| Basic Information | |
|---|---|
| Family ID | F039851 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 163 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MDRRTFLAGTGAVLLAAPLAAEAQQAAKVARIGYL |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 163 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.33 % |
| % of genes near scaffold ends (potentially truncated) | 66.26 % |
| % of genes from short scaffolds (< 2000 bps) | 64.42 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.417 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.472 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.742 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (33.742 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 26.98% β-sheet: 0.00% Coil/Unstructured: 73.02% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 163 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 41.10 |
| PF12867 | DinB_2 | 3.07 |
| PF04303 | PrpF | 1.84 |
| PF02518 | HATPase_c | 1.84 |
| PF00924 | MS_channel | 1.23 |
| PF01548 | DEDD_Tnp_IS110 | 1.23 |
| PF09995 | MPAB_Lcp_cat | 1.23 |
| PF00296 | Bac_luciferase | 1.23 |
| PF03992 | ABM | 1.23 |
| PF02371 | Transposase_20 | 1.23 |
| PF04226 | Transgly_assoc | 1.23 |
| PF00596 | Aldolase_II | 1.23 |
| PF05494 | MlaC | 0.61 |
| PF03988 | DUF347 | 0.61 |
| PF02416 | TatA_B_E | 0.61 |
| PF08734 | GYD | 0.61 |
| PF01568 | Molydop_binding | 0.61 |
| PF13240 | zinc_ribbon_2 | 0.61 |
| PF07883 | Cupin_2 | 0.61 |
| PF00753 | Lactamase_B | 0.61 |
| PF12773 | DZR | 0.61 |
| PF13541 | ChlI | 0.61 |
| PF03328 | HpcH_HpaI | 0.61 |
| PF01850 | PIN | 0.61 |
| PF00589 | Phage_integrase | 0.61 |
| PF05163 | DinB | 0.61 |
| PF07978 | NIPSNAP | 0.61 |
| PF13501 | SoxY | 0.61 |
| PF14659 | Phage_int_SAM_3 | 0.61 |
| PF00578 | AhpC-TSA | 0.61 |
| PF13432 | TPR_16 | 0.61 |
| PF00497 | SBP_bac_3 | 0.61 |
| PF00072 | Response_reg | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 163 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 41.10 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.45 |
| COG2828 | 2-Methylaconitate cis-trans-isomerase PrpF (2-methyl citrate pathway) | Energy production and conversion [C] | 1.84 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 1.23 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.23 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 1.23 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 1.23 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.61 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.61 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.61 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.61 |
| COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.61 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.61 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.61 |
| COG4705 | Uncharacterized membrane-anchored protein | Function unknown [S] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.42 % |
| Unclassified | root | N/A | 35.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090009|LWAnN_F624WLL02G1IN9 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 2088090014|GPIPI_17427372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium moriokaense | 2629 | Open in IMG/M |
| 2199352025|deepsgr__Contig_170177 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100660223 | Not Available | 739 | Open in IMG/M |
| 3300000955|JGI1027J12803_106348681 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300003994|Ga0055435_10226898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300004633|Ga0066395_10421464 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300005332|Ga0066388_102236868 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300005363|Ga0008090_15198892 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300005437|Ga0070710_10936954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 627 | Open in IMG/M |
| 3300005713|Ga0066905_100148782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1683 | Open in IMG/M |
| 3300005719|Ga0068861_100881903 | Not Available | 846 | Open in IMG/M |
| 3300005764|Ga0066903_102059217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1098 | Open in IMG/M |
| 3300005841|Ga0068863_100134940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2358 | Open in IMG/M |
| 3300005841|Ga0068863_100205350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1896 | Open in IMG/M |
