| Basic Information | |
|---|---|
| Family ID | F039930 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 162 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LTLSELVRMLGDFAEIAVTILLAYVVYKIASLIDTLNGKIKGEKSI |
| Number of Associated Samples | 64 |
| Number of Associated Scaffolds | 162 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 85.19 % |
| % of genes near scaffold ends (potentially truncated) | 6.17 % |
| % of genes from short scaffolds (< 2000 bps) | 55.56 % |
| Associated GOLD sequencing projects | 58 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (77.160 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (45.679 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.852 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (44.444 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.11% β-sheet: 0.00% Coil/Unstructured: 41.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 162 Family Scaffolds |
|---|---|---|
| PF09826 | Beta_propel | 54.32 |
| PF00557 | Peptidase_M24 | 6.17 |
| PF08714 | Fae | 5.56 |
| PF13685 | Fe-ADH_2 | 5.56 |
| PF14801 | GCD14_N | 3.09 |
| PF08704 | GCD14 | 3.09 |
| PF01321 | Creatinase_N | 1.23 |
| PF01726 | LexA_DNA_bind | 1.23 |
| PF02662 | FlpD | 0.62 |
| PF00702 | Hydrolase | 0.62 |
| PF01978 | TrmB | 0.62 |
| PF13673 | Acetyltransf_10 | 0.62 |
| PF12675 | DUF3795 | 0.62 |
| PF13229 | Beta_helix | 0.62 |
| PF05048 | NosD | 0.62 |
| PF00374 | NiFeSe_Hases | 0.62 |
| PF00348 | polyprenyl_synt | 0.62 |
| PF01750 | HycI | 0.62 |
| PF00082 | Peptidase_S8 | 0.62 |
| PF01865 | PhoU_div | 0.62 |
| PF03447 | NAD_binding_3 | 0.62 |
| PF12706 | Lactamase_B_2 | 0.62 |
| PF01909 | NTP_transf_2 | 0.62 |
| PF02919 | Topoisom_I_N | 0.62 |
| PF07705 | CARDB | 0.62 |
| PF12327 | FtsZ_C | 0.62 |
| PF07992 | Pyr_redox_2 | 0.62 |
| PF01402 | RHH_1 | 0.62 |
| PF01451 | LMWPc | 0.62 |
| PF02754 | CCG | 0.62 |
| PF04277 | OAD_gamma | 0.62 |
| PF01979 | Amidohydro_1 | 0.62 |
| PF00496 | SBP_bac_5 | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 162 Family Scaffolds |
|---|---|---|---|
| COG1795 | Formaldehyde-activating enzyme (5,6,7,8-tetrahydromethanopterin hydrolyase) | Energy production and conversion [C] | 5.56 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 3.09 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 1.23 |
| COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 0.62 |
| COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.62 |
| COG0374 | Ni,Fe-hydrogenase I large subunit | Energy production and conversion [C] | 0.62 |
| COG0680 | Ni,Fe-hydrogenase maturation factor | Energy production and conversion [C] | 0.62 |
| COG1392 | Phosphate transport regulator YkaA, distantly related to PhoU, UPF0111/DUF47 family | Inorganic ion transport and metabolism [P] | 0.62 |
| COG1908 | Coenzyme F420-reducing hydrogenase, delta subunit | Energy production and conversion [C] | 0.62 |
| COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.62 |
| COG3259 | Coenzyme F420-reducing hydrogenase, alpha subunit | Energy production and conversion [C] | 0.62 |
| COG3569 | DNA topoisomerase IB | Replication, recombination and repair [L] | 0.62 |
| COG3630 | Na+-transporting oxaloacetate/methylmalonyl-CoA decarboxylase, gamma subunit | Energy production and conversion [C] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.01 % |
| Unclassified | root | N/A | 20.99 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001749|JGI24025J20009_10050614 | Not Available | 1589 | Open in IMG/M |
| 3300001749|JGI24025J20009_10062847 | Not Available | 1303 | Open in IMG/M |
| 3300001749|JGI24025J20009_10070991 | All Organisms → cellular organisms → Archaea | 1162 | Open in IMG/M |
| 3300001749|JGI24025J20009_10093473 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 890 | Open in IMG/M |
| 3300001749|JGI24025J20009_10128851 | Not Available | 653 | Open in IMG/M |
| 3300001782|WOR52_10006370 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 20162 | Open in IMG/M |
| 3300001854|JGI24422J19971_10021421 | All Organisms → cellular organisms → Archaea | 3906 | Open in IMG/M |
| 3300001854|JGI24422J19971_10027232 | Not Available | 3417 | Open in IMG/M |
| 3300001854|JGI24422J19971_10160475 | All Organisms → cellular organisms → Archaea | 1035 | Open in IMG/M |
| 3300002966|JGI24721J44947_10012954 | All Organisms → cellular organisms → Archaea | 10213 | Open in IMG/M |
| 3300002966|JGI24721J44947_10044477 | All Organisms → cellular organisms → Archaea | 3921 | Open in IMG/M |
| 3300003332|GBSed_10018508 | All Organisms → cellular organisms → Archaea | 3086 | Open in IMG/M |
| 3300003332|GBSed_10046294 | All Organisms → cellular organisms → Archaea | 1554 | Open in IMG/M |
| 3300003859|Ga0031653_10060044 | Not Available | 1016 | Open in IMG/M |
| 3300003859|Ga0031653_10099229 | All Organisms → cellular organisms → Archaea | 763 | Open in IMG/M |
| 3300003891|Ga0063011_10002237 | All Organisms → cellular organisms → Archaea | 85106 | Open in IMG/M |
| 3300004107|Ga0065179_1147629 | All Organisms → cellular organisms → Archaea | 711 | Open in IMG/M |
| 3300004143|Ga0066630_1080270 | Not Available | 830 | Open in IMG/M |
| 3300004212|Ga0066631_10232305 | All Organisms → cellular organisms → Archaea | 836 | Open in IMG/M |
| 3300005573|Ga0078972_1008360 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 21753 | Open in IMG/M |
