| Basic Information | |
|---|---|
| Family ID | F039998 |
| Family Type | Metagenome |
| Number of Sequences | 162 |
| Average Sequence Length | 43 residues |
| Representative Sequence | TGKVDMREQRRELRLKFVSNVAGGDYQVGKVLLDADFGDVRPY |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 162 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 3.09 % |
| % of genes near scaffold ends (potentially truncated) | 94.44 % |
| % of genes from short scaffolds (< 2000 bps) | 86.42 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (90.741 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (25.309 % of family members) |
| Environment Ontology (ENVO) | Unclassified (66.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (69.136 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.23% β-sheet: 0.00% Coil/Unstructured: 95.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 162 Family Scaffolds |
|---|---|---|
| PF10118 | Metal_hydrol | 8.64 |
| PF02801 | Ketoacyl-synt_C | 2.47 |
| PF00109 | ketoacyl-synt | 1.23 |
| PF07460 | NUMOD3 | 1.23 |
| PF13946 | DUF4214 | 1.23 |
| PF05866 | RusA | 0.62 |
| PF00128 | Alpha-amylase | 0.62 |
| PF11397 | GlcNAc | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 162 Family Scaffolds |
|---|---|---|---|
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.62 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.62 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.62 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.62 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.77 % |
| Unclassified | root | N/A | 1.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2222084011|2225749127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4201 | Open in IMG/M |
| 3300001838|RCM33_1080839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300001839|RCM40_1036659 | Not Available | 1042 | Open in IMG/M |
| 3300001850|RCM37_1361721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300001851|RCM31_10141876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300002142|M2t2FKB2_1593577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300002835|B570J40625_100671622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
| 3300003394|JGI25907J50239_1007567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2590 | Open in IMG/M |
| 3300003394|JGI25907J50239_1111395 | Not Available | 532 | Open in IMG/M |
| 3300004054|Ga0063232_10007238 | All Organisms → Viruses → Predicted Viral | 2331 | Open in IMG/M |
| 3300004096|Ga0066177_10218570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
| 3300004240|Ga0007787_10620037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300004448|Ga0065861_1100215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 946 | Open in IMG/M |
| 3300004773|Ga0007795_10233557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300004807|Ga0007809_10208584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300005581|Ga0049081_10131213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
| 3300005581|Ga0049081_10349433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300005584|Ga0049082_10266246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300005992|Ga0073924_1057804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300006802|Ga0070749_10455085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300006875|Ga0075473_10158086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 911 | Open in IMG/M |
| 3300006875|Ga0075473_10248359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
| 3300007276|Ga0070747_1340999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300007363|Ga0075458_10106406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
| 3300007640|Ga0070751_1247033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
| 3300007974|Ga0105747_1312742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300008107|Ga0114340_1063794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1573 | Open in IMG/M |
| 3300008116|Ga0114350_1129427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
| 3300008448|Ga0114876_1022077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3278 | Open in IMG/M |
| 3300009026|Ga0102829_1066359 | All Organisms → Viruses → Predicted Viral | 1097 | Open in IMG/M |
| 3300009068|Ga0114973_10076163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1933 | Open in IMG/M |