| 3300005844|Ga0068862_101471005 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 686 | Open in IMG/M |
| 3300006046|Ga0066652_100281752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1468 | Open in IMG/M |
| 3300006163|Ga0070715_10161790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1107 | Open in IMG/M |
| 3300006755|Ga0079222_11445819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 640 | Open in IMG/M |
| 3300007076|Ga0075435_100137533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2047 | Open in IMG/M |
| 3300009012|Ga0066710_100139606 | All Organisms → cellular organisms → Bacteria | 3345 | Open in IMG/M |
| 3300009038|Ga0099829_10060150 | All Organisms → cellular organisms → Bacteria | 2846 | Open in IMG/M |
| 3300009038|Ga0099829_11182163 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300009089|Ga0099828_10363635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1304 | Open in IMG/M |
| 3300009089|Ga0099828_11129096 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300009162|Ga0075423_12014433 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300010046|Ga0126384_10432837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1119 | Open in IMG/M |
| 3300010046|Ga0126384_11227652 | Not Available | 692 | Open in IMG/M |
| 3300010046|Ga0126384_11823164 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 578 | Open in IMG/M |
| 3300010047|Ga0126382_11131735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13 | 696 | Open in IMG/M |
| 3300010358|Ga0126370_11520677 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 637 | Open in IMG/M |
| 3300010358|Ga0126370_12080901 | Not Available | 557 | Open in IMG/M |
| 3300010360|Ga0126372_10532137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1111 | Open in IMG/M |
| 3300010360|Ga0126372_12887720 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 532 | Open in IMG/M |
| 3300010361|Ga0126378_10060594 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3577 | Open in IMG/M |
| 3300010366|Ga0126379_11208371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 862 | Open in IMG/M |
| 3300010391|Ga0136847_10150711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 3339 | Open in IMG/M |
| 3300010403|Ga0134123_10301218 | Not Available | 1422 | Open in IMG/M |
| 3300011106|Ga0151489_1469485 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300011269|Ga0137392_10004678 | All Organisms → cellular organisms → Bacteria | 8533 | Open in IMG/M |
| 3300011269|Ga0137392_11108112 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300011271|Ga0137393_10949565 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300012096|Ga0137389_10854959 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300012189|Ga0137388_11850861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300012199|Ga0137383_10381427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1033 | Open in IMG/M |
| 3300012199|Ga0137383_10470098 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300012202|Ga0137363_11333232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300012205|Ga0137362_10360524 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300012205|Ga0137362_10367055 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1247 | Open in IMG/M |
| 3300012207|Ga0137381_10352905 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1282 | Open in IMG/M |
| 3300012207|Ga0137381_10603123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 957 | Open in IMG/M |
| 3300012207|Ga0137381_10753168 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300012209|Ga0137379_10834448 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 826 | Open in IMG/M |
| 3300012211|Ga0137377_10755380 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300012354|Ga0137366_10055613 | All Organisms → cellular organisms → Bacteria | 3029 | Open in IMG/M |
| 3300012359|Ga0137385_10403667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium symbiodeficiens | 1165 | Open in IMG/M |
| 3300012361|Ga0137360_10534763 | Not Available | 1000 | Open in IMG/M |
| 3300012362|Ga0137361_10792820 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300012917|Ga0137395_10287213 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300012927|Ga0137416_10661094 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 915 | Open in IMG/M |
