| Basic Information | |
|---|---|
| Family ID | F039973 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 162 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MMKSRIARALVAALVAGTLILAGTAGYGPPGSGIIVSSVNW |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 162 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 25.31 % |
| % of genes near scaffold ends (potentially truncated) | 72.22 % |
| % of genes from short scaffolds (< 2000 bps) | 98.15 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.358 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (31.482 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.185 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.654 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 36.23% β-sheet: 0.00% Coil/Unstructured: 63.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 162 Family Scaffolds |
|---|---|---|
| PF03704 | BTAD | 6.79 |
| PF02518 | HATPase_c | 1.23 |
| PF02782 | FGGY_C | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 162 Family Scaffolds |
|---|---|---|---|
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 6.79 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 6.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.36 % |
| Unclassified | root | N/A | 8.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003163|Ga0006759J45824_1067462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 556 | Open in IMG/M |
| 3300003163|Ga0006759J45824_1070489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 557 | Open in IMG/M |
| 3300003316|rootH1_10157734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus | 1164 | Open in IMG/M |
| 3300003544|Ga0007417J51691_1077022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 991 | Open in IMG/M |
| 3300003570|Ga0007418J51697_1064580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 773 | Open in IMG/M |
| 3300003574|Ga0007410J51695_1052166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 675 | Open in IMG/M |
| 3300004114|Ga0062593_103373125 | Not Available | 512 | Open in IMG/M |
| 3300004479|Ga0062595_101557017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae | 613 | Open in IMG/M |
| 3300004798|Ga0058859_10019386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1027 | Open in IMG/M |
| 3300004798|Ga0058859_10139412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 879 | Open in IMG/M |
| 3300004798|Ga0058859_11614595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 640 | Open in IMG/M |
| 3300004798|Ga0058859_11815773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1015 | Open in IMG/M |
| 3300004801|Ga0058860_11858060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 524 | Open in IMG/M |
| 3300005340|Ga0070689_100476046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1066 | Open in IMG/M |
| 3300005344|Ga0070661_100663165 | Not Available | 847 | Open in IMG/M |
| 3300005355|Ga0070671_101002553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 732 | Open in IMG/M |
| 3300005356|Ga0070674_101206399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 672 | Open in IMG/M |
| 3300005365|Ga0070688_101118716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 630 | Open in IMG/M |
| 3300005445|Ga0070708_100696915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 956 | Open in IMG/M |
| 3300005518|Ga0070699_101198853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 696 | Open in IMG/M |
| 3300005841|Ga0068863_100197115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1936 | Open in IMG/M |
| 3300005843|Ga0068860_101866076 | Not Available | 623 | Open in IMG/M |
| 3300005843|Ga0068860_102115765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 584 | Open in IMG/M |
| 3300006844|Ga0075428_101278301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 772 | Open in IMG/M |
| 3300006880|Ga0075429_100448018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae | 1131 | Open in IMG/M |
| 3300009147|Ga0114129_10872763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1142 | Open in IMG/M |
| 3300009162|Ga0075423_10765961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1021 | Open in IMG/M |
| 3300009177|Ga0105248_13246839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 517 | Open in IMG/M |
| 3300009553|Ga0105249_10929819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae | 937 | Open in IMG/M |
| 3300009553|Ga0105249_11223644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 822 | Open in IMG/M |
| 3300009553|Ga0105249_13175317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae | 528 | Open in IMG/M |
| 3300009686|Ga0123338_10009978 | All Organisms → cellular organisms → Bacteria | 7414 | Open in IMG/M |
