria3164Open in IMG/M
3300026358|Ga0257166_1055229All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300026555|Ga0179593_1044726All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2384Open in IMG/M
3300027432|Ga0209421_1003775All Organisms → cellular organisms → Bacteria2776Open in IMG/M
3300027629|Ga0209422_1106238All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300027803|Ga0209910_10048305All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium518Open in IMG/M
3300027842|Ga0209580_10233995All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium913Open in IMG/M
3300027879|Ga0209169_10214588All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa1007Open in IMG/M
3300027882|Ga0209590_11057678All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300027905|Ga0209415_10034578All Organisms → cellular organisms → Bacteria → Acidobacteria7107Open in IMG/M
3300028068|Ga0255355_1005373All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis3910Open in IMG/M
3300028574|Ga0302153_10008968All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3461Open in IMG/M
3300028648|Ga0268299_1063470All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-41141Open in IMG/M
3300028766|Ga0302269_1017317All Organisms → cellular organisms → Bacteria → Acidobacteria2476Open in IMG/M
3300028783|Ga0302279_10032848All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3480Open in IMG/M
3300028785|Ga0302201_10424606All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium513Open in IMG/M
3300028789|Ga0302232_10484617All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium608Open in IMG/M
3300028798|Ga0302222_10006754All Organisms → cellular organisms → Bacteria4835Open in IMG/M
3300028867|Ga0302146_10032332All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2328Open in IMG/M
3300029918|Ga0302143_1135187All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300029919|Ga0302141_1006171All Organisms → cellular organisms → Bacteria → Proteobacteria3347Open in IMG/M
3300029922|Ga0311363_10508380All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1223Open in IMG/M
3300029922|Ga0311363_11398015All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium570Open in IMG/M
3300029951|Ga0311371_10510329All Organisms → cellular organisms → Bacteria1582Open in IMG/M
3300029951|Ga0311371_11375440All Organisms → cellular organisms → Bacteria → Acidobacteria797Open in IMG/M
3300029954|Ga0311331_11583548All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300029955|Ga0311342_11062946All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium594Open in IMG/M
3300029994|Ga0302283_1263606All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium612Open in IMG/M
3300029997|Ga0302302_1237825All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300030000|Ga0311337_11201947All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales663Open in IMG/M
3300030011|Ga0302270_10461942All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4668Open in IMG/M
3300030054|Ga0302182_10149891All Organisms → cellular organisms → Bacteria → Acidobacteria1009Open in IMG/M
3300030057|Ga0302176_10074096All Organisms → cellular organisms → Bacteria → Acidobacteria1317Open in IMG/M
3300030518|Ga0302275_10117642All Organisms → cellular organisms → Bacteria → Acidobacteria1733Open in IMG/M
3300030520|Ga0311372_10077698All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6198Open in IMG/M
3300030617|Ga0311356_11443134All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium624Open in IMG/M