| 3300012929|Ga0137404_11685419 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300012930|Ga0137407_12291678 | Not Available | 516 | Open in IMG/M |
| 3300012944|Ga0137410_11822981 | Not Available | 537 | Open in IMG/M |
| 3300012948|Ga0126375_10876338 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300012948|Ga0126375_11134147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13 | 646 | Open in IMG/M |
| 3300012948|Ga0126375_11796604 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300012948|Ga0126375_12008011 | Not Available | 511 | Open in IMG/M |
| 3300012976|Ga0134076_10459610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 576 | Open in IMG/M |
| 3300014882|Ga0180069_1043620 | Not Available | 997 | Open in IMG/M |
| 3300014884|Ga0180104_1212340 | Not Available | 577 | Open in IMG/M |
| 3300015374|Ga0132255_101685596 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 962 | Open in IMG/M |
| 3300015374|Ga0132255_104803278 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 572 | Open in IMG/M |
| 3300018051|Ga0184620_10122161 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300018052|Ga0184638_1024481 | All Organisms → cellular organisms → Bacteria | 2153 | Open in IMG/M |
| 3300018078|Ga0184612_10359100 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 738 | Open in IMG/M |
| 3300018084|Ga0184629_10023998 | All Organisms → cellular organisms → Bacteria | 2565 | Open in IMG/M |
| 3300025313|Ga0209431_10570097 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300025910|Ga0207684_10025634 | All Organisms → cellular organisms → Bacteria | 5025 | Open in IMG/M |
| 3300025935|Ga0207709_11394847 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 580 | Open in IMG/M |
| 3300026018|Ga0208418_1032612 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 552 | Open in IMG/M |
| 3300026317|Ga0209154_1052232 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300026334|Ga0209377_1080576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1384 | Open in IMG/M |
| 3300026469|Ga0257169_1045617 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300026497|Ga0257164_1042890 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300026529|Ga0209806_1069810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1586 | Open in IMG/M |
| 3300026538|Ga0209056_10354618 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300026555|Ga0179593_1172387 | All Organisms → cellular organisms → Bacteria | 2871 | Open in IMG/M |
| 3300027862|Ga0209701_10212758 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300027882|Ga0209590_10189826 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300028047|Ga0209526_10264794 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1172 | Open in IMG/M |
| 3300031231|Ga0170824_125724282 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 573 | Open in IMG/M |
| 3300031720|Ga0307469_10794512 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300031720|Ga0307469_11434517 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 659 | Open in IMG/M |
| 3300031740|Ga0307468_100179756 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1403 | Open in IMG/M |
| 3300031740|Ga0307468_100470028 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300031740|Ga0307468_101359508 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300031740|Ga0307468_101452302 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300031780|Ga0318508_1216860 | Not Available | 549 | Open in IMG/M |
| 3300031820|Ga0307473_10530089 | Not Available | 800 | Open in IMG/M |
| 3300031910|Ga0306923_10103626 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3212 | Open in IMG/M |
| 3300031949|Ga0214473_10788394 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300032174|Ga0307470_10297509 | Not Available | 1093 | Open in IMG/M |
| 3300032180|Ga0307471_100082302 | All Organisms → cellular organisms → Bacteria | 2838 | Open in IMG/M |
| 3300032180|Ga0307471_100644075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1221 | Open in IMG/M |
| 3300032180|Ga0307471_100822397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1096 | Open in IMG/M |
| 3300032180|Ga0307471_100903332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1050 | Open in IMG/M |
| 3300032180|Ga0307471_101390988 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300032180|Ga0307471_102290045 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 681 | Open in IMG/M |