| 3300010039|Ga0126309_10784708 | Not Available | 620 | Open in IMG/M |
| 3300010044|Ga0126310_10493861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 893 | Open in IMG/M |
| 3300010044|Ga0126310_10606338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 817 | Open in IMG/M |
| 3300010045|Ga0126311_10989465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae | 687 | Open in IMG/M |
| 3300010146|Ga0126320_1174582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 771 | Open in IMG/M |
| 3300010166|Ga0126306_11225144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 617 | Open in IMG/M |
| 3300010359|Ga0126376_10877075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 885 | Open in IMG/M |
| 3300010375|Ga0105239_11880440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 694 | Open in IMG/M |
| 3300010375|Ga0105239_12743614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae | 575 | Open in IMG/M |
| 3300010403|Ga0134123_11628189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae | 694 | Open in IMG/M |
| 3300011119|Ga0105246_10439372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae | 1094 | Open in IMG/M |
| 3300011333|Ga0127502_11087994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 773 | Open in IMG/M |
| 3300011333|Ga0127502_11266168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 809 | Open in IMG/M |
| 3300011444|Ga0137463_1210833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 727 | Open in IMG/M |
| 3300012211|Ga0137377_11834003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 525 | Open in IMG/M |
| 3300012212|Ga0150985_100596418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1599 | Open in IMG/M |
| 3300012212|Ga0150985_101137983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 2127 | Open in IMG/M |
| 3300012212|Ga0150985_102126919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 960 | Open in IMG/M |
| 3300012212|Ga0150985_104748344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1194 | Open in IMG/M |
| 3300012212|Ga0150985_105135911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 994 | Open in IMG/M |
| 3300012212|Ga0150985_106516243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 745 | Open in IMG/M |
| 3300012212|Ga0150985_111531869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1247 | Open in IMG/M |
| 3300012212|Ga0150985_115203975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1552 | Open in IMG/M |
| 3300012212|Ga0150985_116325044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 865 | Open in IMG/M |
| 3300012212|Ga0150985_120961177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 637 | Open in IMG/M |
| 3300012355|Ga0137369_10613452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae | 755 | Open in IMG/M |
| 3300012469|Ga0150984_101809020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1920 | Open in IMG/M |
| 3300012469|Ga0150984_102578345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 886 | Open in IMG/M |
| 3300012469|Ga0150984_104471693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1512 | Open in IMG/M |
| 3300012469|Ga0150984_107201837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1835 | Open in IMG/M |
| 3300012469|Ga0150984_110365565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1017 | Open in IMG/M |
| 3300012469|Ga0150984_110418468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1416 | Open in IMG/M |
| 3300012469|Ga0150984_112964970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus | 1155 | Open in IMG/M |
| 3300012469|Ga0150984_113869459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 751 | Open in IMG/M |
| 3300012469|Ga0150984_119106903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1454 | Open in IMG/M |
| 3300012469|Ga0150984_119112816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 901 | Open in IMG/M |
| 3300012955|Ga0164298_10641129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae | 736 | Open in IMG/M |
| 3300013297|Ga0157378_10319734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 1507 | Open in IMG/M |
| 3300014325|Ga0163163_10851105 | Not Available | 975 | Open in IMG/M |
| 3300015372|Ga0132256_102030439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 681 | Open in IMG/M |
| 3300017792|Ga0163161_11865149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 535 | Open in IMG/M |
| 3300018056|Ga0184623_10250652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae | 808 | Open in IMG/M |
| 3300019208|Ga0180110_1099275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 669 | Open in IMG/M |
| 3300019228|Ga0180119_1385619 | Not Available | 1026 | Open in IMG/M |
| 3300019229|Ga0180116_1173598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 675 | Open in IMG/M |