| 3300009081|Ga0105098_10233056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 862 | Open in IMG/M |
| 3300009151|Ga0114962_10120683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1608 | Open in IMG/M |
| 3300009151|Ga0114962_10308059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
| 3300009151|Ga0114962_10629520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300009154|Ga0114963_10034161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3334 | Open in IMG/M |
| 3300009154|Ga0114963_10234559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1047 | Open in IMG/M |
| 3300009154|Ga0114963_10684474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300009158|Ga0114977_10160478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1335 | Open in IMG/M |
| 3300009161|Ga0114966_10279962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1017 | Open in IMG/M |
| 3300009161|Ga0114966_10441992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300009161|Ga0114966_10456015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
| 3300009161|Ga0114966_10678620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300009164|Ga0114975_10568612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300009180|Ga0114979_10743307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300009182|Ga0114959_10272229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae | 853 | Open in IMG/M |
| 3300009182|Ga0114959_10627935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300009184|Ga0114976_10024689 | All Organisms → Viruses → Predicted Viral | 3644 | Open in IMG/M |
| 3300009184|Ga0114976_10090287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1757 | Open in IMG/M |
| 3300009184|Ga0114976_10673183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300009187|Ga0114972_10467050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
| 3300009684|Ga0114958_10415279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
| 3300010158|Ga0114960_10129796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1374 | Open in IMG/M |
| 3300010160|Ga0114967_10448895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300010885|Ga0133913_10230904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4920 | Open in IMG/M |
| 3300010885|Ga0133913_10830115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2406 | Open in IMG/M |
| 3300010885|Ga0133913_12013708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1434 | Open in IMG/M |
| 3300010885|Ga0133913_12805713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1173 | Open in IMG/M |
| 3300010885|Ga0133913_13221612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1078 | Open in IMG/M |
| 3300011184|Ga0136709_1048845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300012012|Ga0153799_1039699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
| 3300012017|Ga0153801_1056198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300012666|Ga0157498_1037661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300013004|Ga0164293_10163318 | All Organisms → Viruses → Predicted Viral | 1642 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10185351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1328 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10737403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10846280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_10367727 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
| 3300013295|Ga0170791_11029967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
| 3300013372|Ga0177922_10154302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 936 | Open in IMG/M |
| 3300013372|Ga0177922_10985018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1810 | Open in IMG/M |
| 3300013372|Ga0177922_11058187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
| 3300013372|Ga0177922_11293955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2318 | Open in IMG/M |
| 3300017700|Ga0181339_1035716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300017701|Ga0181364_1002208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3462 | Open in IMG/M |
| 3300017716|Ga0181350_1081209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
| 3300017716|Ga0181350_1099461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300017747|Ga0181352_1048195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1245 | Open in IMG/M |