| 3300032180|Ga0307471_102343224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 674 | Open in IMG/M |
| 3300032180|Ga0307471_102674136 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 633 | Open in IMG/M |
| 3300032180|Ga0307471_104255958 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300032205|Ga0307472_101703707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300032205|Ga0307472_101734313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
| 3300032342|Ga0315286_11769228 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300032401|Ga0315275_10800165 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300032516|Ga0315273_11902410 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
| 3300033004|Ga0335084_11901614 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300033500|Ga0326730_1112486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300033501|Ga0326732_1044463 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300034178|Ga0364934_0265577 | Not Available | 650 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.47% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 14.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.75% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.68% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.84% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.23% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.23% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.23% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.23% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.23% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.23% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.61% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.61% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.61% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090009 | Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C-methane anaerobic+nitrate | Environmental | Open in IMG/M |
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014882 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026018 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
| 3300033501 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF12FN SIP fraction | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LWAnN_07020730 | 2088090009 | Freshwater Sediment | MDRRAFLAGTGAVLLAAPLAAEAQKSEKKARVGILGVGP |
| GPIPI_03244820 | 2088090014 | Soil | MDRRTFLAGTSAVLVAAPRAAEAIEDKPARIGVLSS |
| deepsgr_02864190 | 2199352025 | Soil | MDRRTFLAGTGAILFAVPLVTEAQPGGKTWQIGFLTGRRAPA |
| INPhiseqgaiiFebDRAFT_1006602231 | 3300000364 | Soil | LAGTGAVLLAGPSAAEAQQPRKVYRVGWIIGKIHG* |
| JGI1027J12803_1063486813 | 3300000955 | Soil | LIDRRTFLAGTGVVLLVSPLAAEAQFPEKVPRVGYLSP |
| JGI12053J15887_103103722 | 3300001661 | Forest Soil | MDRRSFLGIVGTGLLAAPLAAEAQKSEKMPRVGILNIGPAPSPQE |
| Ga0055435_102268981 | 3300003994 | Natural And Restored Wetlands | VIDRRTVLAGTGAVLLATPLVPEAQQARKVPRVGILGSAPTP |
| Ga0055432_101607772 | 3300004022 | Natural And Restored Wetlands | VIDRRTFLAGTGVVLLAAPVAAEAQKSQKMARVGILGIGPAPSPQ |
| Ga0066398_101205332 | 3300004268 | Tropical Forest Soil | VISRRAFVASLTGGLLTAPPAAEAQKSEKIARVGILGIGSAPSPQE |
| Ga0066395_104214641 | 3300004633 | Tropical Forest Soil | VDRRTFLAGTGGGLLATPLAAEAQPTARVYRVGFLSPGPAPH |
| Ga0066388_1022368683 | 3300005332 | Tropical Forest Soil | VRRRRFLQVAGAGLLAAPLAAQAQPAGRVRRIGVLHITPDP |
| Ga0066388_1074586481 | 3300005332 | Tropical Forest Soil | MERRTFLAGTGAVLLATPVPAEPQQLPKTYRIGVMIGSSPSAA |
| Ga0070687_1013859142 | 3300005343 | Switchgrass Rhizosphere | MIDRRAFLAGTGAVLLAAPLAAEAQKSEKKARVGILGLGPTPTPQE |
| Ga0008090_151988921 | 3300005363 | Tropical Rainforest Soil | MDRRTFLAGTGAVLLAAPLAAWAQPAKKPWRIGVLGLGQVTSEM |
| Ga0070710_109369541 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LIDRRIFLAGTGAVLLAAPLTAEGQQPGKVYRIGWLASGS |
| Ga0066905_1001487821 | 3300005713 | Tropical Forest Soil | MDRRTFLAGTGALLLATPLGAEAQQARKVHRIGFLP |
| Ga0068861_1008819031 | 3300005719 | Switchgrass Rhizosphere | MIDRRAFLAGTGAVLLAAPLAAEAQKSEKKARVGILGLG |
| Ga0066903_1020592172 | 3300005764 | Tropical Forest Soil | MDRRTFLAGTSAVLLAAPLAVEAQQPRRVYRIALLYAG |
| Ga0068863_1001349404 | 3300005841 | Switchgrass Rhizosphere | MDRRTFLAGTGAVLLAAPLSAGAQQAGRVYKIGFL* |