| 3300019229|Ga0180116_1222979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 926 | Open in IMG/M |
| 3300019232|Ga0180114_1245330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 685 | Open in IMG/M |
| 3300019238|Ga0180112_1026489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 824 | Open in IMG/M |
| 3300019248|Ga0180117_1269185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 774 | Open in IMG/M |
| 3300019249|Ga0184648_1067178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 903 | Open in IMG/M |
| 3300019249|Ga0184648_1501801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 535 | Open in IMG/M |
| 3300019249|Ga0184648_1508897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 636 | Open in IMG/M |
| 3300019257|Ga0180115_1092817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 505 | Open in IMG/M |
| 3300019257|Ga0180115_1430842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus | 1014 | Open in IMG/M |
| 3300019259|Ga0184646_1020635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 545 | Open in IMG/M |
| 3300019263|Ga0184647_1477689 | Not Available | 567 | Open in IMG/M |
| 3300020063|Ga0180118_1220436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 867 | Open in IMG/M |
| 3300020063|Ga0180118_1401054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 579 | Open in IMG/M |
| 3300020064|Ga0180107_1077305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 877 | Open in IMG/M |
| 3300020065|Ga0180113_1169928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 615 | Open in IMG/M |
| 3300020067|Ga0180109_1003717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 852 | Open in IMG/M |
| 3300020067|Ga0180109_1112850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus | 1000 | Open in IMG/M |
| 3300020068|Ga0184649_1123884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus | 1030 | Open in IMG/M |
| 3300021951|Ga0222624_1580022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 776 | Open in IMG/M |
| 3300022561|Ga0212090_10027607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus | 6770 | Open in IMG/M |
| 3300025925|Ga0207650_11159483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 658 | Open in IMG/M |
| 3300025935|Ga0207709_11562986 | Not Available | 548 | Open in IMG/M |
| 3300025937|Ga0207669_10507557 | Not Available | 966 | Open in IMG/M |
| 3300025986|Ga0207658_10280280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus | 1429 | Open in IMG/M |
| 3300030902|Ga0308202_1030120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 910 | Open in IMG/M |
| 3300030904|Ga0308198_1004940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1424 | Open in IMG/M |
| 3300030904|Ga0308198_1007000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1268 | Open in IMG/M |
| 3300030904|Ga0308198_1018112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 921 | Open in IMG/M |
| 3300030905|Ga0308200_1008793 | Not Available | 1409 | Open in IMG/M |
| 3300030905|Ga0308200_1052340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 767 | Open in IMG/M |
| 3300030905|Ga0308200_1131366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 562 | Open in IMG/M |
| 3300030905|Ga0308200_1159624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 527 | Open in IMG/M |
| 3300030987|Ga0308155_1006633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 858 | Open in IMG/M |
| 3300030988|Ga0308183_1009121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1474 | Open in IMG/M |
| 3300030988|Ga0308183_1067641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 754 | Open in IMG/M |
| 3300030989|Ga0308196_1013603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 877 | Open in IMG/M |
| 3300030990|Ga0308178_1024130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus | 990 | Open in IMG/M |
| 3300030990|Ga0308178_1032871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 895 | Open in IMG/M |
| 3300030990|Ga0308178_1044008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 812 | Open in IMG/M |
| 3300030990|Ga0308178_1063414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 718 | Open in IMG/M |
| 3300030993|Ga0308190_1008050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1463 | Open in IMG/M |
| 3300030993|Ga0308190_1118716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 599 | Open in IMG/M |
| 3300031058|Ga0308189_10075176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus | 1010 | Open in IMG/M |
| 3300031058|Ga0308189_10078193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus | 997 | Open in IMG/M |
| 3300031081|Ga0308185_1059534 | Not Available | 503 | Open in IMG/M |