| 3300005573|Ga0078972_1330288 | Not Available | 547 | Open in IMG/M |
| 3300005782|Ga0079367_1007195 | All Organisms → cellular organisms → Archaea | 5834 | Open in IMG/M |
| 3300009034|Ga0115863_1000341 | All Organisms → cellular organisms → Archaea | 68464 | Open in IMG/M |
| 3300009034|Ga0115863_1106343 | All Organisms → cellular organisms → Archaea | 3491 | Open in IMG/M |
| 3300009034|Ga0115863_1518545 | All Organisms → cellular organisms → Archaea | 1361 | Open in IMG/M |
| 3300009034|Ga0115863_1762181 | All Organisms → cellular organisms → Archaea | 1079 | Open in IMG/M |
| 3300009503|Ga0123519_10364813 | Not Available | 854 | Open in IMG/M |
| 3300009529|Ga0114919_10029754 | All Organisms → cellular organisms → Archaea | 4109 | Open in IMG/M |
| 3300010284|Ga0129301_1011900 | All Organisms → cellular organisms → Archaea → TACK group | 2526 | Open in IMG/M |
| 3300010324|Ga0129297_10124093 | All Organisms → cellular organisms → Archaea | 1210 | Open in IMG/M |
| 3300010324|Ga0129297_10363575 | Not Available | 647 | Open in IMG/M |
| 3300010328|Ga0129298_10001650 | All Organisms → cellular organisms → Archaea | 9473 | Open in IMG/M |
| 3300010328|Ga0129298_10071379 | Not Available | 1650 | Open in IMG/M |
| 3300010328|Ga0129298_10110388 | All Organisms → cellular organisms → Archaea | 1301 | Open in IMG/M |
| 3300010328|Ga0129298_10329454 | Not Available | 704 | Open in IMG/M |
| 3300010328|Ga0129298_10423418 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 610 | Open in IMG/M |
| 3300012931|Ga0153915_10206032 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2160 | Open in IMG/M |
| 3300012931|Ga0153915_10584652 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 1283 | Open in IMG/M |
| 3300012931|Ga0153915_11495806 | All Organisms → cellular organisms → Archaea | 789 | Open in IMG/M |
| 3300012931|Ga0153915_12601678 | All Organisms → cellular organisms → Archaea → TACK group | 592 | Open in IMG/M |
| 3300012964|Ga0153916_10138891 | All Organisms → cellular organisms → Archaea | 2357 | Open in IMG/M |
| 3300012964|Ga0153916_10343483 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1540 | Open in IMG/M |
| 3300012964|Ga0153916_11167986 | All Organisms → cellular organisms → Archaea → TACK group | 849 | Open in IMG/M |
| 3300012964|Ga0153916_11604612 | All Organisms → cellular organisms → Archaea | 725 | Open in IMG/M |
| 3300012964|Ga0153916_13191079 | Not Available | 516 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10025939 | All Organisms → cellular organisms → Bacteria | 4106 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10063691 | All Organisms → cellular organisms → Archaea | 2413 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10070877 | All Organisms → cellular organisms → Archaea | 2264 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10100235 | Not Available | 1849 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10151863 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1512 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10294743 | All Organisms → cellular organisms → Archaea | 1010 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10318365 | All Organisms → cellular organisms → Archaea | 963 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10039521 | All Organisms → cellular organisms → Archaea | 3461 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10011860 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 6868 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10013957 | All Organisms → cellular organisms → Bacteria | 6277 | Open in IMG/M |
| 3300014149|Ga0181613_1080621 | All Organisms → cellular organisms → Archaea | 901 | Open in IMG/M |
| 3300014913|Ga0164310_10246568 | All Organisms → cellular organisms → Archaea | 1078 | Open in IMG/M |
| 3300017966|Ga0187776_10062722 | Not Available | 2138 | Open in IMG/M |
| 3300017966|Ga0187776_11557950 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 509 | Open in IMG/M |
| 3300018089|Ga0187774_11422904 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 509 | Open in IMG/M |
| 3300019245|Ga0187791_1328528 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 2190 | Open in IMG/M |
| 3300022204|Ga0224496_10307450 | All Organisms → cellular organisms → Archaea | 648 | Open in IMG/M |
| 3300022208|Ga0224495_10071320 | All Organisms → cellular organisms → Archaea | 1547 | Open in IMG/M |
| 3300022221|Ga0224506_10000945 | All Organisms → cellular organisms → Archaea | 21857 | Open in IMG/M |
| 3300022221|Ga0224506_10091790 | All Organisms → cellular organisms → Archaea | 1470 | Open in IMG/M |
| 3300022221|Ga0224506_10385180 | Not Available | 620 | Open in IMG/M |
| 3300022223|Ga0224501_10001221 | All Organisms → cellular organisms → Archaea | 19883 | Open in IMG/M |
| 3300022548|Ga0212092_1019062 | All Organisms → cellular organisms → Archaea | 4300 | Open in IMG/M |
| 3300022551|Ga0212089_10004105 | All Organisms → cellular organisms → Archaea | 10610 | Open in IMG/M |
| 3300022551|Ga0212089_10028284 | Not Available | 3506 | Open in IMG/M |
| 3300022551|Ga0212089_10169015 | All Organisms → cellular organisms → Archaea | 1100 | Open in IMG/M |
| 3300022551|Ga0212089_10251471 | All Organisms → cellular organisms → Archaea | 848 | Open in IMG/M |
| 3300022551|Ga0212089_10370957 | All Organisms → cellular organisms → Archaea | 656 | Open in IMG/M |
