NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F039973

Metagenome / Metatranscriptome Family F039973

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039973
Family Type Metagenome / Metatranscriptome
Number of Sequences 162
Average Sequence Length 44 residues
Representative Sequence MMKSRIARALVAALVAGTLILAGTAGYGPPGSGIIVSSVNW
Number of Associated Samples 99
Number of Associated Scaffolds 162

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 25.31 %
% of genes near scaffold ends (potentially truncated) 72.22 %
% of genes from short scaffolds (< 2000 bps) 98.15 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.358 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(31.482 % of family members)
Environment Ontology (ENVO) Unclassified
(35.185 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(37.654 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: Yes Secondary Structure distribution: α-helix: 36.23%    β-sheet: 0.00%    Coil/Unstructured: 63.77%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 162 Family Scaffolds
PF03704BTAD 6.79
PF02518HATPase_c 1.23
PF02782FGGY_C 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 162 Family Scaffolds
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 6.79
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 6.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.36 %
UnclassifiedrootN/A8.64 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003163|Ga0006759J45824_1067462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca556Open in IMG/M
3300003163|Ga0006759J45824_1070489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca557Open in IMG/M
3300003316|rootH1_10157734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus1164Open in IMG/M
3300003544|Ga0007417J51691_1077022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca991Open in IMG/M
3300003570|Ga0007418J51697_1064580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca773Open in IMG/M
3300003574|Ga0007410J51695_1052166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca675Open in IMG/M
3300004114|Ga0062593_103373125Not Available512Open in IMG/M
3300004479|Ga0062595_101557017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae613Open in IMG/M
3300004798|Ga0058859_10019386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1027Open in IMG/M
3300004798|Ga0058859_10139412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca879Open in IMG/M
3300004798|Ga0058859_11614595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca640Open in IMG/M
3300004798|Ga0058859_11815773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1015Open in IMG/M
3300004801|Ga0058860_11858060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca524Open in IMG/M
3300005340|Ga0070689_100476046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1066Open in IMG/M
3300005344|Ga0070661_100663165Not Available847Open in IMG/M
3300005355|Ga0070671_101002553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca732Open in IMG/M
3300005356|Ga0070674_101206399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca672Open in IMG/M
3300005365|Ga0070688_101118716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca630Open in IMG/M
3300005445|Ga0070708_100696915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca956Open in IMG/M
3300005518|Ga0070699_101198853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca696Open in IMG/M
3300005841|Ga0068863_100197115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1936Open in IMG/M
3300005843|Ga0068860_101866076Not Available623Open in IMG/M
3300005843|Ga0068860_102115765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca584Open in IMG/M
3300006844|Ga0075428_101278301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca772Open in IMG/M
3300006880|Ga0075429_100448018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae1131Open in IMG/M
3300009147|Ga0114129_10872763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1142Open in IMG/M
3300009162|Ga0075423_10765961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1021Open in IMG/M
3300009177|Ga0105248_13246839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae517Open in IMG/M
3300009553|Ga0105249_10929819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae937Open in IMG/M
3300009553|Ga0105249_11223644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca822Open in IMG/M
3300009553|Ga0105249_13175317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae528Open in IMG/M
3300009686|Ga0123338_10009978All Organisms → cellular organisms → Bacteria7414Open in IMG/M