| 3300031082|Ga0308192_1056180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 601 | Open in IMG/M |
| 3300031082|Ga0308192_1059409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 589 | Open in IMG/M |
| 3300031082|Ga0308192_1066018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 569 | Open in IMG/M |
| 3300031093|Ga0308197_10030320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1266 | Open in IMG/M |
| 3300031093|Ga0308197_10033556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1224 | Open in IMG/M |
| 3300031093|Ga0308197_10105561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 841 | Open in IMG/M |
| 3300031093|Ga0308197_10353665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 560 | Open in IMG/M |
| 3300031094|Ga0308199_1008744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1480 | Open in IMG/M |
| 3300031095|Ga0308184_1002766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1309 | Open in IMG/M |
| 3300031096|Ga0308193_1022307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 823 | Open in IMG/M |
| 3300031096|Ga0308193_1054389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 608 | Open in IMG/M |
| 3300031098|Ga0308191_1009019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 875 | Open in IMG/M |
| 3300031099|Ga0308181_1088732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 652 | Open in IMG/M |
| 3300031114|Ga0308187_10077345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 985 | Open in IMG/M |
| 3300031114|Ga0308187_10229693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 664 | Open in IMG/M |
| 3300031114|Ga0308187_10469569 | Not Available | 511 | Open in IMG/M |
| 3300031123|Ga0308195_1032667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 693 | Open in IMG/M |
| 3300031123|Ga0308195_1039081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 654 | Open in IMG/M |
| 3300031123|Ga0308195_1068999 | Not Available | 545 | Open in IMG/M |
| 3300031125|Ga0308182_1027432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 511 | Open in IMG/M |
| 3300031231|Ga0170824_111202767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 512 | Open in IMG/M |
| 3300031421|Ga0308194_10080177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 901 | Open in IMG/M |
| 3300031421|Ga0308194_10245078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 599 | Open in IMG/M |
| 3300031421|Ga0308194_10348095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 527 | Open in IMG/M |
| 3300031481|Ga0314816_1013968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 962 | Open in IMG/M |
| 3300032126|Ga0307415_100237276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1473 | Open in IMG/M |
| 3300034643|Ga0370545_011077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1365 | Open in IMG/M |
| 3300034643|Ga0370545_026994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. | 1008 | Open in IMG/M |
| 3300034643|Ga0370545_159230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 524 | Open in IMG/M |
| 3300034644|Ga0370548_080497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 631 | Open in IMG/M |
| 3300034661|Ga0314782_014897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1249 | Open in IMG/M |
| 3300034664|Ga0314786_036575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 872 | Open in IMG/M |
| 3300034672|Ga0314797_100473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 593 | Open in IMG/M |
| 3300034673|Ga0314798_097479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 617 | Open in IMG/M |
| 3300034673|Ga0314798_125798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 566 | Open in IMG/M |
| 3300034676|Ga0314801_048282 | Not Available | 835 | Open in IMG/M |
| 3300034676|Ga0314801_075870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 714 | Open in IMG/M |
| 3300034676|Ga0314801_174379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 535 | Open in IMG/M |
| 3300034680|Ga0370541_008103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 1012 | Open in IMG/M |
| 3300034680|Ga0370541_025316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 691 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 31.48% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 13.58% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 8.02% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 7.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.94% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.09% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 3.09% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 1.23% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.23% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.23% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.23% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.62% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.62% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.62% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.62% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003316 | Sugarcane root Sample L1 | Host-Associated | Open in IMG/M |