| 3300024263|Ga0209978_10008987 | All Organisms → cellular organisms → Archaea | 4726 | Open in IMG/M |
| 3300024433|Ga0209986_10004083 | All Organisms → cellular organisms → Archaea | 12517 | Open in IMG/M |
| 3300025022|Ga0210056_1069939 | All Organisms → cellular organisms → Archaea | 1512 | Open in IMG/M |
| 3300025036|Ga0210049_1093910 | All Organisms → cellular organisms → Archaea | 1533 | Open in IMG/M |
| 3300025119|Ga0209126_1180816 | All Organisms → cellular organisms → Archaea | 556 | Open in IMG/M |
| 3300027742|Ga0209121_10062121 | All Organisms → cellular organisms → Archaea | 1816 | Open in IMG/M |
| 3300027742|Ga0209121_10134461 | Not Available | 976 | Open in IMG/M |
| 3300027742|Ga0209121_10154639 | Not Available | 876 | Open in IMG/M |
| 3300027742|Ga0209121_10242117 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 621 | Open in IMG/M |
| 3300027863|Ga0207433_10007159 | All Organisms → cellular organisms → Archaea | 18834 | Open in IMG/M |
| 3300027863|Ga0207433_10039168 | All Organisms → cellular organisms → Archaea | 5467 | Open in IMG/M |
| 3300027888|Ga0209635_10082595 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2631 | Open in IMG/M |
| 3300027888|Ga0209635_11082909 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 545 | Open in IMG/M |
| 3300027893|Ga0209636_10002623 | All Organisms → cellular organisms → Archaea | 18354 | Open in IMG/M |
| 3300027893|Ga0209636_10125131 | Not Available | 2444 | Open in IMG/M |
| 3300027893|Ga0209636_10219189 | All Organisms → cellular organisms → Archaea | 1733 | Open in IMG/M |
| 3300027900|Ga0209253_10009070 | All Organisms → cellular organisms → Archaea | 8555 | Open in IMG/M |
| 3300029977|Ga0272449_1000056 | All Organisms → cellular organisms → Archaea | 162302 | Open in IMG/M |
| 3300031463|Ga0272448_1019695 | All Organisms → cellular organisms → Archaea | 6141 | Open in IMG/M |
| 3300031463|Ga0272448_1417297 | All Organisms → cellular organisms → Archaea | 509 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1004596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 7670 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1010070 | All Organisms → cellular organisms → Archaea | 4982 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1026319 | All Organisms → cellular organisms → Archaea | 2808 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1048204 | All Organisms → cellular organisms → Archaea | 1924 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1071473 | All Organisms → cellular organisms → Archaea | 1489 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1072555 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1474 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1073132 | All Organisms → cellular organisms → Archaea | 1467 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1094701 | All Organisms → cellular organisms → Archaea | 1237 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1153309 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 893 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1208758 | All Organisms → cellular organisms → Archaea | 718 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1210576 | All Organisms → cellular organisms → Archaea → TACK group | 713 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1280323 | All Organisms → cellular organisms → Archaea | 580 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1313536 | Not Available | 535 | Open in IMG/M |
| (restricted) 3300031593|Ga0315307_1037107 | All Organisms → cellular organisms → Archaea | 1915 | Open in IMG/M |
| (restricted) 3300031593|Ga0315307_1078847 | All Organisms → cellular organisms → Archaea | 1209 | Open in IMG/M |
| (restricted) 3300031593|Ga0315307_1087415 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1133 | Open in IMG/M |
| (restricted) 3300031593|Ga0315307_1099446 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1045 | Open in IMG/M |
| (restricted) 3300031604|Ga0315309_1006980 | All Organisms → cellular organisms → Archaea | 6225 | Open in IMG/M |
| (restricted) 3300031806|Ga0315306_10000624 | All Organisms → cellular organisms → Archaea | 17192 | Open in IMG/M |
| (restricted) 3300031806|Ga0315306_10047599 | Not Available | 1682 | Open in IMG/M |
| (restricted) 3300031806|Ga0315306_10126740 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 971 | Open in IMG/M |
| 3300031862|Ga0315280_10003474 | All Organisms → cellular organisms → Archaea | 24185 | Open in IMG/M |
| 3300031862|Ga0315280_10005692 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 17626 | Open in IMG/M |
| 3300031862|Ga0315280_10010125 | All Organisms → cellular organisms → Archaea | 11897 | Open in IMG/M |