3300030688|Ga0311345_10850923All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium707Open in IMG/M
3300031232|Ga0302323_101111542All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium881Open in IMG/M
3300031234|Ga0302325_10256478All Organisms → cellular organisms → Bacteria2903Open in IMG/M
3300031249|Ga0265339_10164102All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1116Open in IMG/M
3300031250|Ga0265331_10010414All Organisms → cellular organisms → Bacteria → Acidobacteria5147Open in IMG/M
3300031261|Ga0302140_10553162All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium877Open in IMG/M
3300031261|Ga0302140_10651188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes780Open in IMG/M
3300031344|Ga0265316_11160520All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300031524|Ga0302320_10739503All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300031524|Ga0302320_11034638All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300031525|Ga0302326_12307178All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium683Open in IMG/M
3300031525|Ga0302326_12362607All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium672Open in IMG/M
3300031525|Ga0302326_12406969All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium664Open in IMG/M
3300031525|Ga0302326_13302680All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium542Open in IMG/M
3300031708|Ga0310686_100778751All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium643Open in IMG/M
3300031708|Ga0310686_102807215All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella pectinivorans1300Open in IMG/M
3300031708|Ga0310686_114283486All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300031708|Ga0310686_119135165All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium598Open in IMG/M
3300031716|Ga0310813_11204803All Organisms → cellular organisms → Bacteria → Acidobacteria697Open in IMG/M
3300031823|Ga0307478_11076501All Organisms → cellular organisms → Bacteria → Acidobacteria671Open in IMG/M
3300031902|Ga0302322_101637306All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium787Open in IMG/M
3300032160|Ga0311301_10000754All Organisms → cellular organisms → Bacteria → Acidobacteria124780Open in IMG/M
3300032456|Ga0335394_10084128All Organisms → cellular organisms → Bacteria → Proteobacteria3346Open in IMG/M
3300032456|Ga0335394_10890325All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium622Open in IMG/M
3300032805|Ga0335078_10739282All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41211Open in IMG/M
3300032829|Ga0335070_10000451All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae45536Open in IMG/M
3300032892|Ga0335081_10255091All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium2364Open in IMG/M
3300032893|Ga0335069_10797242All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1064Open in IMG/M
3300033433|Ga0326726_10417507All Organisms → cellular organisms → Bacteria → Acidobacteria1274Open in IMG/M
3300033475|Ga0310811_10288447All Organisms → cellular organisms → Bacteria1902Open in IMG/M
3300033822|Ga0334828_117125All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium641Open in IMG/M