| 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003570 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_34 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009686 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - groundupSSSS metaG | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300019208 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019228 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019229 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019232 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019238 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019257 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020064 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020065 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020068 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022561 | Borup_combined assembly | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030987 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031081 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031082 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031095 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031098 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_186 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031123 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031125 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_153 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031481 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034673 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0006759J45824_10674621 | 3300003163 | Avena Fatua Rhizosphere | KEFEMKSRIARALVAALVAGTLLLAGTAGFGPPGSGIIVSSVNW* |
| Ga0006759J45824_10704891 | 3300003163 | Avena Fatua Rhizosphere | MKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVASSVNW* |
| rootH1_101577343 | 3300003316 | Sugarcane Root And Bulk Soil | MKTRIARALIAALVAGTLLLAGTAAYGPPGSGIIVSSVNW* |
| Ga0007417J51691_10770221 | 3300003544 | Avena Fatua Rhizosphere | SLKMKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVASSVNW* |
| Ga0007418J51697_10645801 | 3300003570 | Avena Fatua Rhizosphere | TKEFEMKSRIARALVAALVAGTLIFAGSAGLGPPGSGIIVSSVNW* |
| Ga0007410J51695_10521661 | 3300003574 | Avena Fatua Rhizosphere | QIKEFEMKSRIARALVAALVAGTLLLAGTAGFGPPGSGIIVSSVNW* |
| Ga0062593_1033731251 | 3300004114 | Soil | MKTRIVRALVAALVAGTLLLAGTAGYIPPGPKGMIVTSVNW* |
| Ga0062595_1015570171 | 3300004479 | Soil | MMKSRIARVLIAALVAGTLILAGTAGVGPPGSGMIVSSVN |
| Ga0058859_100193861 | 3300004798 | Host-Associated | KPRSLMMKTRIVRALIAALVAGTLLFAGTAGMGPPGSGIIVSSVNW* |
| Ga0058859_101394123 | 3300004798 | Host-Associated | KPRSLMMKSRIVRALVAALVAGTLLFAGTAGMGPPGSGIIVSSVNW* |
| Ga0058859_116145952 | 3300004798 | Host-Associated | KPRSLMMKSRIARALVAALVAGTLILAGTAGYGPPGSGIIVTSVNW* |
| Ga0058859_118157732 | 3300004798 | Host-Associated | MKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVSSVNW* |
| Ga0058860_118580602 | 3300004801 | Host-Associated | MKTRIVRALIAALVAGTLLFAGTAGMGPPGSGIIVSSVNW* |
| Ga0070689_1004760461 | 3300005340 | Switchgrass Rhizosphere | MMKSRIVRALVAALVAGTLLFAGTAGMGPPGSGIIVSSVNW* |
| Ga0070661_1006631652 | 3300005344 | Corn Rhizosphere | MKSRIVRALVAALVAGTLLFAGTAGMGPPGSGIIVSSVNW* |
| Ga0070671_1010025532 | 3300005355 | Switchgrass Rhizosphere | MKTRIARALVAALVAGTLLFAGTAAYGPPGSGIVVSSVNW* |
| Ga0070674_1012063991 | 3300005356 | Miscanthus Rhizosphere | GIIVAAVVVDSHKPRSLNMKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVSSVNW* |
| Ga0070688_1011187162 | 3300005365 | Switchgrass Rhizosphere | MKSRIVRALVAALVAGTLIFAGSAGLGPPGSGIIVSSVSW* |
| Ga0070708_1006969151 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSRIVRALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW* |
| Ga0070699_1011988532 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW* |
| Ga0068863_1001971151 | 3300005841 | Switchgrass Rhizosphere | HKPRSLMMKSRIVRALVAALVAGTLLFAGTAGMGPPGSGIIVSSVNW* |
| Ga0068860_1018660762 | 3300005843 | Switchgrass Rhizosphere | MKSRIVRALVAALVAGTLILAGTAGFGPPGSGIIVSSVNW* |
| Ga0068860_1021157652 | 3300005843 | Switchgrass Rhizosphere | VATVTIDFYKPRSLMMKTRIVRALIAALVAGTLLFAGTAGMGPPGSGIIVSSVNW* |
| Ga0075428_1012783012 | 3300006844 | Populus Rhizosphere | MKSRIARALVAALVAGTLILAGTAGVGPPGSGIIVQSVNW* |
| Ga0075429_1004480181 | 3300006880 | Populus Rhizosphere | MKSRIARALIAALVAGTLILAGTAGVGPPGSGMIV |