3300010039|Ga0126309_10784708Not Available620Open in IMG/M
3300010044|Ga0126310_10493861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca893Open in IMG/M
3300010044|Ga0126310_10606338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca817Open in IMG/M
3300010045|Ga0126311_10989465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae687Open in IMG/M
3300010146|Ga0126320_1174582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca771Open in IMG/M
3300010166|Ga0126306_11225144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca617Open in IMG/M
3300010359|Ga0126376_10877075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca885Open in IMG/M
3300010375|Ga0105239_11880440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca694Open in IMG/M
3300010375|Ga0105239_12743614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae575Open in IMG/M
3300010403|Ga0134123_11628189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae694Open in IMG/M
3300011119|Ga0105246_10439372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae1094Open in IMG/M
3300011333|Ga0127502_11087994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca773Open in IMG/M
3300011333|Ga0127502_11266168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca809Open in IMG/M
3300011444|Ga0137463_1210833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca727Open in IMG/M
3300012211|Ga0137377_11834003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca525Open in IMG/M
3300012212|Ga0150985_100596418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1599Open in IMG/M
3300012212|Ga0150985_101137983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca2127Open in IMG/M
3300012212|Ga0150985_102126919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca960Open in IMG/M
3300012212|Ga0150985_104748344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1194Open in IMG/M
3300012212|Ga0150985_105135911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca994Open in IMG/M
3300012212|Ga0150985_106516243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca745Open in IMG/M
3300012212|Ga0150985_111531869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1247Open in IMG/M
3300012212|Ga0150985_115203975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1552Open in IMG/M
3300012212|Ga0150985_116325044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca865Open in IMG/M
3300012212|Ga0150985_120961177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca637Open in IMG/M
3300012355|Ga0137369_10613452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae755Open in IMG/M
3300012469|Ga0150984_101809020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1920Open in IMG/M
3300012469|Ga0150984_102578345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca886Open in IMG/M
3300012469|Ga0150984_104471693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1512Open in IMG/M
3300012469|Ga0150984_107201837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1835Open in IMG/M
3300012469|Ga0150984_110365565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1017Open in IMG/M
3300012469|Ga0150984_110418468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1416Open in IMG/M
3300012469|Ga0150984_112964970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus1155Open in IMG/M
3300012469|Ga0150984_113869459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca751Open in IMG/M
3300012469|Ga0150984_119106903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1454Open in IMG/M
3300012469|Ga0150984_119112816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca901Open in IMG/M
3300012955|Ga0164298_10641129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae736Open in IMG/M
3300013297|Ga0157378_10319734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-11507Open in IMG/M
3300014325|Ga0163163_10851105Not Available975Open in IMG/M
3300015372|Ga0132256_102030439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca681Open in IMG/M
3300017792|Ga0163161_11865149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca535Open in IMG/M
3300018056|Ga0184623_10250652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae808Open in IMG/M
3300019208|Ga0180110_1099275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca669Open in IMG/M
3300019228|Ga0180119_1385619Not Available1026Open in IMG/M
3300019229|Ga0180116_1173598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca675Open in IMG/M
3300019229|Ga0180116_1222979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca926Open in IMG/M