3300034163|Ga0370515_0280370All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium705Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog9.88%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.64%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog8.02%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog6.17%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.70%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.70%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.70%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.70%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.09%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.09%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.09%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater2.47%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.47%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.47%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.47%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.85%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.85%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.23%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.23%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.23%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.23%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.23%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.62%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.62%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.62%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.62%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.62%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.62%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.62%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.62%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003369Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22AEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005213Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300007521Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01EnvironmentalOpen in IMG/M
3300007799Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011069Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300022872Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025703Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026358Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-BEnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027803Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712S3SEnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028068Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T75EnvironmentalOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028648Activated sludge microbial communities from bioreactor in Nijmegen, Gelderland, Netherland - NOB reactorEngineeredOpen in IMG/M
3300028766Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2EnvironmentalOpen in IMG/M
3300028783Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028867Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3EnvironmentalOpen in IMG/M
3300029918Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1EnvironmentalOpen in IMG/M
3300029919Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029994Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4EnvironmentalOpen in IMG/M
3300029997Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030011Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3EnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032456Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (spades assembly)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033822Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12635J15846_1026666713300001593Forest SoilMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEI
JGIcombinedJ26739_10025553913300002245Forest SoilMQRESRRQCCLKINLFSGDGVLEIQKLGMQEISSIAREAGEIFQ
JGI24140J50213_1008385533300003369Arctic Peat SoilLIPPVDLLMQRETGRQNCLKIDLFSGDGVVEFQKLGVQEISSIAGEAG