| Ga0114129_108727632 | 3300009147 | Populus Rhizosphere | MKSRIARALIAALVAGTLILAGTAGVGPPGSGMIVSSVNW* |
| Ga0075423_107659612 | 3300009162 | Populus Rhizosphere | LAIVATVIDALELRSLKMKTRILRALVAALVAGTLLLAGTAGYGLPGTNGAALSVNW* |
| Ga0105248_132468391 | 3300009177 | Switchgrass Rhizosphere | MKSRIVRALVAALVAGTLILAGTAGFGPPGSGIIVSSVN |
| Ga0105249_109298192 | 3300009553 | Switchgrass Rhizosphere | MKSRIVRALVAALVAGTLILAGTAGFGPPGSGIIVSSV |
| Ga0105249_112236441 | 3300009553 | Switchgrass Rhizosphere | MMKTRIVRALIAALVAGTLLFAGTAGMGPPGSGIIVSSVNW* |
| Ga0105249_131753171 | 3300009553 | Switchgrass Rhizosphere | MMKSRIVRALVAALVAGTLIFAGTAGMGPPGSGIIVSS |
| Ga0123338_100099785 | 3300009686 | Glacier Valley | MKSRIARALVAALVAGTLILAGSAGLGPPGSGMIVSSVNW* |
| Ga0126309_107847082 | 3300010039 | Serpentine Soil | MKSRIVRALIAALVAGTLILAGTAGVGPPGSGMIVSSVNW* |
| Ga0126310_104938611 | 3300010044 | Serpentine Soil | MKSRIARALVAALVAGTLIFAGSAGLGPPGSGIIVSSVNW* |
| Ga0126310_106063381 | 3300010044 | Serpentine Soil | KPRSLMMKNRIVRALIAALVASTLLLAGTAGYGPPGSGMIVSSVNW* |
| Ga0126311_109894651 | 3300010045 | Serpentine Soil | MKSRIARALVAALVAGTLILAGTAGFGPPGSGMIVSSVNW* |
| Ga0126320_11745821 | 3300010146 | Soil | IKEFEMKSRIARALVAALVAGTLLLAGTAGFGPPGSGIIVSSVNW* |
| Ga0126306_112251442 | 3300010166 | Serpentine Soil | MKTRIVRALIAALVAGTLLFAGTAGMGPPGSGMIVTSVNW* |
| Ga0126376_108770753 | 3300010359 | Tropical Forest Soil | MKARIIRALAAALVAGTLILAGTAGVGPPGSGIVTSINW* |
| Ga0105239_118804401 | 3300010375 | Corn Rhizosphere | MMKTRIIRALVAALVAGTLIFAGTAGLGPPGSGIIVSSVNW* |
| Ga0105239_127436141 | 3300010375 | Corn Rhizosphere | MKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVVSSVNW* |
| Ga0134123_116281892 | 3300010403 | Terrestrial Soil | MMKTRIVRALIAALVAGTLLFAGTAGMGPPGSGVIVTSVNW* |
| Ga0105246_104393722 | 3300011119 | Miscanthus Rhizosphere | MMKTRIVRALIAALVAGTLLFAGTAGMGPPGSGIIVSSV |
| Ga0127502_110879942 | 3300011333 | Soil | LSMKTRITRALIAALVAGTLLLAGTAGFGPPGSGIIVTQSVNW* |
| Ga0127502_112661681 | 3300011333 | Soil | PQTKEFEMKSRIARALVAALVAGTLILAGSAGLGPPGSGIIVSSVNW* |
| Ga0137463_12108332 | 3300011444 | Soil | MKSRIARALIAALVAGTLILAGTAGLGPPGSGIIVSSVNW* |
| Ga0137377_118340032 | 3300012211 | Vadose Zone Soil | LKMKTRIIRALVAALVAGTLLLAGTAAYGLPGTNSSPLSVNW* |
| Ga0150985_1005964181 | 3300012212 | Avena Fatua Rhizosphere | RIARALIAALVAGTLLLAGTAGWAPPGTGVVVSSVNW* |
| Ga0150985_1011379834 | 3300012212 | Avena Fatua Rhizosphere | LPQTKEFEMKSRIARALVAALVAGTLIFAGSAGLGPPGSGMIVSSVNW* |
| Ga0150985_1021269193 | 3300012212 | Avena Fatua Rhizosphere | LYKPRSLMMKSRIVRALVAALVAGTLLFAGTAGMGPPGSGIIISSVNW* |
| Ga0150985_1047483444 | 3300012212 | Avena Fatua Rhizosphere | MKTRIARALVAALVAGTLLLAGTAGYGPPGSGIIVSSVNW* |
| Ga0150985_1051359113 | 3300012212 | Avena Fatua Rhizosphere | LYKPRSLRMKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVSSVNW* |
| Ga0150985_1065162432 | 3300012212 | Avena Fatua Rhizosphere | DLHKPRSLMMKTRIVRALIAALVAGTLIFAGTAGFGPPGSGMIVQSVNW* |
| Ga0150985_1115318694 | 3300012212 | Avena Fatua Rhizosphere | IARALVAALVAGTLLFAGTAAYGPPGSGIIVSSVNW* |
| Ga0150985_1152039754 | 3300012212 | Avena Fatua Rhizosphere | VGLYKPRSLMMKTRIARALIAALVAGTLLLAGTAGFSPPGTGVIVQSVNW* |
| Ga0150985_1163250441 | 3300012212 | Avena Fatua Rhizosphere | HKPRSLMMKTRIARALIAALVAATLIFAGTAGMGPPGSGIIVSSVNW* |
| Ga0150985_1209611771 | 3300012212 | Avena Fatua Rhizosphere | HKPRSLMMKTRIARALIAALVAGTLILAGTAGFGPPGSGMIVAQSVNW* |
| Ga0137369_106134521 | 3300012355 | Vadose Zone Soil | MKSRIARALIAALVAGTLILAGTAGLGPPGSGIIV |
| Ga0150984_1018090201 | 3300012469 | Avena Fatua Rhizosphere | LHKPRSLMMKTRIVRALIAALVAGTLIFAGTAGFGPPGSGMIVQSVNW* |
| Ga0150984_1025783451 | 3300012469 | Avena Fatua Rhizosphere | PRSLMMKSRIVRALVAALVAGTLIFAGTAGMGPPGSGIIVSSVNW* |
| Ga0150984_1044716931 | 3300012469 | Avena Fatua Rhizosphere | LHKPRSLMMKTRIVRALIAALVAGTLLLAGTAGYGPPGSGIIVTSVNW* |
| Ga0150984_1072018374 | 3300012469 | Avena Fatua Rhizosphere | LYKPRSLTMKTRIARALIAALVAGTLLLAGTAGWAPPGTGVVVSSVNW* |
| Ga0150984_1103655653 | 3300012469 | Avena Fatua Rhizosphere | PRSLMMKTRIARALIAALVAGTLLLAGTAGYGPPGSGIIVTSVNW* |
| Ga0150984_1104184681 | 3300012469 | Avena Fatua Rhizosphere | HKPRSLTMKTRIARALVAALVAGTLLLAGTAGYGPPGSGIIVSSVNW* |
| Ga0150984_1129649701 | 3300012469 | Avena Fatua Rhizosphere | LYKPRSLMMKTRIARALIAALVAGTLLLAGTAGFSPPGTGVIVQSVNW* |
| Ga0150984_1138694592 | 3300012469 | Avena Fatua Rhizosphere | VVIDLHKPRSLMMKTRIARALIAALVAGTLILAGTAGFGPPGSGMIVAQSVNW* |
| Ga0150984_1191069031 | 3300012469 | Avena Fatua Rhizosphere | LYKPRSLTMKTRITRALIAALVAGTLLLAGTAGWAPPGTGVVVSSVNW* |
| Ga0150984_1191128163 | 3300012469 | Avena Fatua Rhizosphere | PIQTKEFEMKTRIARALVAALVAGTLLFAGTAAYGPPGSGIIVSSVNW* |