| 3300031862|Ga0315280_10185334 | All Organisms → cellular organisms → Archaea | 1215 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10000005 | All Organisms → cellular organisms → Archaea | 183206 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10000043 | All Organisms → cellular organisms → Archaea | 84149 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10052662 | All Organisms → cellular organisms → Archaea | 2167 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10073609 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1746 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10154017 | Not Available | 1070 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10186431 | Not Available | 941 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1001046 | All Organisms → cellular organisms → Archaea | 26300 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1001542 | All Organisms → cellular organisms → Archaea | 20692 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1005832 | All Organisms → cellular organisms → Archaea → TACK group | 8821 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1006610 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 8135 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1007715 | All Organisms → cellular organisms → Archaea | 7347 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1011429 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 5707 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1019124 | All Organisms → cellular organisms → Archaea | 4027 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1020500 | All Organisms → cellular organisms → Archaea | 3841 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1056961 | Not Available | 1851 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1120734 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1056 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1213099 | Not Available | 683 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1220249 | All Organisms → cellular organisms → Archaea → TACK group | 666 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1278021 | All Organisms → cellular organisms → Archaea | 558 | Open in IMG/M |
| (restricted) 3300031898|Ga0315312_1004120 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 9001 | Open in IMG/M |
| 3300032020|Ga0315296_10026940 | All Organisms → cellular organisms → Archaea | 4079 | Open in IMG/M |
| 3300032069|Ga0315282_10131062 | Not Available | 2059 | Open in IMG/M |
| 3300032069|Ga0315282_10358549 | Not Available | 906 | Open in IMG/M |
| 3300032069|Ga0315282_10568375 | Not Available | 622 | Open in IMG/M |
| 3300032118|Ga0315277_10000277 | All Organisms → cellular organisms → Archaea | 85242 | Open in IMG/M |
| 3300032118|Ga0315277_10008556 | All Organisms → cellular organisms → Archaea | 13145 | Open in IMG/M |
| 3300032118|Ga0315277_10101920 | All Organisms → cellular organisms → Archaea | 3234 | Open in IMG/M |
| 3300032118|Ga0315277_11485160 | Not Available | 581 | Open in IMG/M |
| 3300032163|Ga0315281_11080857 | Not Available | 808 | Open in IMG/M |
| 3300032173|Ga0315268_10000005 | All Organisms → cellular organisms → Archaea | 273858 | Open in IMG/M |
| 3300032173|Ga0315268_10022283 | All Organisms → cellular organisms → Archaea | 6253 | Open in IMG/M |
| 3300032173|Ga0315268_10067595 | Not Available | 3369 | Open in IMG/M |
| 3300032173|Ga0315268_10149928 | Not Available | 2215 | Open in IMG/M |
| 3300032173|Ga0315268_10150168 | Not Available | 2213 | Open in IMG/M |
| 3300032173|Ga0315268_10240398 | All Organisms → cellular organisms → Archaea | 1741 | Open in IMG/M |
| 3300032173|Ga0315268_10635394 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1061 | Open in IMG/M |
| 3300032173|Ga0315268_12325600 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 550 | Open in IMG/M |
| 3300032829|Ga0335070_10132519 | Not Available | 2560 | Open in IMG/M |
| 3300033991|Ga0334965_0001076 | All Organisms → cellular organisms → Archaea | 21073 | Open in IMG/M |
| 3300033991|Ga0334965_0004948 | All Organisms → cellular organisms → Archaea | 8318 | Open in IMG/M |
| 3300034078|Ga0373900_013030 | All Organisms → cellular organisms → Archaea | 1288 | Open in IMG/M |
| 3300034078|Ga0373900_066412 | All Organisms → cellular organisms → Archaea → TACK group | 670 | Open in IMG/M |
| 3300034078|Ga0373900_094551 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 577 | Open in IMG/M |
| 3300034099|Ga0373902_143709 | All Organisms → cellular organisms → Archaea | 565 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 45.68% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 7.41% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 5.56% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 5.56% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 4.94% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 4.32% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 3.70% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 3.09% |
| Sediment, Intertidal | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal | 2.47% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 2.47% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.85% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.85% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 1.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.85% |
| Marine Hydrothermal Vent Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent Sediment | 1.23% |
| Hot Spring Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Microbial Mats → Hot Spring Microbial Mat | 1.23% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.62% |
| Marine Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment | 0.62% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.62% |
| Hot Spring Sediments | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediments | 0.62% |
| Anoxic, Neutral-Ph, Fe/Si-Rich Hot Spring Water | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Anoxic, Neutral-Ph, Fe/Si-Rich Hot Spring Water | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.62% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001749 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 | Environmental | Open in IMG/M |