Ga0062595_10002412333300004479SoilMQSEPSRQSCLKIDLFSGDGAVEIQKVGVQEISSIAREAGKIFKRLSG*
Ga0068998_1012216323300005213Natural And Restored WetlandsLIPAVNLLVQGESRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEIFQRLAS*
Ga0070676_1106789123300005328Miscanthus RhizosphereMQSESGRQSCLKIDLFSGDGMLEFQILGVQEISSIAGEAGEI
Ga0070683_10046856613300005329Corn RhizosphereLILDVNLLMQCESGRQRCLKIDLFSGDGVVEFQKLGVEEISSIAGEAGEIFQRLAV*
Ga0070666_1038671713300005335Switchgrass RhizosphereMQWESGRQSCLKIDLFSGDGVAEFQILGVQEISSIAGEAGE
Ga0070713_10207233623300005436Corn, Switchgrass And Miscanthus RhizosphereMQWGSRRQSCLKIDLFSGDGVVEFEILGVQEISSIAGEAGEIFKRLAG*
Ga0070731_1071662523300005538Surface SoilMQWESRRQSCLKIDLFSSDGVVEFQILGVQEISSIAGEAGEILK
Ga0068856_10070253023300005614Corn RhizosphereMQRESRWQRCLKVDLFSADGVLKFQILGVEEISSIAGEAGEIFK
Ga0068856_10214657013300005614Corn RhizosphereMPLLMQSEPSRQSCLKIDLFSGDGAVEIQKVGVQEISSIAREAGKIFKRLSG*
Ga0068852_10099364233300005616Corn RhizosphereMRWEFRRQRRVQIDLFSGDGVGEFQILGVQEISSIAGEAGEIFK
Ga0068859_10197881113300005617Switchgrass RhizosphereMQWESGRQSCLKIDLFSGDGVMEFQILGVEEISSIAGEAGEIFKRLAG*
Ga0068863_10003270253300005841Switchgrass RhizosphereMRRESGWQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEIFKRLAG*
Ga0070766_1042814713300005921SoilMEWGSRRQRCLKIDLFSSDGVVEFQILGVQEISSIAGEAGE
Ga0075029_10033321613300006052WatershedsMQSESGRQSCLKIDFFSGDGVLEIQKLRVQEISSIAREAGEIFKRLSG
Ga0075029_10096957523300006052WatershedsVNLLLQWESGRQGCLEIDLLSGDGMMESQKLGVQEISSIAGEAGKVFKRL
Ga0075017_10016880233300006059WatershedsMQQEPRRQSCRKIDLFSGDGVLEIQKLGMQEISSIARE
Ga0075017_10168153523300006059WatershedsMQWGSRWQSCLKIDLFSGDGVVEFEILGVQEISSIAGEAGEIFKRLAG*
Ga0075030_10077752523300006162WatershedsVGSGGYFIDSWKSRRQSGLKIDLFSGEGVVEFQIVGVQEITSVAWEAGEIFKRLAG*
Ga0075522_1056981213300006638Arctic Peat SoilVNLLVQGESGRQRCFKIDLFSGDGVAEFQILGVQEISSIAGEAG
Ga0105044_1067055733300007521FreshwaterLLLQRESRRQSCLKMDWFSGDGVVEFQILGVQEISSVAGAAGEIFKRLAG*
Ga0105049_1008303833300007799FreshwaterLRAVKLLLQFESGRQSCLKMDLFSGDGVAEFQILGVQEISSIAGEAGEIFKRLAG*
Ga0099828_1133573913300009089Vadose Zone SoilMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEA
Ga0105240_1104400733300009093Corn RhizosphereMQWESRRQRCLKIDWFAGDGVVEFQILGVQEISSIAGKAGEIF
Ga0105248_1011868743300009177Switchgrass RhizosphereMQWESGRQSCLKIDLFSGDGVMEFQILGVEEISSIAGEAGEIFK
Ga0116222_150814323300009521Peatlands SoilLIPAVNLLMQWGSRRQSCLKIDLFSGDGVVEFEILGVQEISSIAGEAGEIFKR
Ga0105237_1074110833300009545Corn RhizosphereMQQESRRQSCLNIDLFSLDGVWEIQKFGVQEISSVAREAG
Ga0105238_1022212733300009551Corn RhizosphereMQWESRRQRCLKIDWFAGDGVVEFQILGVQEIASITGEAGEIFERLAVQAIQR
Ga0116134_108010413300009764PeatlandMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEILKRLAG*
Ga0074045_1011630123300010341Bog Forest SoilMNLLLQSESARQSCLKIDLFSGNGMLEIKKLGVQEISSIAREAGEIFKRLSG*
Ga0136449_100029934133300010379Peatlands SoilMQSESGRQSCLQIDLFSGDGVVEFQKLGVQEISSIAGEAGEIFQRPAR*
Ga0136449_10445273123300010379Peatlands SoilMQWESSRQSCLKIDLFSGDWVVEFQILGVQEISSIAGEAG
Ga0138592_104496913300011069Peatlands SoilMQWESIRQSCLKIDLFSGDGVVEFQILGVQEISPIAGEAGEILKRLAG*
Ga0137367_1022282413300012353Vadose Zone SoilESRRQSCLKIDLFSGDGVLEIQKLGVQEISSIAREAGEIFKRLAG*
Ga0137361_1138588623300012362Vadose Zone SoilMQWESRRQSCLKIDLFSGDGLVEFQILGVEKISSIAG
Ga0137419_1166063523300012925Vadose Zone SoilMQQESRRQSCLKIDWFSGDGVVEIQKLGMQQISSIAGEAG
Ga0137419_1167342123300012925Vadose Zone SoilMQWGSRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEIFKRL
Ga0157378_1121272613300013297Miscanthus RhizosphereLLVQQSVGQSCLKIHRLSGDGVGEFQELGVQEISSIAWEAWEVFKRLA