3300019232|Ga0180114_1245330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca685Open in IMG/M
3300019238|Ga0180112_1026489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca824Open in IMG/M
3300019248|Ga0180117_1269185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca774Open in IMG/M
3300019249|Ga0184648_1067178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca903Open in IMG/M
3300019249|Ga0184648_1501801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca535Open in IMG/M
3300019249|Ga0184648_1508897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca636Open in IMG/M
3300019257|Ga0180115_1092817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca505Open in IMG/M
3300019257|Ga0180115_1430842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus1014Open in IMG/M
3300019259|Ga0184646_1020635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca545Open in IMG/M
3300019263|Ga0184647_1477689Not Available567Open in IMG/M
3300020063|Ga0180118_1220436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca867Open in IMG/M
3300020063|Ga0180118_1401054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca579Open in IMG/M
3300020064|Ga0180107_1077305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca877Open in IMG/M
3300020065|Ga0180113_1169928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca615Open in IMG/M
3300020067|Ga0180109_1003717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca852Open in IMG/M
3300020067|Ga0180109_1112850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus1000Open in IMG/M
3300020068|Ga0184649_1123884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus1030Open in IMG/M
3300021951|Ga0222624_1580022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca776Open in IMG/M
3300022561|Ga0212090_10027607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus6770Open in IMG/M
3300025925|Ga0207650_11159483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca658Open in IMG/M
3300025935|Ga0207709_11562986Not Available548Open in IMG/M
3300025937|Ga0207669_10507557Not Available966Open in IMG/M
3300025986|Ga0207658_10280280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus1429Open in IMG/M
3300030902|Ga0308202_1030120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca910Open in IMG/M
3300030904|Ga0308198_1004940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1424Open in IMG/M
3300030904|Ga0308198_1007000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1268Open in IMG/M
3300030904|Ga0308198_1018112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca921Open in IMG/M
3300030905|Ga0308200_1008793Not Available1409Open in IMG/M
3300030905|Ga0308200_1052340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca767Open in IMG/M
3300030905|Ga0308200_1131366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca562Open in IMG/M
3300030905|Ga0308200_1159624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca527Open in IMG/M
3300030987|Ga0308155_1006633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca858Open in IMG/M
3300030988|Ga0308183_1009121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1474Open in IMG/M
3300030988|Ga0308183_1067641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca754Open in IMG/M
3300030989|Ga0308196_1013603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca877Open in IMG/M
3300030990|Ga0308178_1024130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus990Open in IMG/M
3300030990|Ga0308178_1032871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca895Open in IMG/M
3300030990|Ga0308178_1044008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca812Open in IMG/M
3300030990|Ga0308178_1063414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca718Open in IMG/M
3300030993|Ga0308190_1008050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1463Open in IMG/M
3300030993|Ga0308190_1118716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca599Open in IMG/M
3300031058|Ga0308189_10075176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus1010Open in IMG/M
3300031058|Ga0308189_10078193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus997Open in IMG/M
3300031081|Ga0308185_1059534Not Available503Open in IMG/M
3300031082|Ga0308192_1056180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca601Open in IMG/M
3300031082|Ga0308192_1059409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca589Open in IMG/M
3300031082|Ga0308192_1066018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca569Open in IMG/M