| 3300001782 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_deep_samples | Environmental | Open in IMG/M |
| 3300001854 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 | Environmental | Open in IMG/M |
| 3300002966 | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 | Environmental | Open in IMG/M |
| 3300003332 | Marine hydrothermal vent sediment microbial communities from Guaymas Basin, Gulf of California - Sample 1 | Environmental | Open in IMG/M |
| 3300003859 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR | Environmental | Open in IMG/M |
| 3300003891 | Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing sample CP Core 1 1cm | Environmental | Open in IMG/M |
| 3300004107 | Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/8/14 3 um filter (version 2) | Environmental | Open in IMG/M |
| 3300004143 | Groundwater microbial communities from aquifer - Crystal Geyser CG01_land_8/20/14_3.00 | Environmental | Open in IMG/M |
| 3300004212 | Groundwater microbial communities from aquifer - Crystal Geyser CG02_land_8/20/14_3.00 | Environmental | Open in IMG/M |
| 3300005573 | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPADES assembly) | Environmental | Open in IMG/M |
| 3300005782 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf, PM3 | Environmental | Open in IMG/M |
| 3300009034 | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea | Environmental | Open in IMG/M |
| 3300009503 | Hot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02 | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300010284 | Hot spring microbial mat communities from California, USA to study Microbial Dark Matter (Phase II) - Cone Pool mat layer H metaG | Environmental | Open in IMG/M |
| 3300010324 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaG | Environmental | Open in IMG/M |
| 3300010328 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300014149 | In situ water column microbial community from the vent pool of Chocolate Pots hot spring, Yellowstone National Park, Wyoming, USA - CP Vent Pool | Environmental | Open in IMG/M |
| 3300014913 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay1, Core 4569-9, 0-3 cm | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019245 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022204 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022208 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022223 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022548 | Cone Pool_combined assembly | Environmental | Open in IMG/M |
| 3300022551 | Boni_combined assembly | Environmental | Open in IMG/M |
| 3300024263 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025022 | Groundwater microbial communities from aquifer - Crystal Geyser CG07_land_8/20/14_0.80 (SPAdes) | Environmental | Open in IMG/M |
| 3300025036 | Groundwater microbial communities from aquifer - Crystal Geyser CG06_land_8/20/14_3.00 (SPAdes) | Environmental | Open in IMG/M |
| 3300025119 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027742 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027863 | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027893 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300029977 | Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-024-1 | Environmental | Open in IMG/M |
| 3300031463 | Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-019-1 | Environmental | Open in IMG/M |
| 3300031587 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP3 | Environmental | Open in IMG/M |
| 3300031593 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP2 | Environmental | Open in IMG/M |
| 3300031604 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP4 | Environmental | Open in IMG/M |
| 3300031806 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP1 | Environmental | Open in IMG/M |
| 3300031862 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40 | Environmental | Open in IMG/M |
| 3300031876 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP5 | Environmental | Open in IMG/M |
| 3300031877 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP9 | Environmental | Open in IMG/M |
| 3300031898 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP7 | Environmental | Open in IMG/M |
| 3300032020 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18 | Environmental | Open in IMG/M |
| 3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033991 | Sediment microbial communities from Lake Vrana, Zadar, Croatia - 4 bact | Environmental | Open in IMG/M |
| 3300034078 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.1 | Engineered | Open in IMG/M |
| 3300034099 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.3 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24025J20009_100506143 | 3300001749 | Marine | LALGDFVRMLGDIAEITVTILLAYVVYKIAMLVDTLTCKIKGEKNS* |
| JGI24025J20009_100628472 | 3300001749 | Marine | LALGDFVRMLGDVAEIAVTILLAYVVYKIAMLVDTLNCKIKGEKNS* |
| JGI24025J20009_100709912 | 3300001749 | Marine | LTLSELIRMLGDFAEIAVTILLAYVVYKIAMLIDTLNSKIKGQKNP* |
| JGI24025J20009_100934732 | 3300001749 | Marine | LTLSELIRMLGDFAEIAVTILLAYVVYXIAMLIDTLNSKIKGQKNP* |
| JGI24025J20009_101288511 | 3300001749 | Marine | LTLSELVRMLGDFAEIAVTILLAYVVYKIATLIDTLNSKIKEEKNP* |