Ga0181538_1041485913300014162BogMQWGSGRQRGLKIDLFSCDGVVEFQILGVQEISSIAGEAREILKRLAG*
Ga0181534_1045105223300014168BogMKPGRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEIFKRLAG*
Ga0181534_1076503013300014168BogMQWESGRQGCLKIDLFSGDGVVEFQELGVQEISSIAGEAGEIFKRLAG
Ga0181531_1001044313300014169BogMQWESRRQSCFKIDLFSRDGVMEFQILGMQEISSIAGEAGEIFQRLAG*
Ga0181531_1087853513300014169BogMQRKSRRQSCLKIDLFSGDGMLEIQKLGVQEISSIAREAGEIFKRL
Ga0181535_1043026413300014199BogMQRESGRQSCLKIDLFSGDGVVEFQKLGVQEISSIAGEAG
Ga0181526_1008193223300014200BogMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEIFKRLAG*
Ga0181526_1057922113300014200BogSRRQSCLKINLFSGDGVAEFQKLGMQEISSIAREAGEIFKRLAG*
Ga0181537_1005822213300014201BogMQWESRRQSCFKIDLFSRDGVMEFQILGMQEISSIAGEAGE
Ga0182014_1023602723300014491BogESRRQSCLKIDLFSGDGVVEFQKLGVQEISSISREAGEIFKRLAG*
Ga0182014_1038966513300014491BogMQAESVGQSCLKMDFFSGDGVLEIQKLGVQQISSVAGEAGEIFNWLSVYA
Ga0182013_1032090013300014492BogMQSESGRQSCLKIDLFSGDGVVEFQKLGVQEISSIAGEAGEIFK
Ga0182013_1042989713300014492BogMQGESARQSCLKIDLFSGDGVVEFQKLGVQEISSIAGKAGEIFKRLAG
Ga0182016_1010476933300014493BogMTQSESGWQSCLKMDLFSGDGVVEFQKLGVQEISSIAREAGEIFKRLAG*
Ga0182016_1043675023300014493BogMQCESGRQRRLKIDLFSGDGVMELQKLGVQEISSIAGEAGENFERLAG*
Ga0182012_1011459213300014499BogMQWESRRQRCLKIDLFSGDGVVEFQILGVQEISSI
Ga0182012_1023855913300014499BogMQWQSCLKIDLFSGDGVLEFQKLGVQKISSIAGEAG
Ga0182012_1033450823300014499BogMQSESGRQSCLKIDLFSGDGVVEFQKLGVQEISSIAGEAGEIFKRLAG*
Ga0182024_1267400713300014501PermafrostMQWECGRQRCLKIDLFSGDRMPEFQILGMQEISSIAVK
Ga0182024_1289149623300014501PermafrostMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSIA
Ga0182024_1292586923300014501PermafrostMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAG
Ga0182030_1004795413300014838BogMQCEPRRQLCLKIDLFSGDGVEKIQKLRVQKISSVAWQARKIFKRLAA*
Ga0182030_1014527463300014838BogMQWQSRLKMDLFSGDGVLEFQELGVQEISSIAGEA
Ga0182030_1049179513300014838BogMRWESGRQYSLEMDWFSGDGVVEFQILGVQEISSIAGEAGEI
Ga0182030_1080422213300014838BogMQWESRRQRCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEIFKRL
Ga0182027_1084476113300014839FenMQWESGRQSCLKIDLFSGDGVVEFQKLGVQEISSIAGEAGE
Ga0163161_1071748613300017792Switchgrass RhizosphereMQWESGRQSCLKIDLFSGDGVLEFQKLGVQEISSIAGEAGEIFKRLAG
Ga0187824_1013118023300017927Freshwater SedimentLSSKRESSGQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEIFKRLAG
Ga0187879_1016663413300017946PeatlandMQWEPRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEI
Ga0187847_1014936423300017948PeatlandMQWESRRQSCLKIDLFSGDGVVEFQELGVQEISSIAGEAGEIFKR
Ga0181520_1068150213300017988BogMQWESRRQRCLKIDLFSGDGVVEFQILGVQEISSIAGE
Ga0187869_1025279113300018030PeatlandMQWESRRQSCLKIDLFSGDGVVEFQELGVQEISSIAGEAGEIFKRLAG
Ga0187863_1082788523300018034PeatlandMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEILKRLA
Ga0187862_1000311613300018040PeatlandMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEILKRLAG
Ga0210388_1035752513300021181SoilMQRESRRQSCLKIDLFSGDGVFKFQKLGVQEISSIAREAGEIFERLAGYAIQRIAYQRMA
Ga0210391_1010360333300021433SoilMQRESTRQSRLKLDFFSGDGVVEIQKLGVQEISSIAREAGEIFK
Ga0210391_1094903913300021433SoilMQWESRWQRCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEIFKRL
Ga0210391_1107783223300021433SoilMEWGSRRQRCLKIDLFSSDGVVEFQILGVQEISSIAGEAGEIF
Ga0210398_1105616213300021477SoilMEWGSRRQRCLKIDLFSSDGVVEFQILGVQEISSIAGEAGEMFKRLAG
Ga0224526_100814833300022872SoilMQCEPRRQLCLKIDLFSGDGVEKIQKLRVQKISSVAWQARKIFKRLAA
Ga0224556_119208423300024295SoilMQWESRRQSCLKIDLFSGDGVVEFQKLGVQEISSIAGEAGEIFKRLAG
Ga0208820_105379423300025576PeatlandMQWESRRQSCLKIDLFSGDGVVEFQKLGVQEISSIAREAGEIFKRLAG