| 3300017747|Ga0181352_1159177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300017754|Ga0181344_1023108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1920 | Open in IMG/M |
| 3300017754|Ga0181344_1115048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
| 3300017754|Ga0181344_1158269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300017754|Ga0181344_1160275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300017754|Ga0181344_1184890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300017761|Ga0181356_1067001 | All Organisms → Viruses → Predicted Viral | 1211 | Open in IMG/M |
| 3300017761|Ga0181356_1089941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1010 | Open in IMG/M |
| 3300017761|Ga0181356_1242391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300017777|Ga0181357_1045965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1711 | Open in IMG/M |
| 3300017777|Ga0181357_1060461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1467 | Open in IMG/M |
| 3300017777|Ga0181357_1165512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
| 3300017778|Ga0181349_1116335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 988 | Open in IMG/M |
| 3300017778|Ga0181349_1218434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300017778|Ga0181349_1264350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300017778|Ga0181349_1290666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300017784|Ga0181348_1005375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5655 | Open in IMG/M |
| 3300017785|Ga0181355_1089391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1281 | Open in IMG/M |
| 3300017785|Ga0181355_1166318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
| 3300018416|Ga0181553_10160307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1331 | Open in IMG/M |
| 3300018416|Ga0181553_10745575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300019784|Ga0181359_1094742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1102 | Open in IMG/M |
| 3300020159|Ga0211734_10736473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2471 | Open in IMG/M |
| 3300020550|Ga0208600_1020168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1065 | Open in IMG/M |
| 3300021133|Ga0214175_1007388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1699 | Open in IMG/M |
| 3300021963|Ga0222712_10067619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2596 | Open in IMG/M |
| 3300022190|Ga0181354_1197535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300022407|Ga0181351_1086241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1241 | Open in IMG/M |
| 3300022407|Ga0181351_1165783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
| 3300022407|Ga0181351_1181074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| 3300022407|Ga0181351_1198615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| 3300022407|Ga0181351_1215538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300023179|Ga0214923_10459280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300025369|Ga0208382_1001468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6411 | Open in IMG/M |
| 3300025732|Ga0208784_1000037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 56663 | Open in IMG/M |
| 3300025872|Ga0208783_10036228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 2322 | Open in IMG/M |
| 3300025889|Ga0208644_1277487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
| 3300027538|Ga0255085_1059460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
| 3300027621|Ga0208951_1018643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2219 | Open in IMG/M |
| 3300027708|Ga0209188_1063631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1587 | Open in IMG/M |
| 3300027732|Ga0209442_1280966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300027733|Ga0209297_1164008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
| 3300027741|Ga0209085_1223326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae | 753 | Open in IMG/M |
| 3300027763|Ga0209088_10153049 | All Organisms → Viruses → Predicted Viral | 1018 | Open in IMG/M |
| 3300027763|Ga0209088_10190979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
| 3300027770|Ga0209086_10157278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1091 | Open in IMG/M |
| 3300027782|Ga0209500_10254382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