| WOR52_100063703 | 3300001782 | Marine Sediment | LSLSEFVRMLGDLTEIAVTILLAYVVYKIAILIDTLSFKIKKEKSS* |
| JGI24422J19971_100214216 | 3300001854 | Marine Sediment | LSLTEFTRMLGDLAEIAVTILLAYVVYKIAILIDTFNCKIKKEKSP* |
| JGI24422J19971_100272324 | 3300001854 | Marine Sediment | LALGDFIRMLGDVAEIMVTVLLAYVVYKIAGLVDTLSRKIKGEKNS* |
| JGI24422J19971_101604752 | 3300001854 | Marine Sediment | LSLTEFTRMLGDLAEIAVTILLAYVVYKIAILIDTFDCKIKKEKSS* |
| JGI24721J44947_100129544 | 3300002966 | Hot Spring | VTLSEFVKMIGDFAEMAVTILSAYAVYKIAMLIDVLSGKIKREKEE* |
| JGI24721J44947_100444772 | 3300002966 | Hot Spring | MTLSELIRMLGDFAEVAVTILLAYVVYKVAVLIDVLNSRLKREG* |
| GBSed_100185083 | 3300003332 | Marine Hydrothermal Vent Sediment | LTLKELVSMFGDFAEIAVTILLAYVVYKIAILVDTLNGKIKGEKSP* |
| GBSed_100462943 | 3300003332 | Marine Hydrothermal Vent Sediment | VSLSGLIGMVGDIAEIAVTILLVYAVYKMVVLLDTLNSKMKGEKTV* |
| Ga0031653_100600442 | 3300003859 | Freshwater Lake Sediment | MGLSETVSILGDVAEITVTILLAYVVYKIGAFVDTINHEIKEERETR* |
| Ga0031653_100992292 | 3300003859 | Freshwater Lake Sediment | LNLSELVRLVGDLAEVAVTILLAYVVFKIAMLVESLNTRLREGKSS* |
| Ga0063011_1000223734 | 3300003891 | Hot Spring Sediments | MCKRRRLPLTLSELVRMLGDFAEIAVTILLAYVVLKIAHLIDTLNSRIKAEKTA* |
| Ga0065179_11476292 | 3300004107 | Groundwater | LTLSELVKMLADFAEIAVTILLAYVVYKIARLIETLNSKIREEKS* |
| Ga0066630_10802702 | 3300004143 | Groundwater | LTLSEIVKMLADITEIAVTILLAYVVYKIAALIETLNTKIKGEKSQ* |
| Ga0066631_102323052 | 3300004212 | Groundwater | LSEIVKMLADITEIAVTILLAYVVYKIAALIETLNTKIKGEKSQ* |
| Ga0078972_100836021 | 3300005573 | Hot Spring | VTLSEFVKMIGDFAEMAVTILSAYAVYKIAMLIDVLSGKIKREKAE* |
| Ga0078972_13302881 | 3300005573 | Hot Spring | MTLSELIRMLEDFAEIAVTILLAYVVYKVAVLIDTLNSRLKREG* |
| Ga0079367_10071953 | 3300005782 | Marine Sediment | LALGDFVRMLGDIAEITVTILLAYVVYKIAMLVDTLNCKIKGEKNS* |
| Ga0115863_10003417 | 3300009034 | Sediment, Intertidal | MFGDFAEIAVTVLLAYVVYKIAMLVDTLNGKIKGEKSP* |
| Ga0115863_11063432 | 3300009034 | Sediment, Intertidal | MLGDVAEIAVTILLVYVVYKIAILVDTVSRKIKGEKSP* |
| Ga0115863_15185452 | 3300009034 | Sediment, Intertidal | MLGDVAEIMVTVLLAYVVYKIAGLVDTLSRKIKGEKNS* |
| Ga0115863_17621812 | 3300009034 | Sediment, Intertidal | MFGDFAEIAVTILLAYVVYKIAILVDTLNGKIKGE* |
| Ga0123519_103648132 | 3300009503 | Hot Spring | MLADFTEIAVTILLAYVVYKMARLIETLNSKIREEKS* |
| Ga0114919_100297546 | 3300009529 | Deep Subsurface | LALGDFVRMLGDIAEIAVTILLTYVVYKIAILVDTLNCKIKGEKNS* |
| Ga0129301_10119002 | 3300010284 | Hot Spring Microbial Mat | MTLSELVRMIGDFAEIAVTVLLIYAVYKISQFIDGLNHKIREEKP* |
| Ga0129297_101240932 | 3300010324 | Lake Sediment | MLADITEIAVTILLAYVVYKIAALIETLNTKIKGEKSQ* |
| Ga0129297_103635752 | 3300010324 | Lake Sediment | SELVRMLGDFAEIAVTILLAYIMYKIATLIETLNSKIKGEKANN* |
| Ga0129298_100016503 | 3300010328 | Lake Sediment | LTLSELVKMLGDFAEIAVTILLAYVVYKIASLIESLNSKIKGERSQ* |
| Ga0129298_100713792 | 3300010328 | Lake Sediment | FSQIAVTILLAYVVYRIAILVDTLNNKIRDGKFPDQK* |
| Ga0129298_101103881 | 3300010328 | Lake Sediment | MVRMLGDIAEIAVTILLAYMTYKIATLIETLNNKIKREESH* |
| Ga0129298_103294543 | 3300010328 | Lake Sediment | LGDIAEKIAVTILLAYVAYKIATLIETLNSKIGEKKRQ* |
| Ga0129298_104234182 | 3300010328 | Lake Sediment | LGDFAEIAVTILLALVVYKIAKLVDTLNNKIKAEKD* |
| Ga0153915_102060323 | 3300012931 | Freshwater Wetlands | MALTELTRILADFAEIGVTVLLAYVVYKIARLIGTLEGKIKSEKTV* |
| Ga0153915_105846522 | 3300012931 | Freshwater Wetlands | MADFAEIAVTVLLAYVVYRIARLIGTLEGKIKTEKTL* |
| Ga0153915_114958062 | 3300012931 | Freshwater Wetlands | MALTELTRILADFAEIGVTVLLAYVVYKIARLIGTLEGKIKTEKT* |
| Ga0153915_126016781 | 3300012931 | Freshwater Wetlands | ILADFAEIGVTVLLAYVVYKIARLIGTLEGKIKSEKTI* |
| Ga0153916_101388912 | 3300012964 | Freshwater Wetlands | MALTELTRILADFAEIGVTVLLAYVVYKIARLIGTLEGKIKSEKPV* |
| Ga0153916_103434832 | 3300012964 | Freshwater Wetlands | MIGDFAEIAVTILLAYVVLKIAGLIDTLNGRIKAEKTT* |
| Ga0153916_111679862 | 3300012964 | Freshwater Wetlands | MALTELTRILADFAEIGVTVLLAYVVYKIARLIGTLEGKIKSEKTI* |
| Ga0153916_116046122 | 3300012964 | Freshwater Wetlands | MALTDLVRMLGDFAEIAVTVLLAYVVLKIAYLIDSLNNRIKLEKTADTKT* |
| Ga0153916_131910791 | 3300012964 | Freshwater Wetlands | MIGDFAEIAVTILLAYVVLKIAGLIDTLNGKIKAEKST* |
| (restricted) Ga0172365_100259392 | 3300013127 | Sediment | MFADFAEIAVTILLAYAVYKIAKLIETLNSKIKAETANNQS* |
| (restricted) Ga0172365_100636912 | 3300013127 | Sediment | MLTDFAEIAVTILLAYVVYKIAKLIETLNSKIREEKS* |
| (restricted) Ga0172365_100708772 | 3300013127 | Sediment | LTLSELVNVLADFAEIVVTILLAYVVYKIAKLIETLDSKIREEKSQ* |
| (restricted) Ga0172365_101002351 | 3300013127 | Sediment | DLKLTLSELVKMLADFAEIAVTILLAYVVYKIAKLIETLNSKIREEKS* |
| (restricted) Ga0172366_101518631 | 3300013128 | Sediment | LTLRELVKMVTDSVEIAVTILLAYVVYKIAKLIETLDSKIRAEKTR* |
| (restricted) Ga0172366_102947431 | 3300013128 | Sediment | MLTDFVEIAVTILLAYVVYKIAKLVETLDSKIRAEKTQ* |
| (restricted) Ga0172366_103183652 | 3300013128 | Sediment | LSELVKILGDFAEIAVTILLGYVVYKIAILIETLNNKIK |
| (restricted) Ga0172364_100395214 | 3300013129 | Sediment | MLTDFVEIAVTILLAYVVYKIAKLIETLDSKIRAEKTQ* |
| (restricted) Ga0172363_100118609 | 3300013130 | Sediment | LTNKGDLKLTLSELVKMLADFAEIAVTILLAYVVYKIAKLIETLNSKIREEKS* |
| (restricted) Ga0172363_100139571 | 3300013130 | Sediment | ELVKMLADFAEIAVTILLAYVVYKIAKLIETLNSKIREEKS* |
| Ga0181613_10806211 | 3300014149 | Anoxic, Neutral-Ph, Fe/Si-Rich Hot Spring Water | MIGDFAEMAVTILSAYAVYKIAMLIDVLSGKIKREKAE* |