3300031093|Ga0308197_10030320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1266Open in IMG/M
3300031093|Ga0308197_10033556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1224Open in IMG/M
3300031093|Ga0308197_10105561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca841Open in IMG/M
3300031093|Ga0308197_10353665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca560Open in IMG/M
3300031094|Ga0308199_1008744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1480Open in IMG/M
3300031095|Ga0308184_1002766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1309Open in IMG/M
3300031096|Ga0308193_1022307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca823Open in IMG/M
3300031096|Ga0308193_1054389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca608Open in IMG/M
3300031098|Ga0308191_1009019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca875Open in IMG/M
3300031099|Ga0308181_1088732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca652Open in IMG/M
3300031114|Ga0308187_10077345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca985Open in IMG/M
3300031114|Ga0308187_10229693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca664Open in IMG/M
3300031114|Ga0308187_10469569Not Available511Open in IMG/M
3300031123|Ga0308195_1032667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca693Open in IMG/M
3300031123|Ga0308195_1039081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca654Open in IMG/M
3300031123|Ga0308195_1068999Not Available545Open in IMG/M
3300031125|Ga0308182_1027432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca511Open in IMG/M
3300031231|Ga0170824_111202767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca512Open in IMG/M
3300031421|Ga0308194_10080177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca901Open in IMG/M
3300031421|Ga0308194_10245078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca599Open in IMG/M
3300031421|Ga0308194_10348095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca527Open in IMG/M
3300031481|Ga0314816_1013968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca962Open in IMG/M
3300032126|Ga0307415_100237276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1473Open in IMG/M
3300034643|Ga0370545_011077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1365Open in IMG/M
3300034643|Ga0370545_026994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp.1008Open in IMG/M
3300034643|Ga0370545_159230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca524Open in IMG/M
3300034644|Ga0370548_080497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca631Open in IMG/M
3300034661|Ga0314782_014897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1249Open in IMG/M
3300034664|Ga0314786_036575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca872Open in IMG/M
3300034672|Ga0314797_100473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca593Open in IMG/M
3300034673|Ga0314798_097479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca617Open in IMG/M
3300034673|Ga0314798_125798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca566Open in IMG/M
3300034676|Ga0314801_048282Not Available835Open in IMG/M
3300034676|Ga0314801_075870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca714Open in IMG/M
3300034676|Ga0314801_174379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca535Open in IMG/M
3300034680|Ga0370541_008103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1012Open in IMG/M
3300034680|Ga0370541_025316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca691Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil31.48%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment13.58%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere8.02%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere7.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.94%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.09%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated3.09%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil2.47%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.85%