| 3300027785|Ga0209246_10003123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6267 | Open in IMG/M |
| 3300027785|Ga0209246_10044094 | All Organisms → Viruses → Predicted Viral | 1712 | Open in IMG/M |
| 3300027785|Ga0209246_10328731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300027808|Ga0209354_10004678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5608 | Open in IMG/M |
| 3300027971|Ga0209401_1229685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
| 3300028025|Ga0247723_1018863 | All Organisms → Viruses → Predicted Viral | 2376 | Open in IMG/M |
| 3300028025|Ga0247723_1124314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
| 3300028178|Ga0265593_1056714 | All Organisms → Viruses → Predicted Viral | 1108 | Open in IMG/M |
| 3300028392|Ga0304729_1173316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
| 3300031772|Ga0315288_11474398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300031787|Ga0315900_10291873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1358 | Open in IMG/M |
| 3300031787|Ga0315900_11130431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300031951|Ga0315904_10591651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 957 | Open in IMG/M |
| 3300031952|Ga0315294_10816399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300031952|Ga0315294_11562767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300031999|Ga0315274_10732388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1062 | Open in IMG/M |
| 3300031999|Ga0315274_11494268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300032050|Ga0315906_10663512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
| 3300032053|Ga0315284_11316283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
| 3300032562|Ga0316226_1271953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300032676|Ga0316229_1262770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300032722|Ga0316231_1325661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300033233|Ga0334722_11326962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300033984|Ga0334989_0623323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300034061|Ga0334987_0349174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
| 3300034062|Ga0334995_0614630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300034062|Ga0334995_0675503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300034062|Ga0334995_0767717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300034092|Ga0335010_0642039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300034096|Ga0335025_0650281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300034104|Ga0335031_0030121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3957 | Open in IMG/M |
| 3300034112|Ga0335066_0087851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1984 | Open in IMG/M |
| 3300034112|Ga0335066_0537710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300034118|Ga0335053_0079420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2299 | Open in IMG/M |
| 3300034120|Ga0335056_0553553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300034121|Ga0335058_0346770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
| 3300034166|Ga0335016_0124517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1802 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 25.31% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 22.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.11% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.56% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.94% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.47% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 2.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.85% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.23% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.23% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.23% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.62% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.62% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.62% |