| Ga0164310_102465681 | 3300014913 | Marine Sediment | LTLKELVSMFGDFAEIVVTILLAYVVYKIAILVDTLNGKIKGEKSS* |
| Ga0187776_100627222 | 3300017966 | Tropical Peatland | MTPSEVIRMLADIAEVAVTILLAYVVYKIANLLDSLNDKIKGTTQ |
| Ga0187776_115579501 | 3300017966 | Tropical Peatland | MGLSELVAIINGFAEIAVTLLLAYAAYKIAVLVDTINHKIGEERKPS |
| Ga0187774_114229041 | 3300018089 | Tropical Peatland | MVGDIAEIAVTVLLAYVVFKIAVLIDTLNSKMKKE |
| Ga0187791_13285282 | 3300019245 | Peatland | MTPSEVIRMLADIAEVAVTILLAYVVYKIANLLDSLNDKIKGTT |
| Ga0224496_103074502 | 3300022204 | Sediment | LTLSEIVKMLADITEIAVTILLAYVVYKIAALIETLNTKIKGEKSQ |
| Ga0224495_100713202 | 3300022208 | Sediment | LALSDFVKMAEDFAQIAVTILLAYVVYKISTLIDTINHKIKTEKTA |
| Ga0224506_100009456 | 3300022221 | Sediment | LTLTELIRMLGDITEVAVTIMLAVVVYKIAMLIDSLEIKIREKKS |
| Ga0224506_100917903 | 3300022221 | Sediment | MLADITEIAVTILLAYVVYKIAVLIETLNTKIKGEKSQ |
| Ga0224506_103851802 | 3300022221 | Sediment | LTLSELVKMLADFAEIAVTILLAYVVYKIARLIETLNSKIREEKS |
| Ga0224501_100012219 | 3300022223 | Sediment | LTLRDLVSMFGDFAEIAVTILLAYVVYKIAILVDTLNGKIKGEKSP |
| Ga0212092_10190622 | 3300022548 | Hot Spring Microbial Mat | MTLSELVRMIGDFAEIAVTVLLIYAVYKISQFIDGLNHKIREEKP |
| Ga0212089_100041056 | 3300022551 | Lake Sediment | LTLSELVKMLGDFAEIAVTILLAYVVYKIASLIESLNSKIKGERSQ |
| Ga0212089_100282842 | 3300022551 | Lake Sediment | LTLSDLIRMLGDFAQIAVTILLAYVVYRIAILVDTLNNKIRDGKFPDQK |
| Ga0212089_101690152 | 3300022551 | Lake Sediment | LTLSELVKMLGDFTEIAVTILLAYIMYKIATLIETLNSKIKGEKANN |
| Ga0212089_102514712 | 3300022551 | Lake Sediment | MVRMLGDIAEIAVTILLAYMTYKIATLIETLNSKIGEKKRQ |
| Ga0212089_103709572 | 3300022551 | Lake Sediment | MALTELTRIITDFAEIAVTLLLAYVVYKIATLIDTLNSKIKAEKTV |
| Ga0209978_100089875 | 3300024263 | Deep Subsurface | LALGEFVRMLGDVAEIAVTILLVYVVYKIAILVDTVSRKIKGEKSP |
| Ga0209986_100040836 | 3300024433 | Deep Subsurface | LALGDFVRMLGDIAEIAVTILLTYVVYKIAILVDTLNCKIKSEKNS |
| Ga0210056_10699392 | 3300025022 | Groundwater | MLADFAEIAVTILLAYVVYKIARLIETLNSKIREEKS |
| Ga0210049_10939102 | 3300025036 | Groundwater | MLADITEIAVTILLAYVVYKIAALIETLNTKIKGEKSQ |
| Ga0209126_11808162 | 3300025119 | Soil | MALSELTRILGDFAEIAVTILLAYVVYKIAKLIGTLEGKIKSEKEHVT |
| Ga0209121_100621212 | 3300027742 | Marine | LALGDFVRMLGDVAEIAVTILLAYVVYKIAMLVDTLNCKIKGEKNS |
| Ga0209121_101344612 | 3300027742 | Marine | LALGDFVRMLGDIAEITVTILLAYVVYKIAMLVDTLNCKIKGEKNS |
| Ga0209121_101546392 | 3300027742 | Marine | LALGDFVRMLGDIAEITVTILLAYVVYKIAMLVDTLTCKIKGEKNS |
| Ga0209121_102421172 | 3300027742 | Marine | LTLSELVRMLGDFAEIAVTILLAYVVYKIATLIDTLNSKIKEEKNP |
| Ga0207433_1000715916 | 3300027863 | Hot Spring | MTLSELIRMLGDFAEVAVTILLAYVVYKVAVLIDVLNSRLKREG |
| Ga0207433_100391683 | 3300027863 | Hot Spring | VTLSEFVKMIGDFAEMAVTILSAYAVYKIAMLIDVLSGKIKREKAE |
| Ga0209635_100825952 | 3300027888 | Marine Sediment | LTLSELIRFITDIAEIAVTILLAYAVYKLAALIDTLTAKIKA |
| Ga0209635_110829091 | 3300027888 | Marine Sediment | LTLSELTRMLGDFAEIAVTILLAYVVYKIAILVDTLNSKIKGESQP |
| Ga0209636_1000262314 | 3300027893 | Marine Sediment | MLGDVAEIMVTVLLAYVVYKIAGLVDTLSRKIKGEKNS |
| Ga0209636_101251312 | 3300027893 | Marine Sediment | MLGDLAEIAVTILLAYVVYKIAILIDTFDCKIKKEKSS |
| Ga0209636_102191892 | 3300027893 | Marine Sediment | MLGDLAEIAVTILLAYVVYKIAILIDTFNCKIKKEKSP |
| Ga0209253_100090705 | 3300027900 | Freshwater Lake Sediment | MGLSETVSILGDVAEITVTILLAYVVYKIGAFVDTINHEIKEERETR |
| Ga0272449_100005670 | 3300029977 | Sediment | MTLSALIRMLGDLAEVAVTILLAYLVYKVAVIVDALNSRLKRES |
| Ga0272448_10196956 | 3300031463 | Sediment | VTLSEFVKMIGDFAEMAVTILSACAVYKIAMLIDVLSGKIKREKEE |
| Ga0272448_14172972 | 3300031463 | Sediment | MTLSELIRMLEDFAEIAVTILLAYVVYKVAVLIDTLNSRLKREG |
| (restricted) Ga0315308_10045968 | 3300031587 | Sediment | MALTELTRILADFAEIAVTILLAYVVYKIAKLIGTLEAKIKTEKTT |
| (restricted) Ga0315308_10100705 | 3300031587 | Sediment | MLGDIAEIAVTILLAYVVYKIAILVDTLNNKIKGEKSP |
| (restricted) Ga0315308_10263191 | 3300031587 | Sediment | LTLSDLVRMLGDFAQIAVTILLAYVVYRIAILVDTLNNKIKDGKFPNQK |
| (restricted) Ga0315308_10482043 | 3300031587 | Sediment | LTLSELVRLLGDFVEIAVTILLAYVVYKVAMLVETLNGKIKGEKSP |
| (restricted) Ga0315308_10714731 | 3300031587 | Sediment | LTLSELVKMFGDLAEIAVTILLAYVVYKVAMLVDTLRNKLKEERDSR |
| (restricted) Ga0315308_10725552 | 3300031587 | Sediment | MALTELTRILADFAEIAVTILLAYVVYKIAKLIGALEGKIKTEKTT |
| (restricted) Ga0315308_10731322 | 3300031587 | Sediment | LTLSELVRMLGDFAEIAVTILLAYVVFKIAKLIDTLSDKIKAEKGA |
| (restricted) Ga0315308_10947012 | 3300031587 | Sediment | MTLSELVRMLGDFAEIVVTVLLAYVVLKIAGLIDTLNGKIKTEKTA |
| (restricted) Ga0315308_11533092 | 3300031587 | Sediment | LSLSELVRMLADFAEIAVTILVAYVVYKIAALIDALNVKIKGDKSA |
| (restricted) Ga0315308_12087582 | 3300031587 | Sediment | LTLSEFIRMLGDFLEIAVTVLLAYVIWKIAALIDTLNSKISREKTA |
| (restricted) Ga0315308_12105762 | 3300031587 | Sediment | MALTELTRIITDFAEIAVTLLLAYVVYKIATLIDTLNSKIRAEKTV |
| (restricted) Ga0315308_12803231 | 3300031587 | Sediment | LTPSELVRMIGDFADIAVTILLAYVVLKIAGLIDTLNGRIKAEKSSA |
| (restricted) Ga0315308_13135361 | 3300031587 | Sediment | LTLSELTRILGDIAEIAVTILLAYVVYKIASLIETLNSKIKGEKSQ |
| (restricted) Ga0315307_10371072 | 3300031593 | Sediment | MLGDFAQIAVTILLAYVVYRIAILVDTLNNKIKDGKFPNQK |
| (restricted) Ga0315307_10788472 | 3300031593 | Sediment | MTLSELVRMLGDIAEIAVTILLAYVIYKVATLVDALGGKIKGEKSTE |
| (restricted) Ga0315307_10874152 | 3300031593 | Sediment | LSLNELVRMVADFAEIAVTILVAYVVYKIAALIDALNVKIKGDKSA |