Ga0208357_102763513300025703Arctic Peat SoilMQRASRRQSRLKLDLFSGDGVLKFQKLGVQKIPSIPRQPGEIFKRLAAYAVQRIAYQG
Ga0207680_1044777613300025903Switchgrass RhizosphereMQWESGRQSCLKIDLFSGDGVAEFQILGVQEISSIAGEAGEIFKR
Ga0207705_1101640023300025909Corn RhizosphereMRWEFRRQRRVQIDLFSGDGVAEFQILGVQEIASIAGEAGEIFKGL
Ga0207707_1008156013300025912Corn RhizosphereMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSI
Ga0207695_1113663413300025913Corn RhizosphereMRWEFRRQRRVQIDLFSGDGVAEFQILGVQEIASIA
Ga0207671_1073402323300025914Corn RhizosphereVNLSMQQESRRQSCLNIDLFSLDGVWEIQKFGVQEISSVAREAG
Ga0207694_1102037723300025924Corn RhizosphereMHWESRRQSCLKIDSLSGDGVLKVEISRVQEVSSIAGQAGE
Ga0207700_1155232023300025928Corn, Switchgrass And Miscanthus RhizosphereMQWGSRRQSCLKIDLFSGDGVVEFQKLGVQEISSIAGEARQIFKRLAG
Ga0207644_1139060513300025931Switchgrass RhizosphereMQRESRRQSCLKIDLFPGDGVVEFQILGVEEISSIAG
Ga0207658_1201520513300025986Switchgrass RhizosphereMRRESGRQSCLKIDLFSSDGVVKFQVLGVEEISSIARKAGE
Ga0207702_1061788513300026078Corn RhizosphereMNLLMQWESGWQSCLKIDLFSGDGVVEFQILGVQEITSIAGEA
Ga0207702_1153672123300026078Corn RhizosphereMQSEPSRQSCLKIDLFSGDGAVEIQKVGVQEISSIAREAGKIFKRLSG
Ga0207641_1006309723300026088Switchgrass RhizosphereMRRESGWQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEIFKRLAG
Ga0257166_105522913300026358SoilMQWESRRQSRLKIDLFSGDGVVEFQKLGVQEISSIAREAGEIFKRL
Ga0179593_104472643300026555Vadose Zone SoilMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGDAGEILKRLAG
Ga0209421_100377513300027432Forest SoilMQWESGRQSCLKIDLFSADGVVEFQKLGVQKISPIAGEAGC
Ga0209422_110623823300027629Forest SoilMQWESRRQSCLKIDLFSGDGVVEFQKLGVQEISSIAGEAGENFKRLAG
Ga0209910_1004830513300027803Thawing PermafrostMWGAVLALTVQWESRRQSCLKIDLFRGDGVVEFQILGMQEISSIAGEAGEILKRPAG
Ga0209580_1023399513300027842Surface SoilMQWESRRQSCLKIDLFSGDGVVEFEILGVQEISSIAGEAGEIFERLAG
Ga0209169_1021458823300027879SoilMQWESGRQSCLKIDRFSGDGVVEFQKLGVQEISSIAGEAGEIFKRLAG
Ga0209590_1105767823300027882Vadose Zone SoilMQWESGRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEIFKR
Ga0209415_1003457873300027905Peatlands SoilMLWESRRQSCLKIDFFSGGGVVEFQILGVQEISSIAGEAGEILK
Ga0255355_100537353300028068SoilLIPAVNLLMQSESGRQSCLKMDFFSGDGVLEFQKLGVQQISSIAGESGEIFKRLAV
Ga0302153_1000896873300028574BogMQWQSRLKMDLFSGDGVLEFQELGVQEISSIAGEAGEI
Ga0268299_106347023300028648Activated SludgeVNLLMQWEPGRQGCLKIDLFSGDGLVKSQILGVQEISSIAGEAW
Ga0302269_101731713300028766BogLLAVGVREESGRQSCLKIDLFSGDGVVEFEELGVQEVSSIAGKAGEIFKRLTG
Ga0302279_1003284813300028783BogMQWQSRLKMDLFSGDGVLEFQELGVQEISSIAGEAGEIFNRLAA
Ga0302201_1042460613300028785BogRQSCLKIDLFSGDGVLEFQKLGVQKISSIAGEAGEIFKRLAA
Ga0302232_1048461723300028789PalsaVNLLMQWESGRQGCLKIDLFSGDGVKEFQKLRVQKISSIAGEAGEIFKRLAG
Ga0302222_1000675463300028798PalsaMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEILKEAGRL
Ga0302146_1003233213300028867BogMQWQSCLKIDLFSGDGVLEFQKLGVQKISSIAGEAGEIFKRLAGWAVQRIANQGVA
Ga0302143_113518713300029918BogMHCESRRQSCLKIDLFSGDGVVEIQKLGVQEISSIAREAGEIFKRRP
Ga0302141_100617113300029919BogMQWQSRLKMDLFSGDGVLEFQELGVQEISSIAGEAG
Ga0311363_1050838023300029922FenMQCESGRQRRLKIDLFSGDGVMELQKLGVQEISSIAGEAGENFERLAG
Ga0311363_1139801513300029922FenMNLLMQAESGRQSCLKMDLLSSDGMLEIQKLGVQKISSIAGEAGTIIKWLAV
Ga0311371_1051032933300029951PalsaMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGE
Ga0311371_1137544013300029951PalsaMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEILKR
Ga0311331_1158354823300029954BogVNLLLQQESRRQSCLKIDLFAGDGVVEFQKLGVQEISSIAGEA
Ga0311342_1106294633300029955BogMQSESRRQSRLEIDLFSGDGVLEFQILGVQQISSVAGEAGKIFKRLAGYAVQRIANQGMA