| Coastal Lagoon | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Coastal Lagoon | 0.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.62% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.62% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.62% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.62% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.62% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.62% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.62% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.62% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2222084011 | Coastal lagoon microbial communities from Albufera, Spain - Sample 1 | Environmental | Open in IMG/M |
| 3300001838 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a | Environmental | Open in IMG/M |
| 3300001839 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002142 | M2t3t2 FKB2 (115f) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004773 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1M | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005992 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021133 | Freshwater microbial communities from Trout Bog Lake, WI - 09AUG2007 epilimnion | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027538 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
| 3300032676 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023 | Environmental | Open in IMG/M |
| 3300032722 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033984 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2225150399 | 2222084011 | Coastal Lagoon | TNKIDMREQRRELRLKCRSNVVGGDYQLGKIILNADVGDVRGY |
| RCM33_10808391 | 3300001838 | Marine Plankton | KIDLREQRRELRLIFTSNVQGGNYQLGKVLLHANVGDVRP* |
| RCM40_10366591 | 3300001839 | Marine Plankton | LREQRRELRVKFESNVVRGDYQTGNVILHGEIGDVRGTS* |
| RCM37_13617213 | 3300001850 | Marine Plankton | KVDLREQRRELRLIFVSDVQDGEYQLGRIMLSANVGDVRPY* |
| RCM31_101418763 | 3300001851 | Marine Plankton | DTGKIDMREQRRELRLKFVSNVAGGDYQLGRVILNADIGDVRPY* |
| M2t2FKB2_15935771 | 3300002142 | Marine | FDPDTGKIDMRQQRREIRLLFRSNVSGGDYEMGKVLLSVTLGDSRPYGS* |
| B570J40625_1006716221 | 3300002835 | Freshwater | KEQRRLLRLKFVSNVADGNYQAGKVIVDADVGDVRGYSTS* |
| JGI25907J50239_10075671 | 3300003394 | Freshwater Lake | IDMREQRRELRLKFESNVVGGDYQLGYILLSADIGDVRP* |
| JGI25907J50239_11113951 | 3300003394 | Freshwater Lake | KIDMKEQRREMRLKFVSNTLNGNYQVGRLLLNATFGDVRGY* |
| Ga0063232_100072381 | 3300004054 | Freshwater Lake | KISDAFVFTPTTGKIDMKEQRREMRLRFVSNIAGGDYQLGKVLLSGAIGDVRGYE* |
| Ga0066177_102185701 | 3300004096 | Freshwater Lake | AFVFTPTTGKIDMKEQRREMRLIFVSDIAGGDYQLGKVMLSGAIGDVRGYE* |
| Ga0007787_106200371 | 3300004240 | Freshwater Lake | ETSTAYVFAPSTNKIDMKEQRRELRVKFVSNVAGGDYQLGKVLLNATIGDVRGY* |
| Ga0065861_11002154 | 3300004448 | Marine | PDTGKIDMRQQRREIRLRFKSNVQGGTYQLGRVLLSVTFGDSRPY* |
| Ga0007795_102335571 | 3300004773 | Freshwater | TGKIDMREQRRELRLRFISNVAGGNYQLGRVLLDADIGDTRPYG* |
| Ga0007809_102085841 | 3300004807 | Freshwater | LKVDMREQRRELRLRFTSNVVGGNYFMGKVLVSLDTGDVRSTANP* |
| Ga0049081_101312134 | 3300005581 | Freshwater Lentic | RELRLRFTSNVAGGNYQLGRVLVSATIGDVRGYE* |
| Ga0049081_103494333 | 3300005581 | Freshwater Lentic | FGPNTGKIDMREQRRELRLRFTSDVAGGNYQLGKLVLNAEIGDVRPYGP* |
| Ga0049082_102662461 | 3300005584 | Freshwater Lentic | MREQRREIRLFFKSNVEGGNYQMGRVLLSATVGDVRP* |
| Ga0073924_10578043 | 3300005992 | Sand | TNKIDMREQRRLGRLKFGSNVQGGNYQMGRILISANFGDVRGF* |
| Ga0070749_104550852 | 3300006802 | Aqueous | MREQRRELRLKFRSNVTGGDYQLGKVILNADVGDVRGY* |
| Ga0075473_101580864 | 3300006875 | Aqueous | QRREMRLKFVSNTLNGNYQVGRLLLNATFGDVRGY* |
| Ga0075473_102483593 | 3300006875 | Aqueous | REQRREMRLKFVSNVAGGNYQAGKILADADFGDVRGY* |
| Ga0070747_13409993 | 3300007276 | Aqueous | TGKIDLREQRRELRLKFVSNVAGGNYQMGKVIVNADFGDVRGY* |
| Ga0075458_101064061 | 3300007363 | Aqueous | RRELRLIFRSNVVGGDYQTGRVILSADIGDVRGY* |
| Ga0070751_12470331 | 3300007640 | Aqueous | KIDMKEQRRELRLKFESNEAGGNYQLGRTLLNATIGDVRGY* |
| Ga0105747_13127423 | 3300007974 | Estuary Water | DMREQRRELRLIFTSNVAGGDYQLGKVLLHANVGDVRP* |
| Ga0114340_10637941 | 3300008107 | Freshwater, Plankton | PNTHKIDMKEQRRELRLKFESNVVGGDYQLGYLLLSADIGDVRGY* |
| Ga0114350_11294271 | 3300008116 | Freshwater, Plankton | STGKIDMRQQRREIRLIFKSNVQGGDYQMGKVLLTVTLGDSRPYGS* |
| Ga0114876_10220773 | 3300008448 | Freshwater Lake | ELRLKFESNVVGGDYQMGRILLSLDMGDVRGYTP* |
| Ga0102829_10663591 | 3300009026 | Estuarine | TFTPSTGKVDMREQRRELRLKFVSNVTGGNYQLGKLLLDADFGDVRPY* |
| Ga0114973_100761635 | 3300009068 | Freshwater Lake | VFGPNTGKVDMREQRRELRLKFISNTAGGDYQLGKLLLSAEVGDARPYGP* |