| Ga0164298_106411292 | 3300012955 | Soil | MKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVSSV |
| Ga0157378_103197342 | 3300013297 | Miscanthus Rhizosphere | MKSRIARALVAALVAGTLILAGRAGVGPPGSGIIVSSVNW* |
| Ga0163163_108511051 | 3300014325 | Switchgrass Rhizosphere | MMKSRIVRALVAALVAGTLLFAGTAGMGPPGSGII |
| Ga0132256_1020304392 | 3300015372 | Arabidopsis Rhizosphere | MMKTRIARALIAALVAGTLLLAGTAGFGPPGSGIIVTSVNW* |
| Ga0163161_118651492 | 3300017792 | Switchgrass Rhizosphere | MKSRIVRALVAALVAGTLLFAGTAGMGPPGSGIIVSSVNW |
| Ga0184623_102506522 | 3300018056 | Groundwater Sediment | MKTRIVRALIAALVAGTLILAGTAGVGPPGSGIIVQSVNW |
| Ga0180110_10992752 | 3300019208 | Groundwater Sediment | MMKTRIARALVAALVAGTLLLAGTAAYGPPGSGIIVTSVNW |
| Ga0180119_13856191 | 3300019228 | Groundwater Sediment | KPRSLMMKSRIARALVAALVAGTLILAGTAGLGPPGSGIIVTSVNW |
| Ga0180116_11735981 | 3300019229 | Groundwater Sediment | SRIARALVAALVAGTLIFAGTAGLGPPGSGVIVASVNW |
| Ga0180116_12229793 | 3300019229 | Groundwater Sediment | LYKPRSLMMKTRIARALVAALVAGTLLLAGTAAYGPPGSGIIVTSVNW |
| Ga0180114_12453301 | 3300019232 | Groundwater Sediment | HKPRSLMMKSRIARALVAALVAGTLILAGTAGLGPPGSGIIVTSVNW |
| Ga0180112_10264891 | 3300019238 | Groundwater Sediment | THKPRSLNMKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVASVNW |
| Ga0180117_12691851 | 3300019248 | Groundwater Sediment | HKPRSLNMKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVSSVNW |
| Ga0184648_10671783 | 3300019249 | Groundwater Sediment | AHKPRSLNMKSRIARALVAALVAGTLIFAGTAGLGPPGSGVIVASVNW |
| Ga0184648_15018011 | 3300019249 | Groundwater Sediment | KPRSLIMKARIIRALAAALVAGTLILAGTAGLGPPGTGIVITHSVNW |
| Ga0184648_15088971 | 3300019249 | Groundwater Sediment | HKPRSLNMKSRIARALVAALVAGTLIFAGTAGLGTPGSGIIVASVNW |
| Ga0180115_10928172 | 3300019257 | Groundwater Sediment | DLYKPRSLMMKTRIARALVAALVAGTLLLAGTAAYGPPGSGIIVTSVNW |
| Ga0180115_14308421 | 3300019257 | Groundwater Sediment | HKPRSLNMKSRIARALVAALVAGTLIFAGTAGLGPPGSGVIVASVNW |
| Ga0184646_10206352 | 3300019259 | Groundwater Sediment | LTMKSRIVRALIAALVAGTLILAGTAGVGPPGSGIVSSVNW |
| Ga0184647_14776892 | 3300019263 | Groundwater Sediment | LPQTKEFEMKSRIARALVAALVAGTLILAGSAGVGPPGSGIIVSSVNW |
| Ga0180118_12204363 | 3300020063 | Groundwater Sediment | MMKSRIARALIAALVAGTLIFAGTAGLGPPGSGIIVQSVNW |
| Ga0180118_14010541 | 3300020063 | Groundwater Sediment | KPRSLMMKTRIARALVAALVAGTLLLAGTAAYGPPGSGIIVTSVNW |
| Ga0180107_10773051 | 3300020064 | Groundwater Sediment | PTHKPRSLMMKSRIARALVAALVAGTLILAGTAGLGPPGSGIIVTSVNW |
| Ga0180113_11699281 | 3300020065 | Groundwater Sediment | THKPRSLNMKSRIARALVAALVAGTLILAGTAGVGPPGSGIIVSSVNW |
| Ga0180109_10037173 | 3300020067 | Groundwater Sediment | LHKPRSLMMKSRIARALIAALVAGTLIFAGTAGLGPPGSGIIVQSVNW |
| Ga0180109_11128503 | 3300020067 | Groundwater Sediment | LNMKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVASVNW |
| Ga0184649_11238843 | 3300020068 | Groundwater Sediment | DLHKPRSLTMKSRIVRALIAALVAGTLILAGTAGVGPPGSGIIVTSVNW |
| Ga0222624_15800221 | 3300021951 | Groundwater Sediment | IQTKEFEMKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW |
| Ga0212090_100276073 | 3300022561 | Glacier Valley | MKSRIARALVAALVAGTLILAGSAGLGPPGSGMIVSSVNW |
| Ga0207650_111594831 | 3300025925 | Switchgrass Rhizosphere | MKTRIVRALIAALVAGTLLFAGTAGMGPPGSGIIVSSVNW |
| Ga0207709_115629861 | 3300025935 | Miscanthus Rhizosphere | MMKSRIARALVAALVAGTLILAGTAGYGPPGSGIIVSSVNW |
| Ga0207669_105075573 | 3300025937 | Miscanthus Rhizosphere | MKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVSSVNW |
| Ga0207658_102802802 | 3300025986 | Switchgrass Rhizosphere | MMKSRIVRALVAALVAGTLLFAGTAGMGPPGSGIIVSSVNW |
| Ga0308202_10301201 | 3300030902 | Soil | AEFEMKSRIARALVAALVAGTLILAGSAGVGPPGSGIIVSSVNW |
| Ga0308198_10049404 | 3300030904 | Soil | EMKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW |
| Ga0308198_10070001 | 3300030904 | Soil | KMKTRIIRALVAALVAGTLLLAGTAGYGLPGTNGATFSVNW |
| Ga0308198_10181121 | 3300030904 | Soil | QTKEFEMKSRIARALVAALVAGTLILAGSAGVGPPGSGIIVSSVNW |
| Ga0308200_10087931 | 3300030905 | Soil | LHKPRSLMMKSRIARALVAALVAGTLIFAGTAGMGPPGSGIIVSSVNW |
| Ga0308200_10523401 | 3300030905 | Soil | EFEMKSRIVRALVAALVAGTLILAGTAGFGPPGSGIIVSSVNW |
| Ga0308200_11313661 | 3300030905 | Soil | HKPRSLTMKTRIARALIAALVAGTLLLAGTAGYGPPGSGIIVSSVNW |
| Ga0308200_11596241 | 3300030905 | Soil | TKEFEMKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW |
| Ga0308155_10066333 | 3300030987 | Soil | EMKSRIARALVAALVAGTLILAGSAGVGPPGSGIIVSSVNW |
| Ga0308183_10091214 | 3300030988 | Soil | FEMKSRIARALVAALVAGTLILAGSAGLGPPGSGIIVSSVNW |
| Ga0308183_10676412 | 3300030988 | Soil | HKPRSLKMKSRIVRALIAALVAGTLILAGTAGVGPPGSGIVSSVNW |
| Ga0308196_10136031 | 3300030989 | Soil | LRSLKMKTRIIRARVAALVAGTLLFAGTAGYGLPGTNGATLSVNW |