Ga0302283_126360613300029994FenSLAVGDRGEPSRQSCLEIDLFSGDGVVESQKLGVQEISSIAGETGEIFERLAG
Ga0302302_123782523300029997PalsaVNLLMQWESGRQGCLKIDLFSGDGVVEFQKLRVQKISSIAGEA
Ga0311337_1120194713300030000FenMQRKFRRQSCLKVDLFSGDGVLELQKLGVQEISSVAGKAGEIFERLA
Ga0302270_1046194223300030011BogLIPAVNLPMQCESGRQRRLKIDFFSGDGVMELQKLGVQEISSIAGEAGENFERLAG
Ga0302182_1014989133300030054PalsaMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEILKEAGRLS
Ga0302176_1007409633300030057PalsaMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSVAGEAGEILKRLAG
Ga0302275_1011764233300030518BogLLAVGVREESGRQSCLKIDLFSGDGVVEFEELGVQEVSS
Ga0311372_1007769863300030520PalsaVNLLMQWESGGQSCLKLDLFSGDGVVEFQKLSVQKISSISR
Ga0311356_1144313413300030617PalsaMQGKSRRQSCLKIDLFSGHGVVELQKLGVQKIPSIAREPGEIFKRLPG
Ga0311345_1085092323300030688BogMQRGSGRQSCLKIDLFSGDWVVEFQILGVQEISSIA
Ga0302323_10111154233300031232FenMQWGSKRQIRLKIDLFSGDGMLEFQKLGVQEISPIAGEARKIFKRLAR
Ga0302325_1025647843300031234PalsaMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEILKEAGRLSR
Ga0265339_1016410213300031249RhizosphereMQGESGRYRRLEIDLLSGDGVVEFQKLGVQEISSIAGEAGEVFERLAG
Ga0265331_1001041453300031250RhizosphereMQCESGRQSCLKIDLFSGDGVLEFQKLGVQEISSIAGEAGEILKRLAGEAVQRIA
Ga0302140_1055316223300031261BogPRTWDRGEPRRQNRLKIELSSGDGVLEFEKLGVQEISSVAGEAGEIFKRLAG
Ga0302140_1065118823300031261BogMQCESGRQRRLKIDFFSGDGVMELQKLGVQEISSIAGEAGENFERLAG
Ga0265316_1116052013300031344RhizosphereMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGE
Ga0302320_1073950323300031524BogMQRGSGRQSCLKIDLFSGDWVVEFQILGVQEISSIAGEAGEILKRLAG
Ga0302320_1103463823300031524BogMQWESSRQSRLKMDLFSGAGMLKSQKLGVQKISSIAGDDG
Ga0302326_1230717823300031525PalsaLIPAVNLLMQWGSRWQSCLKIDLLSGDGVVELEILGVQEISSIAGEAGEIFKRLTG
Ga0302326_1236260733300031525PalsaMVGSRRFQRLLLQRESGRQRCLKIDLFSGNGVVEFQILGVQEISS
Ga0302326_1240696923300031525PalsaMIPAVNLPMQWESGRQRSLKIDLFSGDGVVEFQILGVQEISSIAGEAGQIFKRLAG
Ga0302326_1330268013300031525PalsaMQWESRRQRCLKIDLRSGDGVVEIQILGVQEISSIAGEAGEIFK
Ga0310686_10077875113300031708SoilMQWESRRQRCLKIDLLSGDGVVEFQILGVQEISSIAGEAGEIFQRLAG
Ga0310686_10280721523300031708SoilMLQQESGWQSCLKIDLFSGDGVAEFKKLGVQEISSIAGEAREIF
Ga0310686_11428348623300031708SoilMNLLMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGE
Ga0310686_11913516513300031708SoilMQWESRRQSCLKIDLLSGDGVAEIQKLGMQEISSIAGEAREIFKRLAC
Ga0310813_1120480313300031716SoilMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEIFKRLA
Ga0307478_1107650123300031823Hardwood Forest SoilMNLLMQWESRRQSCLKIDLLSGDGVVEFQILGVQEISSIAGE
Ga0302322_10163730613300031902FenMQSESGRQSCLKIDLFPGGGVVEFQKLGVQKISSVAGEAGKMFKRVAG
Ga0311301_1000075443300032160Peatlands SoilMQWESIRQSCLKIDLFSGDGVVELQILGVQEISSIAGDQASH
Ga0335394_1008412843300032456FreshwaterMITALRLPMQRESRRQSCLKMDWFSGDGVAEFQILGVQGKSSVAGEAGEIFKRLAG
Ga0335394_1089032513300032456FreshwaterMTAARQRCLKIDLFSGDGVVKVQILGVQEISAIACEAREIFKRL
Ga0335078_1073928213300032805SoilMQRESGRQSCLKIDLFSGDGVVEFQKLGVQEISSIA
Ga0335070_10000451373300032829SoilLGHFRLPPDFPALTLPLHREPARQSCLKIDLFSGDGVVEIQKLGVQEISSIAGEAG
Ga0335081_1025509123300032892SoilLIPAVNLLESGRQSCLKIDLFSGDGVVEFQKLGVQEISSIAGEAGEIFKRLAG
Ga0335069_1079724213300032893SoilLHREPARQSCLKIDLFSGDGVVEIQKLGVQEISSIAGEAGEIFERLSG
Ga0326726_1041750713300033433Peat SoilMQRESRWQYGLKIDLFSGDGVVEFQMLGVQEISSIAGEAGEIFKRQAG
Ga0310811_1028844713300033475SoilMPLLMQSEPSRQSCLKIDLFSGDGAVEIQKVGVQEISSIAREAGKI
Ga0334828_117125_95_2413300033822SoilMQRESGRQSCLKIDLFSGDGVVEFQKLGVQEISSIAGEAGENFKRLAG
Ga0370515_0280370_94_2403300034163Untreated Peat SoilMQWESGGQSCLKLDLFSGDGVVEFQKLSVQKISSISRETGEIFNRLAG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.