| Ga0105098_102330563 | 3300009081 | Freshwater Sediment | EQRRELRLRFTSNIVGGNYQLGKLLLNADLGDVRGFGS* |
| Ga0114962_101206831 | 3300009151 | Freshwater Lake | IDLREQRREIRFRFVSDVAGGNYQLGKVIVTAEIGDTRPYGS* |
| Ga0114962_103080591 | 3300009151 | Freshwater Lake | PNTGKVDMREQRRELRIRFRSNVAGGNYQLGRVLLSAAFGDVRPY* |
| Ga0114962_106295203 | 3300009151 | Freshwater Lake | IDLREQRREIRFRFVSDVAGGNYQLGKVIVTAEIGDTRPYGA* |
| Ga0114963_100341611 | 3300009154 | Freshwater Lake | NTGKVDMREQRRELRIRFRSNVAGGNYQLGRVLLSAAFGDVRPY* |
| Ga0114963_102345591 | 3300009154 | Freshwater Lake | RELRLKFISNTAGGDYQLGKLLLSAEVGDARPYGP* |
| Ga0114963_106844743 | 3300009154 | Freshwater Lake | KVDMREQRREIRLRFRSNVVGGDYQLGKLLLSATIGDVRPY* |
| Ga0114977_101604783 | 3300009158 | Freshwater Lake | YNFGENTGKIDMREQRREIRFRFVSDVAGGNYQLGRVIVTAEIGDTRPYGA* |
| Ga0114966_102799621 | 3300009161 | Freshwater Lake | EQRRELRLRFISDVAGGNYQLGKLLLTAEIGDVRPYGP* |
| Ga0114966_104419921 | 3300009161 | Freshwater Lake | HKIDMKEQRRELRLRFTSNVQGGDYQMGRVLLSADTGDVRGY* |
| Ga0114966_104560153 | 3300009161 | Freshwater Lake | AEFTFSPDTGKVDMREQRRELRIRFRSNVAGGNYQLGKLLLNATIGDVRPY* |
| Ga0114966_106786203 | 3300009161 | Freshwater Lake | MREQRRELRLRFVSNTQGGNYQMGRVIIDAEFGDTRPYGS* |
| Ga0114975_105686123 | 3300009164 | Freshwater Lake | QTTGRIDLREQRRELRLRFRSNVQGGDYQLGRLLLNADTGDVRPY* |
| Ga0114979_107433073 | 3300009180 | Freshwater Lake | NTGKIDMKEQRREMRLRFTSNTLNGDYQLGKTLLSAEIGDVRGY* |
| Ga0114959_102722291 | 3300009182 | Freshwater Lake | NTNKIDMKEQRRELRLKFVSNEAGGDYQLGRVLLNADLAGDTRGY* |
| Ga0114959_106279353 | 3300009182 | Freshwater Lake | EQRRELRLRFRSNIAGGNYQLGKILLNATIGDVRPY* |
| Ga0114976_100246891 | 3300009184 | Freshwater Lake | NFGENTGKIDMREQRREIRFRFVSDVAGGNYQLGRVIVTAEIGDTRPYGA* |
| Ga0114976_100902874 | 3300009184 | Freshwater Lake | RELRLKFVSNVQGGNYQLGKVIVNAELGDVRGYST* |
| Ga0114976_106731831 | 3300009184 | Freshwater Lake | NKIDMREQRRELRLKFVSNVQGGNYQLGKVIITADLGDVRGYSS* |
| Ga0114972_104670501 | 3300009187 | Freshwater Lake | VFDPDTKKIDLREQRRELRLIFTSNVQGGNYQLGKVLLSANVGDVRP* |
| Ga0114958_104152791 | 3300009684 | Freshwater Lake | GPNTGKVDMREQRREIRLRFRSNTVGGNYQLGKLLLSAAIGDVRPY* |
| Ga0114960_101297961 | 3300010158 | Freshwater Lake | VDMREQRRELRIRFRSNVAGGNYQLGRVLLSAAFGDVRPY* |
| Ga0114967_104488953 | 3300010160 | Freshwater Lake | RELRLKFTSDVAGGNYQLGKVLLSGEVGDARPYGS* |
| Ga0133913_102309041 | 3300010885 | Freshwater Lake | PDTHKIDMKEQRRELRLRFTSNVQGGDYQMGRVLLSADTGDVRGY* |
| Ga0133913_108301151 | 3300010885 | Freshwater Lake | PNTGKIDMREQRREIRLRFTSNVQGGNYQMGKILLSANVGDVRPYGS* |
| Ga0133913_120137081 | 3300010885 | Freshwater Lake | TNKIDMREQGRELRLRFVSNVTGGNYQVGRVIVNVDFGDVRGY* |
| Ga0133913_128057133 | 3300010885 | Freshwater Lake | GKIDLREQRRELRLRFVSNTQNGNYQLGVLLLSADIGDVRP* |
| Ga0133913_132216124 | 3300010885 | Freshwater Lake | SKIDMREQGRELRLKFVSNEAGGDYQTGRILLNANVGDVRGYS* |
| Ga0136709_10488451 | 3300011184 | Freshwater | FDPDTNKIDMREQRRELRVRIVSNVAGGNYQLGRLLLSANVGDVRGY* |
| Ga0153799_10396992 | 3300012012 | Freshwater | VFDGTTNKIDMKEQRRELRLKFRSNTAGGNYQTGRVIVSADIGDVRGY* |
| Ga0153801_10561983 | 3300012017 | Freshwater | TFSPTTGKVDMREQRRELRLKFVSNVAGGNYQVGKILLDADLGDVRP* |
| Ga0157498_10376612 | 3300012666 | Freshwater, Surface Ice | MREQRRELRLKFVSNVAGGNYQVGKILLDAEFGDVRP* |
| Ga0164293_101633181 | 3300013004 | Freshwater | TNKIDIREQRREFRLKFVSNVSGGDYQLGRLLLSANVGDVRGY* |
| (restricted) Ga0172367_101853511 | 3300013126 | Freshwater | PYMFAPGTGKVDMKEQRRELRLKFVSNVAGGNYQLGKVLISADEGDVRGYST* |
| (restricted) Ga0172366_107374033 | 3300013128 | Sediment | DMKEQRRELRLKFVSNQAGGNYQMGKVIVSADLGDVRGYST* |
| (restricted) Ga0172373_108462803 | 3300013131 | Freshwater | TFASGTGKVDMKEQRRELRLKFVSNVAGGNYQLGKILISADEGDVRGYST* |
| (restricted) Ga0172362_103677272 | 3300013133 | Sediment | MKEQRREMRIRFVSNEAGGNYQMGKVILNATFGDVRGY* |
| Ga0170791_110299673 | 3300013295 | Freshwater | LPDTHKIDMREQRRELRLRFVSNVQGGDYQLGRIIINADFGDVRPY* |
| Ga0177922_101543021 | 3300013372 | Freshwater | AYTFTSTTGKVDMREQRRELRLKFVSNVTGGNYQVGKILLDADFGDVRP* |
| Ga0177922_109850183 | 3300013372 | Freshwater | VFDANIGKIDMKEQRRELRLRFTSNIVGGNYQLGKLLLNADLGDVRGFGS* |
| Ga0177922_110581871 | 3300013372 | Freshwater | KIDIREQRRELRLRFLSNVVNGDYQVGRIVLNANTGDVRPYGA* |
| Ga0177922_112939551 | 3300013372 | Freshwater | FDSVTGKVDMKEQRRLLRLQFVSNQVDADYQAGKILVDADIGDVRGYTV* |
| Ga0181339_10357163 | 3300017700 | Freshwater Lake | PTTGKIDLREQRREIRLIFTSNVAGGDYQLGKILLHANVGDVRP |