Glacier ValleyEnvironmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley1.23%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.23%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.23%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.23%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.23%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.23%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.23%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.62%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.62%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.62%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.62%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.62%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.62%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.62%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003163Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003316Sugarcane root Sample L1Host-AssociatedOpen in IMG/M
3300003544Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003570Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_34 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003574Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004801Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009686Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - groundupSSSS metaGEnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010146Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011333Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300019208Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019228Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019229Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019232Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019238Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019248Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019249Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019257Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020063Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020064Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020065Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020067Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020068Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022561Borup_combined assemblyEnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030904Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030987Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030988Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030989Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030990Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031081Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031082Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031095Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031096Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031098Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_186 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031123Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031125Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_153 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031481Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300034643Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034644Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034664Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034672Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034673Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034676Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034680Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0006759J45824_106746213300003163Avena Fatua RhizosphereKEFEMKSRIARALVAALVAGTLLLAGTAGFGPPGSGIIVSSVNW*
Ga0006759J45824_107048913300003163Avena Fatua RhizosphereMKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVASSVNW*
rootH1_1015773433300003316Sugarcane Root And Bulk SoilMKTRIARALIAALVAGTLLLAGTAAYGPPGSGIIVSSVNW*
Ga0007417J51691_107702213300003544Avena Fatua RhizosphereSLKMKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVASSVNW*
Ga0007418J51697_106458013300003570Avena Fatua RhizosphereTKEFEMKSRIARALVAALVAGTLIFAGSAGLGPPGSGIIVSSVNW*
Ga0007410J51695_105216613300003574Avena Fatua RhizosphereQIKEFEMKSRIARALVAALVAGTLLLAGTAGFGPPGSGIIVSSVNW*
Ga0062593_10337312513300004114SoilMKTRIVRALVAALVAGTLLLAGTAGYIPPGPKGMIVTSVNW*
Ga0062595_10155701713300004479SoilMMKSRIARVLIAALVAGTLILAGTAGVGPPGSGMIVSSVN
Ga0058859_1001938613300004798Host-AssociatedKPRSLMMKTRIVRALIAALVAGTLLFAGTAGMGPPGSGIIVSSVNW*
Ga0058859_1013941233300004798Host-AssociatedKPRSLMMKSRIVRALVAALVAGTLLFAGTAGMGPPGSGIIVSSVNW*
Ga0058859_1161459523300004798Host-AssociatedKPRSLMMKSRIARALVAALVAGTLILAGTAGYGPPGSGIIVTSVNW*
Ga0058859_1181577323300004798Host-AssociatedMKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVSSVNW*
Ga0058860_1185806023300004801Host-AssociatedMKTRIVRALIAALVAGTLLFAGTAGMGPPGSGIIVSSVNW*