| Ga0308178_10241301 | 3300030990 | Soil | QTKEFEMKSRIVRALVAALVAGTLILAGTAGFGPPGSGIIVSSVNW |
| Ga0308178_10328711 | 3300030990 | Soil | RSLTMKSRIVRALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW |
| Ga0308178_10440081 | 3300030990 | Soil | SLKMKTRIIRALVAALVAGTLLLAGTAGYGLPGTNGATFSVNW |
| Ga0308178_10634142 | 3300030990 | Soil | QTKEFEMKSRIVRALVAALVAGTLILAGSAGVGPPGSGIIVSSVNW |
| Ga0308190_10080504 | 3300030993 | Soil | SKLRSLKMKTRIIRALVAALVAGTLLLAGTAGYGLPGTNGATLSVNW |
| Ga0308190_11187161 | 3300030993 | Soil | HKPRSLTMKTRIARALIAALVAGTLILAGTAGVGPPGSGMIVQSVNW |
| Ga0308189_100751761 | 3300031058 | Soil | LPQTKEFEMKSRIVRALVAALVAGTLILAGTAGFGPPGSGIIVSSVNW |
| Ga0308189_100781931 | 3300031058 | Soil | YKPRSLMMKTRIVRALIAALVAGTLLFAGTAGMGPPGSGIIVSSVNW |
| Ga0308185_10595341 | 3300031081 | Soil | EFEMKSRIVRALVAALVAGTLILAGSAGVGPPGSGIIVSSVNW |
| Ga0308192_10561801 | 3300031082 | Soil | MKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW |
| Ga0308192_10594092 | 3300031082 | Soil | LPQTKEFEMKSRIARALVAALVAGTLILAGSAGLGPPGSGIIVSSVNW |
| Ga0308192_10660182 | 3300031082 | Soil | EMKSRIARALVAALVAGTLIFAGSAGLGPPGSGIIVSSVNW |
| Ga0308197_100303204 | 3300031093 | Soil | FELRSLKMKTRIIRALVAALVAGTLLLAGTAGYGLPGTNGATLSVNW |
| Ga0308197_100335561 | 3300031093 | Soil | QIQTKEFEMKSRIARALVAALVAGTLILAGTAGVGPPGSGIIVSSVNW |
| Ga0308197_101055611 | 3300031093 | Soil | DLYKPRSLTMKSRIVRALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW |
| Ga0308197_103536651 | 3300031093 | Soil | PQTKEFEMKSRIVRALVAALVAGTLILAGTAGFGPPGSGIIVSSVNW |
| Ga0308199_10087444 | 3300031094 | Soil | FELRSLKMKTRIIRALVAALVAGTLLLAGTAGYGLPGTNGATFSVNW |
| Ga0308184_10027664 | 3300031095 | Soil | LQTKEFEMKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW |
| Ga0308193_10223073 | 3300031096 | Soil | ARALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW |
| Ga0308193_10543891 | 3300031096 | Soil | PRSLTMKSRIVRALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW |
| Ga0308191_10090191 | 3300031098 | Soil | LELRSLKMKTRIIRALVAALVAGTLLLAGTAGYGLPGTNGATLSVNW |
| Ga0308181_10887321 | 3300031099 | Soil | QTKEFDMKSRIARSLIAALVAGTLILAGTAGVGPPGSGIIVSSVNW |
| Ga0308187_100773451 | 3300031114 | Soil | MKSRIVRALVAALVAGTLILAGSAGVGPPGSGIIVSSVNW |
| Ga0308187_102296932 | 3300031114 | Soil | SLKMKTRIIRALVAALVAGTLLLAGTAAYGLPGTNGATLSVNW |
| Ga0308187_104695692 | 3300031114 | Soil | RIVRALVAALVAGTLILAGTAGFGPPGSGIIVSSVNW |
| Ga0308195_10326671 | 3300031123 | Soil | QTQTKEFEMKSRIARALVAALVAGTLILAGSAGVGPPGSGIIVSSVNW |
| Ga0308195_10390811 | 3300031123 | Soil | KPRSLTMKSRIVRALIAALIAGTLILAGTAGVGPPGSGMIVHSVNW |
| Ga0308195_10689992 | 3300031123 | Soil | QTKEFEMKSRIARALVAALVAGTLIFAGTAGFGPPGSGIIVSSVNW |
| Ga0308182_10274322 | 3300031125 | Soil | YKPRSLTMKSRIARALIAALVAGTLILAGTAGVGPPGSGIVSSVNW |
| Ga0170824_1112027672 | 3300031231 | Forest Soil | FEMKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW |
| Ga0308194_100801771 | 3300031421 | Soil | LRKPRSLMMKTRIVRALIAALVAGTLLLAGTAGYGPPGSGMIVSSVNW |
| Ga0308194_102450781 | 3300031421 | Soil | YKPRSLTMKSRIVRALIAALIAGTLILAGTAGVGPPGSGMIVQSVNW |
| Ga0308194_103480951 | 3300031421 | Soil | KPRSLTMKTRIARALIAALVAGTLILAGTAGVGPPGSGMIVQSVNW |
| Ga0314816_10139683 | 3300031481 | Soil | EMKSRIARALVAALVAGTLILAGSAGLGPPGSGIIVSSVNW |
| Ga0307415_1002372764 | 3300032126 | Rhizosphere | MKARIIRALAAALVAGTLILAGTAGLGPPGTGIIVAQSVNW |
| Ga0370545_011077_26_148 | 3300034643 | Soil | MKSRIVRALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW |
| Ga0370545_026994_22_144 | 3300034643 | Soil | MKSRIARALIAALVAGTLILAGTAGLGPPGSGIIVSSVNW |
| Ga0370545_159230_392_514 | 3300034643 | Soil | MKSRIVRALIAALVAGTLILAGTAGVGPPGSGMIVQSVNW |
| Ga0370548_080497_2_133 | 3300034644 | Soil | EFEMKSRIARALVAALVAGTLIFAGSAGLGPPGSGIIVSSVNW |
| Ga0314782_014897_2_148 | 3300034661 | Soil | LHKPRSLMMKSRIVRALVAALVAGTLLFAGTAGMGPPGSGIIVSSVNW |
| Ga0314786_036575_2_145 | 3300034664 | Soil | HKPRSLMMKSRIVRALVAALVAGTLLFAGTAGMGPPGSGIIVSSVNW |
| Ga0314797_100473_2_121 | 3300034672 | Soil | KSRIARALVAALVAGTLILAGTAGFGPPGSGIIVSSVNW |
| Ga0314798_097479_23_148 | 3300034673 | Soil | MMKSRIARALVAALVAGTLIFAGTAGMGPPGSGIIVSSVNW |
| Ga0314798_125798_20_145 | 3300034673 | Soil | MMKSRIARALVAALVAGTLIFAGTAGLGPPGSGIIVSSVNW |
| Ga0314801_048282_728_835 | 3300034676 | Soil | VRALVAALVAGTLIFAGTAGMGPPGSGIIVSSVNW |
| Ga0314801_075870_12_137 | 3300034676 | Soil | MKARIVRALAAALVAGTLILAGTAGLGPPGSGIIVVQSVNW |
| Ga0314801_174379_392_535 | 3300034676 | Soil | PQTKEFEMKSRIARALVAALVAGTLIFAGSAGLGPPGSGIIVSSVNW |
| Ga0370541_008103_2_148 | 3300034680 | Soil | LHKPRSLTMKTRIARALIAALVAGTLILAGTAGVGPPGSGMIVQSVNW |
| Ga0370541_025316_1_144 | 3300034680 | Soil | TQTKEFEMKSRIARALIAALVAGTLILAGTAGVGPPGSGIIVSSVNW |
| ⦗Top⦘ |