| Ga0181364_10022081 | 3300017701 | Freshwater Lake | VDMREQRRELRLKFVSNVAGGTYQVGKILLDADFGDVRP |
| Ga0181350_10812093 | 3300017716 | Freshwater Lake | GPYPFDPDTGKVDMRAQRRELRLKFVSNVAGGNYQVGKIILDADLGDVRP |
| Ga0181350_10994611 | 3300017716 | Freshwater Lake | PFDPDTGKVDMREQRRELRLKFVSNVAGGNYQVGKIILDADLGDVRP |
| Ga0181352_10481951 | 3300017747 | Freshwater Lake | TGKVDMREQRRELRLKFVSNVAGGDYQVGKVLLDADFGDVRPY |
| Ga0181352_11591771 | 3300017747 | Freshwater Lake | SPDTGKVDMREQRRELRLKFVSNVAGGDYQVGKVILDADLGDVRP |
| Ga0181344_10231081 | 3300017754 | Freshwater Lake | REQRRELRLKFESNVVGGDYQLGYLLLSADIGDVRP |
| Ga0181344_11150484 | 3300017754 | Freshwater Lake | GKIDMREQRCECRLKFVSNTVNGNYQLGRLLLSANVGDVRGY |
| Ga0181344_11582691 | 3300017754 | Freshwater Lake | KIDVREQRRELRVIFGSNVAGGDYQLGKLLLDADFGDTRGY |
| Ga0181344_11602753 | 3300017754 | Freshwater Lake | KIDLREQRRELRLQFVSDVQDGDYQLGRVLLSATLGDVRPY |
| Ga0181344_11848901 | 3300017754 | Freshwater Lake | AFTPTTGKVDMREQRRELRLKFVSNVTGGNYQVGKIILDADFGDVRPY |
| Ga0181356_10670011 | 3300017761 | Freshwater Lake | GKVDMREQRRELRLKFVSNVAGGNYQVGKIILDADLGDVRP |
| Ga0181356_10899411 | 3300017761 | Freshwater Lake | TGKIDMREQRREIRLFFKSNVEGGNYQMGRVLLSATIGDVRP |
| Ga0181356_12423913 | 3300017761 | Freshwater Lake | GPNNGKIDMREQRRELRLKFTSDVAGGDYQLGKVLLSAEIGDVRPYGP |
| Ga0181357_10459654 | 3300017777 | Freshwater Lake | KIDMREQRRELRLKFESNVVGGDYQLGYLLLSADIGDVRP |
| Ga0181357_10604611 | 3300017777 | Freshwater Lake | EQRRELRLRFTSDVAGGNYQLGKLVLNAEIGDVRPYGP |
| Ga0181357_11655123 | 3300017777 | Freshwater Lake | QRREMRLRFVSNIAGGDYQLGKVLLSGAIGDVRGYE |
| Ga0181349_11163353 | 3300017778 | Freshwater Lake | DPDTGKIDMREQRREIRLFFKSNVEGGNYQMGRVLLSATIGDGRP |
| Ga0181349_12184341 | 3300017778 | Freshwater Lake | MREQRRELRLKFVSNVAGGDYQVGKILLDADVGDSRPYG |
| Ga0181349_12643503 | 3300017778 | Freshwater Lake | VFSPTTGKIDMKEQRRELRIKIVSNVLGGDYQLGKILLNADVGDVRGYG |
| Ga0181349_12906663 | 3300017778 | Freshwater Lake | GKIDMREQRRELRLRFTSDVAGGNYQMGKVLLTADVGDARPYGS |
| Ga0181348_10053755 | 3300017784 | Freshwater Lake | FDPETHRVDMREQRRELRLKFLSNTQGGDYQLGRLLLAANIGDVRGY |
| Ga0181355_10893911 | 3300017785 | Freshwater Lake | QRRELRLRFTSNVAGGNYQLGRVLVSATIGDVRGYE |
| Ga0181355_11663181 | 3300017785 | Freshwater Lake | KEQRRELRLQFRSNVVGGDYQTGKIVISADIGDVRGY |
| Ga0181553_101603074 | 3300018416 | Salt Marsh | EQRREIRLRFVSNVVGGNYQLGKLLVTAEIGDTRPYGS |
| Ga0181553_107455753 | 3300018416 | Salt Marsh | PGTGKIDMKEQRRILRLKFVSNVAGGDYQVGKIIVDADTGDVRGYST |
| Ga0181359_10947421 | 3300019784 | Freshwater Lake | FGPNNGKIDMREQRRELRLKFTSDVAGGDYQLGKILLSAEIGDVRPYGP |
| Ga0211734_107364736 | 3300020159 | Freshwater | VFTPSTGKIDMRQQRREIRLRFASNVQGGDYQMGKVLLTVTLGDSRPYGS |
| Ga0208600_10201683 | 3300020550 | Freshwater | VKIDMREQRRELRLKFTSDVAGGDYQLGKILLSAEIGDSRPYGS |
| Ga0214175_10073883 | 3300021133 | Freshwater | REPRLKFNSNVVGGDYQMGNVLISAEISDVRGTGNP |
| Ga0222712_100676193 | 3300021963 | Estuarine Water | QRRELRIKIVSNVLGGDYQLGKILLNADVGDVRGYG |
| Ga0181354_11975353 | 3300022190 | Freshwater Lake | KIDMREQRRELRLKFISDVAGGDYQLGKILLSAEIGDVRPYGP |
| Ga0181351_10862414 | 3300022407 | Freshwater Lake | EQRRELRLQFRSNVVGGDYQTGKIVISADIGDVRGY |
| Ga0181351_11657833 | 3300022407 | Freshwater Lake | GKIDMREQRREIRLFFKSNVEGGNYQMGRVLLSATVGDVRP |
| Ga0181351_11810741 | 3300022407 | Freshwater Lake | GKIDMRQQRREIRLIFKSNVQGGDYQMGKVLLTVTLGDSRPYGS |
| Ga0181351_11986151 | 3300022407 | Freshwater Lake | KIDMREQRRELRLKFTSDVAGGDYQLGKVLLSAEIGDVRPYGS |
| Ga0181351_12155381 | 3300022407 | Freshwater Lake | DKQSDAYVFSPTTGKIDMKEQRRELRIKIVSNVLGGDYQLGKILLNADVGDVRGYG |
| Ga0214923_104592803 | 3300023179 | Freshwater | KEQRRILRLKFVSNIANGDYQTGKIIVDADMGDVRGYST |
| Ga0208382_10014686 | 3300025369 | Freshwater | FDMSTGKIDMKEQRRELKLQFVSNQQNGDYQCGRILVDADFGDVRGY |
| Ga0208784_10000371 | 3300025732 | Aqueous | PGTSKIDMKEQRRLLRLKFVSNVAGGDYQTGKIIVDADTGDVRGYTV |
| Ga0208783_100362283 | 3300025872 | Aqueous | RELRLKFESNIIGGDYQMGRILLSLDMGDVRGYTP |
| Ga0208644_12774873 | 3300025889 | Aqueous | KIDMKEQRRELRLKFESDEAGGNYQLGRVLLSATTGDVRGY |
| Ga0255085_10594601 | 3300027538 | Freshwater | DLREQRRELRLIFTSNVQGGDYQLGRVLLSANVGDVRP |
| Ga0208951_10186431 | 3300027621 | Freshwater Lentic | GKIDMRQQRREIRLIFKSNVQGGDYQMGKVLLSVTLGDVRPFGS |
| Ga0209188_10636314 | 3300027708 | Freshwater Lake | GPNTGKVDMREQRRELRIRFRSNVAGGNYQLGRVLLSAAFGDVRPY |