Ga0070689_10047604613300005340Switchgrass RhizosphereMMKSRIVRALVAALVAGTLLFAGTAGMGPPGSGIIVSSVNW*
Ga0070661_10066316523300005344Corn RhizosphereMKSRIVRALVAALVAGTLLFAGTAGMGPPGSGIIVSSVNW*
Ga0070671_10100255323300005355Switchgrass RhizosphereMKTRIARALVAALVAGTLLFAGTAAYGPPGSGIVVSSVNW*
Ga0070674_10120639913300005356Miscanthus RhizosphereGIIVAAVVVDSHKPRSLNMKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVSSVNW*
Ga0070688_10111871623300005365Switchgrass RhizosphereMKSRIVRALVAALVAGTLIFAGSAGLGPPGSGIIVSSVSW*
Ga0070708_10069691513300005445Corn, Switchgrass And Miscanthus RhizosphereMKSRIVRALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW*
Ga0070699_10119885323300005518Corn, Switchgrass And Miscanthus RhizosphereMKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW*
Ga0068863_10019711513300005841Switchgrass RhizosphereHKPRSLMMKSRIVRALVAALVAGTLLFAGTAGMGPPGSGIIVSSVNW*
Ga0068860_10186607623300005843Switchgrass RhizosphereMKSRIVRALVAALVAGTLILAGTAGFGPPGSGIIVSSVNW*
Ga0068860_10211576523300005843Switchgrass RhizosphereVATVTIDFYKPRSLMMKTRIVRALIAALVAGTLLFAGTAGMGPPGSGIIVSSVNW*
Ga0075428_10127830123300006844Populus RhizosphereMKSRIARALVAALVAGTLILAGTAGVGPPGSGIIVQSVNW*
Ga0075429_10044801813300006880Populus RhizosphereMKSRIARALIAALVAGTLILAGTAGVGPPGSGMIV
Ga0114129_1087276323300009147Populus RhizosphereMKSRIARALIAALVAGTLILAGTAGVGPPGSGMIVSSVNW*
Ga0075423_1076596123300009162Populus RhizosphereLAIVATVIDALELRSLKMKTRILRALVAALVAGTLLLAGTAGYGLPGTNGAALSVNW*
Ga0105248_1324683913300009177Switchgrass RhizosphereMKSRIVRALVAALVAGTLILAGTAGFGPPGSGIIVSSVN
Ga0105249_1092981923300009553Switchgrass RhizosphereMKSRIVRALVAALVAGTLILAGTAGFGPPGSGIIVSSV
Ga0105249_1122364413300009553Switchgrass RhizosphereMMKTRIVRALIAALVAGTLLFAGTAGMGPPGSGIIVSSVNW*
Ga0105249_1317531713300009553Switchgrass RhizosphereMMKSRIVRALVAALVAGTLIFAGTAGMGPPGSGIIVSS
Ga0123338_1000997853300009686Glacier ValleyMKSRIARALVAALVAGTLILAGSAGLGPPGSGMIVSSVNW*
Ga0126309_1078470823300010039Serpentine SoilMKSRIVRALIAALVAGTLILAGTAGVGPPGSGMIVSSVNW*
Ga0126310_1049386113300010044Serpentine SoilMKSRIARALVAALVAGTLIFAGSAGLGPPGSGIIVSSVNW*
Ga0126310_1060633813300010044Serpentine SoilKPRSLMMKNRIVRALIAALVASTLLLAGTAGYGPPGSGMIVSSVNW*
Ga0126311_1098946513300010045Serpentine SoilMKSRIARALVAALVAGTLILAGTAGFGPPGSGMIVSSVNW*
Ga0126320_117458213300010146SoilIKEFEMKSRIARALVAALVAGTLLLAGTAGFGPPGSGIIVSSVNW*
Ga0126306_1122514423300010166Serpentine SoilMKTRIVRALIAALVAGTLLFAGTAGMGPPGSGMIVTSVNW*
Ga0126376_1087707533300010359Tropical Forest SoilMKARIIRALAAALVAGTLILAGTAGVGPPGSGIVTSINW*
Ga0105239_1188044013300010375Corn RhizosphereMMKTRIIRALVAALVAGTLIFAGTAGLGPPGSGIIVSSVNW*
Ga0105239_1274361413300010375Corn RhizosphereMKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVVSSVNW*
Ga0134123_1162818923300010403Terrestrial SoilMMKTRIVRALIAALVAGTLLFAGTAGMGPPGSGVIVTSVNW*
Ga0105246_1043937223300011119Miscanthus RhizosphereMMKTRIVRALIAALVAGTLLFAGTAGMGPPGSGIIVSSV
Ga0127502_1108799423300011333SoilLSMKTRITRALIAALVAGTLLLAGTAGFGPPGSGIIVTQSVNW*
Ga0127502_1126616813300011333SoilPQTKEFEMKSRIARALVAALVAGTLILAGSAGLGPPGSGIIVSSVNW*
Ga0137463_121083323300011444SoilMKSRIARALIAALVAGTLILAGTAGLGPPGSGIIVSSVNW*
Ga0137377_1183400323300012211Vadose Zone SoilLKMKTRIIRALVAALVAGTLLLAGTAAYGLPGTNSSPLSVNW*
Ga0150985_10059641813300012212Avena Fatua RhizosphereRIARALIAALVAGTLLLAGTAGWAPPGTGVVVSSVNW*
Ga0150985_10113798343300012212Avena Fatua RhizosphereLPQTKEFEMKSRIARALVAALVAGTLIFAGSAGLGPPGSGMIVSSVNW*
Ga0150985_10212691933300012212Avena Fatua RhizosphereLYKPRSLMMKSRIVRALVAALVAGTLLFAGTAGMGPPGSGIIISSVNW*
Ga0150985_10474834443300012212Avena Fatua RhizosphereMKTRIARALVAALVAGTLLLAGTAGYGPPGSGIIVSSVNW*
Ga0150985_10513591133300012212Avena Fatua RhizosphereLYKPRSLRMKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVSSVNW*
Ga0150985_10651624323300012212Avena Fatua RhizosphereDLHKPRSLMMKTRIVRALIAALVAGTLIFAGTAGFGPPGSGMIVQSVNW*
Ga0150985_11153186943300012212Avena Fatua RhizosphereIARALVAALVAGTLLFAGTAAYGPPGSGIIVSSVNW*
Ga0150985_11520397543300012212Avena Fatua RhizosphereVGLYKPRSLMMKTRIARALIAALVAGTLLLAGTAGFSPPGTGVIVQSVNW*
Ga0150985_11632504413300012212Avena Fatua RhizosphereHKPRSLMMKTRIARALIAALVAATLIFAGTAGMGPPGSGIIVSSVNW*
Ga0150985_12096117713300012212Avena Fatua RhizosphereHKPRSLMMKTRIARALIAALVAGTLILAGTAGFGPPGSGMIVAQSVNW*
Ga0137369_1061345213300012355Vadose Zone SoilMKSRIARALIAALVAGTLILAGTAGLGPPGSGIIV
Ga0150984_10180902013300012469Avena Fatua RhizosphereLHKPRSLMMKTRIVRALIAALVAGTLIFAGTAGFGPPGSGMIVQSVNW*
Ga0150984_10257834513300012469Avena Fatua RhizospherePRSLMMKSRIVRALVAALVAGTLIFAGTAGMGPPGSGIIVSSVNW*