| (restricted) Ga0315307_10994462 | 3300031593 | Sediment | LTLSELVRMVGDFAEIAVTILLAYVVYKIARLIDSLNGKIKGEKGT |
| (restricted) Ga0315309_10069805 | 3300031604 | Sediment | MLGDFAEIAVTILLAYVVYKIAILVDTLNDKIKREKSP |
| (restricted) Ga0315306_100006249 | 3300031806 | Sediment | MLGDFTEIAVTILLAYIMYKIATLIETLNSKIKGEKANN |
| (restricted) Ga0315306_100475991 | 3300031806 | Sediment | MVRMLGDIAEIAVTILLAYMTYKIATLIETLNNKIKREESH |
| (restricted) Ga0315306_101267402 | 3300031806 | Sediment | MALSDLVRMLGDFAEIAVTILLAYVVYKIATLIDTLNGKIKGEKSA |
| Ga0315280_1000347417 | 3300031862 | Sediment | MTLADFIRILNDFTQIAVTLLLAYVTYKIAMLVDTLNRKIKQGE |
| Ga0315280_100056921 | 3300031862 | Sediment | MLADFAEIAVTILLAYVVHKIARLIETLNSKIREEKS |
| Ga0315280_100101254 | 3300031862 | Sediment | MLADIAEIAVTILLAYVVYKIAVLIETLNSKIKGEKNQ |
| Ga0315280_101853341 | 3300031862 | Sediment | LTLSELVKMLADFAEIAVTILLAYVVYKIARLIETLNSKIREEKSK |
| (restricted) Ga0315310_1000000563 | 3300031876 | Sediment | LTLSELVKMFGDLTEIAVTILLAYVVYKVAMLVDTLKNKLKEERDSR |
| (restricted) Ga0315310_100000437 | 3300031876 | Sediment | LRLTLSDLTRVLADIAEIAVTILLAYVVYKIATLIDTLNGKIKAEKTT |
| (restricted) Ga0315310_100526622 | 3300031876 | Sediment | MIGDFAEIAITILLAYVVYKIATLIDTLNRKINGEKNK |
| (restricted) Ga0315310_100736092 | 3300031876 | Sediment | LTLSELTRMLSDFAEIAVTILLAYVVYKIAGLIDTLSSRIKAEKTT |
| (restricted) Ga0315310_101540171 | 3300031876 | Sediment | LTLSEFVRMLGDFLEIAVTVLLAYVIWKIAALIDTLNSKISLEKIA |
| (restricted) Ga0315310_101864312 | 3300031876 | Sediment | MTLSEIIRMLGDVAEIAVTILLVYVVYKIASFIDTLNSKIKGERVRD |
| (restricted) Ga0315314_10010466 | 3300031877 | Sediment | LSLGELTRMLGDFAEIAVTILLAYAVYKIAMLVDALNVKIKAEKTT |
| (restricted) Ga0315314_100154218 | 3300031877 | Sediment | VTLSELIRMLSDFAQLAVTVLLAFVVYKIAVLIDSLSHKIKEIKSA |
| (restricted) Ga0315314_10058325 | 3300031877 | Sediment | MKTEAAQLTLSELIRFIADIVEIGVTVLLAYVVYKLATLIDTLTAKIKA |
| (restricted) Ga0315314_10066106 | 3300031877 | Sediment | MLGDFAEISVTLLLAYVVLKIAHLIDTLNGRIKAEKTA |
| (restricted) Ga0315314_10077156 | 3300031877 | Sediment | MLGDFAEVAVTILLAYLVYKLAIFIETLNSKIMQEKDQ |
| (restricted) Ga0315314_10114295 | 3300031877 | Sediment | LALSELTRILGDFAEIAVTILLAYVVYKIAKLIDALSGKIKAEKST |
| (restricted) Ga0315314_10191242 | 3300031877 | Sediment | MLGDFAEIAVTILLAYVVLKIAHLIDTLNGKIKAEKTA |
| (restricted) Ga0315314_10205002 | 3300031877 | Sediment | LTLSELVRMLGDIAEIAVTILLAYVVYKIASLIDTLNGKIKGEKSI |
| (restricted) Ga0315314_10569611 | 3300031877 | Sediment | VTLSELVRMLSDFAEIAVTVLLAYAVYKIATLIDSLNHKIKAEKTA |
| (restricted) Ga0315314_11207342 | 3300031877 | Sediment | LTLSELIRLIADIAEIAVTILLAYVVYKLATLLDVLTAKIKA |
| (restricted) Ga0315314_12130991 | 3300031877 | Sediment | LTLSELVRLLQDFAEIAVTVLLVYAVYKIAKLISTLETKIKAEKTS |
| (restricted) Ga0315314_12202492 | 3300031877 | Sediment | MLADFAEIAVTILVAYVVYKIAALIDALNVKIKGDKSA |
| (restricted) Ga0315314_12780211 | 3300031877 | Sediment | LTLSELVRMLGDFAEIAVTVLLAYVVYKIASLIDTLNGRIKGEKSI |
| (restricted) Ga0315312_10041207 | 3300031898 | Sediment | MLADFAEIAVTILLAYVVYKIAKLIETLNSKIKAEKSQ |
| Ga0315296_100269403 | 3300032020 | Sediment | LPLSELVRMIGDFAEVAVTILLAYLVLKIASLIDTLNGKIKAEKSA |
| Ga0315282_101310621 | 3300032069 | Sediment | MLADCAEIAVTILLAYVVYKIAALIETLNTKIKGEKSQ |
| Ga0315282_103585492 | 3300032069 | Sediment | VTLSEFVKMIGDFAEMAVTILSAYAVYKIAMLIDVLSGKIKREKEE |
| Ga0315282_105683751 | 3300032069 | Sediment | MLADFAEIAVTILLAYVVYKIAKLIETLNSKIREEKS |
| Ga0315277_1000027774 | 3300032118 | Sediment | MIGDFTEIAVTILLAYVVLKIATLIDTLNGRIKAEKST |
| Ga0315277_100085569 | 3300032118 | Sediment | LTLSELIKMFGDLAEIAVTLLLAYVVYKIAIFVDALSHKIKSDSTQ |
| Ga0315277_101019202 | 3300032118 | Sediment | LNLSELVRLVGDLAEVAVTILLAYVVFKIAMLVESLNTRLREGRSS |
| Ga0315277_114851601 | 3300032118 | Sediment | MFGDLAEIAVTVLLAYVVYKIAIFVDALSHKIKSDSTQ |
| Ga0315281_110808572 | 3300032163 | Sediment | MGLSELVSILGDVAEITVTILLAYVVYKIAALVDTINHRIKEERKPQ |
| Ga0315268_1000000585 | 3300032173 | Sediment | MSLSELTNIVNDFAEIAVTILLAYVAYKVAMLVDTLNHKIKKEEK |
| Ga0315268_100222835 | 3300032173 | Sediment | LTLSELVRMIGDFAEIAVTILLAYVVFKIAGLIDTLNGRIKAEKST |
| Ga0315268_100675952 | 3300032173 | Sediment | LTLSEIVKMLADIAEIAVTILLAYVVYKIAVLIETLNSKIKGEKNQ |
| Ga0315268_101499281 | 3300032173 | Sediment | LTLSELVRMIGDFTEIAVTILLAYVVFKIANLIDTLNGRIKAEKST |
| Ga0315268_101501682 | 3300032173 | Sediment | LNLSELIRLVGDLAEVAVTILLAYVTFKIAMLVDSLNTKLREGKSS |
| Ga0315268_102403982 | 3300032173 | Sediment | MLADFTEIAVTILLAYVVYKMARLIETLNSKIREEKS |
| Ga0315268_106353942 | 3300032173 | Sediment | LTLSELVRMLGDFAEIAVTILLAYVVYKIASLIDTLNGKIKGEKSI |
| Ga0315268_123256001 | 3300032173 | Sediment | VTLSEFVKMIGDFAEMAVTILSAYAIYKIAMLIDVLSGKIKREKEE |
| Ga0335070_101325193 | 3300032829 | Soil | MGLSELVAIINGFAEIAVTLLLAYAAYKIAVLVDTINHEIGEERKPS |
| Ga0334965_0001076_9894_10010 | 3300033991 | Sediment | MLADCAEIAVTILLAYVVYKIAKLVETLNIKIKGEKSQ |
| Ga0334965_0004948_7968_8081 | 3300033991 | Sediment | MLGDFAEIAVTVLLVYAVYKIALLIDGLNRKIRQENP |
| Ga0373900_013030_858_974 | 3300034078 | Sediment Slurry | MIADFAEIAVTLLVAYVVWKIAHLIDTLNNKIKAEKTA |
| Ga0373900_066412_67_219 | 3300034078 | Sediment Slurry | MALTDLVRMLGDFAEIAVTVLLAYVVLKIAYLIDSLNNRIKLEKTTDTKT |
| Ga0373900_094551_226_366 | 3300034078 | Sediment Slurry | VALTELTRILADFAEIGVTVLLAYVVYKIARLIGTLEGKIKTEKTV |
| Ga0373902_143709_198_344 | 3300034099 | Sediment Slurry | MALSDLTRLLGDLAEISVTILLAYVVYKIAKLIGTLEGKIKSEKEHTT |
| ⦗Top⦘ |