| Ga0209442_12809661 | 3300027732 | Freshwater Lake | IDMREQRRELRLKFESNVVGGDYQLGYLLLSADIGDVRP |
| Ga0209297_11640081 | 3300027733 | Freshwater Lake | EQRREIRFRFVSDVAGGNYQLGRVIVTAEIGDTRPYGA |
| Ga0209085_12233263 | 3300027741 | Freshwater Lake | VFDANTNKIDMKEQRRELRLKFVSNEAGGDYQLGRVLLNADLAGDTRGY |
| Ga0209088_101530493 | 3300027763 | Freshwater Lake | FSPSTGKIDMREQRRELRLRFVSNVAGGTYQVGKILLDADVGDSRPYG |
| Ga0209088_101909793 | 3300027763 | Freshwater Lake | YTFSPTTGKIDVREQRRELRLKFRSNVLNGDYQLGRMLLNADTGDVRPYGS |
| Ga0209086_101572784 | 3300027770 | Freshwater Lake | EKVDLKEQRRELRVRIRSNVSGGDYQLGKMLLDAETGDVRG |
| Ga0209500_102543823 | 3300027782 | Freshwater Lake | DMREQRRELRLKFVSNVAGGTYQLGKVILDADLGDVRPY |
| Ga0209246_100031235 | 3300027785 | Freshwater Lake | DMREQRRELRLKFISDVAGGDYQLGKILLSAEIGDVRPYGP |
| Ga0209246_100440941 | 3300027785 | Freshwater Lake | REQRRELRLKFVSNVAGGDYQMGKVIVSADLGDTRGYNT |
| Ga0209246_103287313 | 3300027785 | Freshwater Lake | DTRKIDLREQRRELRLIFTSNTQGGDYQLGKVLLHANVGDVRP |
| Ga0209354_100046781 | 3300027808 | Freshwater Lake | RRELRLKFTSDVAGGDYQLGKILLSAEIGDVRPYGP |
| Ga0209401_12296851 | 3300027971 | Freshwater Lake | DMREQRRELRLKFISNTAGGDYQLGKLLLSAEVGDARPYGP |
| Ga0247723_10188633 | 3300028025 | Deep Subsurface Sediment | IDMREQRREIRLRFTSNVQGGNYQMGRILLSANVGDVRPFGG |
| Ga0247723_11243143 | 3300028025 | Deep Subsurface Sediment | DMREQRRELRLKFVSNVQGGNYQLGKVIVNAELGDVRGYST |
| Ga0265593_10567144 | 3300028178 | Saline Water | DPDTHKIDMKEQRREMRLKFVSNTLNGNYQVGRLLLNATFGDVRGY |
| Ga0304729_11733163 | 3300028392 | Freshwater Lake | TEYVFGPNTGKVDMREQRRELRIRFRSNVAGGNYQLGRVLLSAAFGDVRPY |
| Ga0315288_114743983 | 3300031772 | Sediment | KIDMKEQRRELRIKIVSNVLGGDYQLGKILLNADVGDVRGYG |
| Ga0315900_102918731 | 3300031787 | Freshwater | QRRELRVKFVSNVAGGDYQLGKVLLNATIGDVRGY |
| Ga0315900_111304311 | 3300031787 | Freshwater | PYPFDPDTGKVDMREQRRELRLKFVSNVAGGNYQVGKVVLDADVGDVRP |
| Ga0315904_105916511 | 3300031951 | Freshwater | RRLLRLKFVSNVANGNYQVGKIIVDADIGDVRGYST |
| Ga0315294_108163991 | 3300031952 | Sediment | VTSESYVFDPDTKKIDLREQRRELRLIFTSNVQGGDYQLGKVLLSANVGDVRP |
| Ga0315294_115627671 | 3300031952 | Sediment | KIDMRQQRREIRLRFRSNEQGGNYQMGKVLLSVTLGDVRPFGN |
| Ga0315274_107323884 | 3300031999 | Sediment | TGKIDMREQRRELRLKFESNVVGGDYQLGYLLLSADIGDVRP |
| Ga0315274_114942681 | 3300031999 | Sediment | TGKIDMKEQRRELRIKVVSNVLGGDYQLGKMLLNADVGDVRGYG |
| Ga0315906_106635124 | 3300032050 | Freshwater | TSDPFVFAPNTNKIDMKEQRRELRMKFVSNVAGGDYQLGKVLLNATIGDVRGY |
| Ga0315284_113162834 | 3300032053 | Sediment | TGKIDMRQQRREIRLRFRSNVSGGDYQMGKVLLSVTIGDSRPYGT |
| Ga0316226_12719531 | 3300032562 | Freshwater | QRREMRLKFVSNVAGGNYQLGRIMLDADVGDVRGYS |
| Ga0316229_12627701 | 3300032676 | Freshwater | IDLKEQRREMRLRFVSNVAGGNYQLGRIMLDADVGDVRGYS |
| Ga0316231_13256613 | 3300032722 | Freshwater | SSTLKIDLREQRRELRLRFESNVQGGNYQVGKILLSIDAGDIRGTGNP |
| Ga0334722_113269623 | 3300033233 | Sediment | STGKVDMREQRRELRLKFVSNVAGGNYQLGKIILDADLGDVRP |
| Ga0334989_0623323_330_452 | 3300033984 | Freshwater | MREQRRELRLKFTSDVAGGNYQLGKLLLDAEIGDVRPYGP |
| Ga0334987_0349174_3_158 | 3300034061 | Freshwater | YPFEPGTTKIDLREQRRELRLKFVSNVSGGDFQMGKVIVNADLGDVRGYST |
| Ga0334995_0614630_2_157 | 3300034062 | Freshwater | TGPYVFSPDTGKVDMREQRRELRLKFVSNVAGGNYQVGKVILDADLGDVRP |
| Ga0334995_0675503_3_143 | 3300034062 | Freshwater | NTGKIDLREQRRELRLKFTSDVAGGNYQLGKLLLSAEIGDVRPYGS |
| Ga0334995_0767717_385_531 | 3300034062 | Freshwater | SPTTGKIDIREQRRELRLRFLSNVVNGDYQVGRIVLNANTGDVRPYGA |
| Ga0335010_0642039_415_531 | 3300034092 | Freshwater | LREQRRELRLRFRSNVQGGNYQLGRLLLNADTGDVRPY |
| Ga0335025_0650281_403_513 | 3300034096 | Freshwater | RRLLRLKFVSNQVDGDYQTGKVIVDADFGDVRGYTV |
| Ga0335031_0030121_18_140 | 3300034104 | Freshwater | MKEQRRVLQLKFVSDTVGGDYQAGKIILDADFGDVRGYTV |
| Ga0335066_0087851_1_153 | 3300034112 | Freshwater | PYVFDGNTNKIDMKEQRRELRLQFRSNVVGGDYQTGKIIISADIGDVRGY |
| Ga0335066_0537710_26_139 | 3300034112 | Freshwater | MLEQRRELRLKFVSNVAGGNYQLGKVILNADLGDVRP |
| Ga0335053_0079420_47_169 | 3300034118 | Freshwater | MKEQRRELRLKFVSNVAGGNYQLGKILISADEGDVRGYST |
| Ga0335056_0553553_436_597 | 3300034120 | Freshwater | PSDPYVFDGNTNKIDMKEQRRELRLQFRSNVVGGDYQTGKIIISADIGDVRGY |
| Ga0335058_0346770_732_857 | 3300034121 | Freshwater | GKVDMREQRRELRLKFVSNVAGGDYQVGKVILDADLGDVRP |
| Ga0335016_0124517_47_163 | 3300034166 | Freshwater | MREQRRELRLLFRSDVQGGNYQMGRVIISADFGDVRGF |
| ⦗Top⦘ |