Ga0150984_10447169313300012469Avena Fatua RhizosphereLHKPRSLMMKTRIVRALIAALVAGTLLLAGTAGYGPPGSGIIVTSVNW*
Ga0150984_10720183743300012469Avena Fatua RhizosphereLYKPRSLTMKTRIARALIAALVAGTLLLAGTAGWAPPGTGVVVSSVNW*
Ga0150984_11036556533300012469Avena Fatua RhizospherePRSLMMKTRIARALIAALVAGTLLLAGTAGYGPPGSGIIVTSVNW*
Ga0150984_11041846813300012469Avena Fatua RhizosphereHKPRSLTMKTRIARALVAALVAGTLLLAGTAGYGPPGSGIIVSSVNW*
Ga0150984_11296497013300012469Avena Fatua RhizosphereLYKPRSLMMKTRIARALIAALVAGTLLLAGTAGFSPPGTGVIVQSVNW*
Ga0150984_11386945923300012469Avena Fatua RhizosphereVVIDLHKPRSLMMKTRIARALIAALVAGTLILAGTAGFGPPGSGMIVAQSVNW*
Ga0150984_11910690313300012469Avena Fatua RhizosphereLYKPRSLTMKTRITRALIAALVAGTLLLAGTAGWAPPGTGVVVSSVNW*
Ga0150984_11911281633300012469Avena Fatua RhizospherePIQTKEFEMKTRIARALVAALVAGTLLFAGTAAYGPPGSGIIVSSVNW*
Ga0164298_1064112923300012955SoilMKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVSSV
Ga0157378_1031973423300013297Miscanthus RhizosphereMKSRIARALVAALVAGTLILAGRAGVGPPGSGIIVSSVNW*
Ga0163163_1085110513300014325Switchgrass RhizosphereMMKSRIVRALVAALVAGTLLFAGTAGMGPPGSGII
Ga0132256_10203043923300015372Arabidopsis RhizosphereMMKTRIARALIAALVAGTLLLAGTAGFGPPGSGIIVTSVNW*
Ga0163161_1186514923300017792Switchgrass RhizosphereMKSRIVRALVAALVAGTLLFAGTAGMGPPGSGIIVSSVNW
Ga0184623_1025065223300018056Groundwater SedimentMKTRIVRALIAALVAGTLILAGTAGVGPPGSGIIVQSVNW
Ga0180110_109927523300019208Groundwater SedimentMMKTRIARALVAALVAGTLLLAGTAAYGPPGSGIIVTSVNW
Ga0180119_138561913300019228Groundwater SedimentKPRSLMMKSRIARALVAALVAGTLILAGTAGLGPPGSGIIVTSVNW
Ga0180116_117359813300019229Groundwater SedimentSRIARALVAALVAGTLIFAGTAGLGPPGSGVIVASVNW
Ga0180116_122297933300019229Groundwater SedimentLYKPRSLMMKTRIARALVAALVAGTLLLAGTAAYGPPGSGIIVTSVNW
Ga0180114_124533013300019232Groundwater SedimentHKPRSLMMKSRIARALVAALVAGTLILAGTAGLGPPGSGIIVTSVNW
Ga0180112_102648913300019238Groundwater SedimentTHKPRSLNMKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVASVNW
Ga0180117_126918513300019248Groundwater SedimentHKPRSLNMKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVSSVNW
Ga0184648_106717833300019249Groundwater SedimentAHKPRSLNMKSRIARALVAALVAGTLIFAGTAGLGPPGSGVIVASVNW
Ga0184648_150180113300019249Groundwater SedimentKPRSLIMKARIIRALAAALVAGTLILAGTAGLGPPGTGIVITHSVNW
Ga0184648_150889713300019249Groundwater SedimentHKPRSLNMKSRIARALVAALVAGTLIFAGTAGLGTPGSGIIVASVNW
Ga0180115_109281723300019257Groundwater SedimentDLYKPRSLMMKTRIARALVAALVAGTLLLAGTAAYGPPGSGIIVTSVNW
Ga0180115_143084213300019257Groundwater SedimentHKPRSLNMKSRIARALVAALVAGTLIFAGTAGLGPPGSGVIVASVNW
Ga0184646_102063523300019259Groundwater SedimentLTMKSRIVRALIAALVAGTLILAGTAGVGPPGSGIVSSVNW
Ga0184647_147768923300019263Groundwater SedimentLPQTKEFEMKSRIARALVAALVAGTLILAGSAGVGPPGSGIIVSSVNW
Ga0180118_122043633300020063Groundwater SedimentMMKSRIARALIAALVAGTLIFAGTAGLGPPGSGIIVQSVNW
Ga0180118_140105413300020063Groundwater SedimentKPRSLMMKTRIARALVAALVAGTLLLAGTAAYGPPGSGIIVTSVNW
Ga0180107_107730513300020064Groundwater SedimentPTHKPRSLMMKSRIARALVAALVAGTLILAGTAGLGPPGSGIIVTSVNW
Ga0180113_116992813300020065Groundwater SedimentTHKPRSLNMKSRIARALVAALVAGTLILAGTAGVGPPGSGIIVSSVNW
Ga0180109_100371733300020067Groundwater SedimentLHKPRSLMMKSRIARALIAALVAGTLIFAGTAGLGPPGSGIIVQSVNW
Ga0180109_111285033300020067Groundwater SedimentLNMKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVASVNW
Ga0184649_112388433300020068Groundwater SedimentDLHKPRSLTMKSRIVRALIAALVAGTLILAGTAGVGPPGSGIIVTSVNW
Ga0222624_158002213300021951Groundwater SedimentIQTKEFEMKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW
Ga0212090_1002760733300022561Glacier ValleyMKSRIARALVAALVAGTLILAGSAGLGPPGSGMIVSSVNW
Ga0207650_1115948313300025925Switchgrass RhizosphereMKTRIVRALIAALVAGTLLFAGTAGMGPPGSGIIVSSVNW
Ga0207709_1156298613300025935Miscanthus RhizosphereMMKSRIARALVAALVAGTLILAGTAGYGPPGSGIIVSSVNW
Ga0207669_1050755733300025937Miscanthus RhizosphereMKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVSSVNW
Ga0207658_1028028023300025986Switchgrass RhizosphereMMKSRIVRALVAALVAGTLLFAGTAGMGPPGSGIIVSSVNW
Ga0308202_103012013300030902SoilAEFEMKSRIARALVAALVAGTLILAGSAGVGPPGSGIIVSSVNW
Ga0308198_100494043300030904SoilEMKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW
Ga0308198_100700013300030904SoilKMKTRIIRALVAALVAGTLLLAGTAGYGLPGTNGATFSVNW
Ga0308198_101811213300030904SoilQTKEFEMKSRIARALVAALVAGTLILAGSAGVGPPGSGIIVSSVNW
Ga0308200_100879313300030905SoilLHKPRSLMMKSRIARALVAALVAGTLIFAGTAGMGPPGSGIIVSSVNW
Ga0308200_105234013300030905SoilEFEMKSRIVRALVAALVAGTLILAGTAGFGPPGSGIIVSSVNW
Ga0308200_113136613300030905SoilHKPRSLTMKTRIARALIAALVAGTLLLAGTAGYGPPGSGIIVSSVNW
Ga0308200_115962413300030905SoilTKEFEMKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW
Ga0308155_100663333300030987SoilEMKSRIARALVAALVAGTLILAGSAGVGPPGSGIIVSSVNW
Ga0308183_100912143300030988SoilFEMKSRIARALVAALVAGTLILAGSAGLGPPGSGIIVSSVNW
Ga0308183_106764123300030988SoilHKPRSLKMKSRIVRALIAALVAGTLILAGTAGVGPPGSGIVSSVNW
Ga0308196_101360313300030989SoilLRSLKMKTRIIRARVAALVAGTLLFAGTAGYGLPGTNGATLSVNW
Ga0308178_102413013300030990SoilQTKEFEMKSRIVRALVAALVAGTLILAGTAGFGPPGSGIIVSSVNW
Ga0308178_103287113300030990SoilRSLTMKSRIVRALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW
Ga0308178_104400813300030990SoilSLKMKTRIIRALVAALVAGTLLLAGTAGYGLPGTNGATFSVNW
Ga0308178_106341423300030990SoilQTKEFEMKSRIVRALVAALVAGTLILAGSAGVGPPGSGIIVSSVNW
Ga0308190_100805043300030993SoilSKLRSLKMKTRIIRALVAALVAGTLLLAGTAGYGLPGTNGATLSVNW
Ga0308190_111871613300030993SoilHKPRSLTMKTRIARALIAALVAGTLILAGTAGVGPPGSGMIVQSVNW
Ga0308189_1007517613300031058SoilLPQTKEFEMKSRIVRALVAALVAGTLILAGTAGFGPPGSGIIVSSVNW
Ga0308189_1007819313300031058SoilYKPRSLMMKTRIVRALIAALVAGTLLFAGTAGMGPPGSGIIVSSVNW
Ga0308185_105953413300031081SoilEFEMKSRIVRALVAALVAGTLILAGSAGVGPPGSGIIVSSVNW
Ga0308192_105618013300031082SoilMKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW
Ga0308192_105940923300031082SoilLPQTKEFEMKSRIARALVAALVAGTLILAGSAGLGPPGSGIIVSSVNW
Ga0308192_106601823300031082SoilEMKSRIARALVAALVAGTLIFAGSAGLGPPGSGIIVSSVNW
Ga0308197_1003032043300031093SoilFELRSLKMKTRIIRALVAALVAGTLLLAGTAGYGLPGTNGATLSVNW
Ga0308197_1003355613300031093SoilQIQTKEFEMKSRIARALVAALVAGTLILAGTAGVGPPGSGIIVSSVNW
Ga0308197_1010556113300031093SoilDLYKPRSLTMKSRIVRALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW
Ga0308197_1035366513300031093SoilPQTKEFEMKSRIVRALVAALVAGTLILAGTAGFGPPGSGIIVSSVNW
Ga0308199_100874443300031094SoilFELRSLKMKTRIIRALVAALVAGTLLLAGTAGYGLPGTNGATFSVNW
Ga0308184_100276643300031095SoilLQTKEFEMKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW
Ga0308193_102230733300031096SoilARALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW
Ga0308193_105438913300031096SoilPRSLTMKSRIVRALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW
Ga0308191_100901913300031098SoilLELRSLKMKTRIIRALVAALVAGTLLLAGTAGYGLPGTNGATLSVNW
Ga0308181_108873213300031099SoilQTKEFDMKSRIARSLIAALVAGTLILAGTAGVGPPGSGIIVSSVNW
Ga0308187_1007734513300031114SoilMKSRIVRALVAALVAGTLILAGSAGVGPPGSGIIVSSVNW
Ga0308187_1022969323300031114SoilSLKMKTRIIRALVAALVAGTLLLAGTAAYGLPGTNGATLSVNW
Ga0308187_1046956923300031114SoilRIVRALVAALVAGTLILAGTAGFGPPGSGIIVSSVNW
Ga0308195_103266713300031123SoilQTQTKEFEMKSRIARALVAALVAGTLILAGSAGVGPPGSGIIVSSVNW
Ga0308195_103908113300031123SoilKPRSLTMKSRIVRALIAALIAGTLILAGTAGVGPPGSGMIVHSVNW
Ga0308195_106899923300031123SoilQTKEFEMKSRIARALVAALVAGTLIFAGTAGFGPPGSGIIVSSVNW
Ga0308182_102743223300031125SoilYKPRSLTMKSRIARALIAALVAGTLILAGTAGVGPPGSGIVSSVNW
Ga0170824_11120276723300031231Forest SoilFEMKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW
Ga0308194_1008017713300031421SoilLRKPRSLMMKTRIVRALIAALVAGTLLLAGTAGYGPPGSGMIVSSVNW
Ga0308194_1024507813300031421SoilYKPRSLTMKSRIVRALIAALIAGTLILAGTAGVGPPGSGMIVQSVNW
Ga0308194_1034809513300031421SoilKPRSLTMKTRIARALIAALVAGTLILAGTAGVGPPGSGMIVQSVNW
Ga0314816_101396833300031481SoilEMKSRIARALVAALVAGTLILAGSAGLGPPGSGIIVSSVNW
Ga0307415_10023727643300032126RhizosphereMKARIIRALAAALVAGTLILAGTAGLGPPGTGIIVAQSVNW
Ga0370545_011077_26_1483300034643SoilMKSRIVRALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW
Ga0370545_026994_22_1443300034643SoilMKSRIARALIAALVAGTLILAGTAGLGPPGSGIIVSSVNW
Ga0370545_159230_392_5143300034643SoilMKSRIVRALIAALVAGTLILAGTAGVGPPGSGMIVQSVNW
Ga0370548_080497_2_1333300034644SoilEFEMKSRIARALVAALVAGTLIFAGSAGLGPPGSGIIVSSVNW
Ga0314782_014897_2_1483300034661SoilLHKPRSLMMKSRIVRALVAALVAGTLLFAGTAGMGPPGSGIIVSSVNW
Ga0314786_036575_2_1453300034664SoilHKPRSLMMKSRIVRALVAALVAGTLLFAGTAGMGPPGSGIIVSSVNW
Ga0314797_100473_2_1213300034672SoilKSRIARALVAALVAGTLILAGTAGFGPPGSGIIVSSVNW
Ga0314798_097479_23_1483300034673SoilMMKSRIARALVAALVAGTLIFAGTAGMGPPGSGIIVSSVNW
Ga0314798_125798_20_1453300034673SoilMMKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVSSVNW
Ga0314801_048282_728_8353300034676SoilVRALVAALVAGTLIFAGTAGMGPPGSGIIVSSVNW
Ga0314801_075870_12_1373300034676SoilMKARIVRALAAALVAGTLILAGTAGLGPPGSGIIVVQSVNW
Ga0314801_174379_392_5353300034676SoilPQTKEFEMKSRIARALVAALVAGTLIFAGSAGLGPPGSGIIVSSVNW
Ga0370541_008103_2_1483300034680SoilLHKPRSLTMKTRIARALIAALVAGTLILAGTAGVGPPGSGMIVQSVNW
Ga0370541_025316_1_1443300034680SoilTQTKEFEMKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.