| Ga0068863_1002053501 | 3300005841 | Switchgrass Rhizosphere | VIDRRRFLAGRAAVLLAAPLAAEAQPVGTTYRIGFLGGA |
| Ga0068862_1014710051 | 3300005844 | Switchgrass Rhizosphere | MTSVMDRRTFLAGTGAVLLAAPLAAEGQQAGKVWRI |
| Ga0070717_119762952 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MERRTFLRVITGGLLAAPITAEAQKSEKMARVGILGIGPAPS |
| Ga0066652_1002817523 | 3300006046 | Soil | MIDRRTFLAGTGAVILAAPLAAEGQPARLYRVGVVLE |
| Ga0070715_101617901 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDRRTFLAGTGAVLLAAPLAAQAQQPGKVSRLGYLGVNRPEE |
| Ga0079222_114458192 | 3300006755 | Agricultural Soil | MDRRTFLAGTGAVLLAAPLAAEGQQAAKVPRIGYLGLNRA |
| Ga0075425_1015491741 | 3300006854 | Populus Rhizosphere | MISRRAFIGFVAGGLLVAPLAAEAQKSQKMARVGILGI |
| Ga0075424_1015272201 | 3300006904 | Populus Rhizosphere | MDRRALLAGATALLAAPLAAEGQPAGKVWRIGFLHP |
| Ga0075435_1001375335 | 3300007076 | Populus Rhizosphere | MISRRIFLAGTGAVLLAAPLAAEAQQARKVHRIGFLVYGPG |
| Ga0075435_1005335304 | 3300007076 | Populus Rhizosphere | MNRRTFLCGLTLGAMAAPLAAVAQKSEKMARVGILGIG |
| Ga0066710_1001396061 | 3300009012 | Grasslands Soil | LLDRRTFLAGTSALLLVAPFASEAQQAKKVYKIGYLS |
| Ga0066710_1043497821 | 3300009012 | Grasslands Soil | MISRRAFINTLASGLLAAPLAAEAQKSEKMARVGILG |
| Ga0099829_100601501 | 3300009038 | Vadose Zone Soil | VIDRRTFLAGTGAVLLAAPFAAQAQQGEKVWRLGVLSPG |
| Ga0099829_111821632 | 3300009038 | Vadose Zone Soil | MDRRTFLAGTGAVLLAAPRVSEAQPSGKVPRVGYLSVF |
| Ga0099828_103636353 | 3300009089 | Vadose Zone Soil | VIDRRTFLAGTGAVVLAAPLTAAAQPAGTVPRVGYLSAGS |
| Ga0099828_111290962 | 3300009089 | Vadose Zone Soil | MERRTFLAGTGTVLLAAPLKAEAQEAAKAYRIGILG* |
| Ga0114129_125640111 | 3300009147 | Populus Rhizosphere | VNRRAFIGTIAGGLLTAPLAAVAQKSEQKSEKMARVGILGIGPAPNPQE |
| Ga0075423_120144332 | 3300009162 | Populus Rhizosphere | VIDRRTFLAGTGAALLAAPLAGEAQQSGKVPRVGYATSTDKSI |
| Ga0126374_108412352 | 3300009792 | Tropical Forest Soil | MNRRAFVTGLGATLAAPLAAEGQPAAAVPKIGYLSPWA |
| Ga0126384_104328371 | 3300010046 | Tropical Forest Soil | VIVRRTFLAGTGAVLLAAPLAAEGQQSGKVRRVGF |
| Ga0126384_112276521 | 3300010046 | Tropical Forest Soil | MSRYMAGMKRRTFLGTVGAALLAMPLAAEAQQAGK |
| Ga0126384_118231641 | 3300010046 | Tropical Forest Soil | VINRRTFLAGTGAVLLAAPLAADAAPTRKVPVVGYLAPEAE |
| Ga0126382_111317352 | 3300010047 | Tropical Forest Soil | VIDRRTFLAGAGAVLLAAPLAAETQEAKKVYRIGYLSAGSLF |
| Ga0126373_132848073 | 3300010048 | Tropical Forest Soil | VIDRRVFVGTLSGGILATQFAAEAQKPEKMARVGILGLGPV |
| Ga0134063_107348911 | 3300010335 | Grasslands Soil | VHRRAFLAGTGAVLLTAPLVAQAQPAGRATRIGFLSPSSLHDPRTQT |
| Ga0126370_115206772 | 3300010358 | Tropical Forest Soil | MIARRTFLAGTGAVLLAVPLVAEAQQPGKLYRIGWLGLNPP |
| Ga0126370_120809012 | 3300010358 | Tropical Forest Soil | MDRRTFLAGTGAVLLAAPLAAGAQPAGKVYRVATVSWANEFS |
| Ga0126372_105321372 | 3300010360 | Tropical Forest Soil | LIDRRTFLAGTAAVVLAAPLAAEGQQPGRLYKIGY |
| Ga0126372_128877201 | 3300010360 | Tropical Forest Soil | MDRRTFLAGTGAVLLAAPLAAEAQESPKKVARVGILG |
| Ga0126378_100605941 | 3300010361 | Tropical Forest Soil | VIDRRTFLACTGAVVLAAPLVAEAQQAGEVPRIGYLLPNANR |
| Ga0126379_112083711 | 3300010366 | Tropical Forest Soil | VDRRTFLAGTGAVLLAAPLAAEAQQARKAPLIGILWNNPLA |
| Ga0136847_101507115 | 3300010391 | Freshwater Sediment | VIDRRTFLAGTGAVLLAAPLATDAQPTAKIPRIGVLQVGTA |
| Ga0136847_108030875 | 3300010391 | Freshwater Sediment | MNRRAFLAGTGAALLAAPRAAEAQKTEKKARVGILGIG |
| Ga0126383_114425813 | 3300010398 | Tropical Forest Soil | VIDRRVFVGTLSGGILATQFAAEAQKPEKMARVGILGLGPVPSPQE |
| Ga0134122_130913891 | 3300010400 | Terrestrial Soil | MHRRAFLKTLSGGLLAAPLAAEAQKSEKKARVGILN |
| Ga0134123_103012182 | 3300010403 | Terrestrial Soil | VERRIFLAGTGAVLLTRPLPAEAQQPERVYRIGFLWDS |
| Ga0151489_14694852 | 3300011106 | Soil | MNRRTFLSATGAVLLAAPIEAQSATKVPRIGYLGLDLA* |
| Ga0137392_1000467811 | 3300011269 | Vadose Zone Soil | VIARRAFLVGTGAVLLAAPFAAVTAQPREKVPRVGY |
| Ga0137392_111081122 | 3300011269 | Vadose Zone Soil | LIDRRTFLAGIGVVLLAPPLAAEAQQARKVYKIGS |
| Ga0137393_109495652 | 3300011271 | Vadose Zone Soil | VIDRRTFLAGTGAVLLATPLAAGAQQAGKMWRIVTMQEDFTS |
| Ga0137389_108549591 | 3300012096 | Vadose Zone Soil | VDRRTFLAGTGAVLLAAPLAAEGQPSVKLRKIGFLRPGLPPQ |
| Ga0137388_118508611 | 3300012189 | Vadose Zone Soil | LIDRRTFLAGTGAVLLAAPLAADAQQPGKVWRIGYLQAGARTPDG |
| Ga0137383_103814273 | 3300012199 | Vadose Zone Soil | VIDRRAFLAGTGAVLLAAPLAAEAQQAGKVYRVGILGEKASD |
| Ga0137383_104700981 | 3300012199 | Vadose Zone Soil | MDRRTFLAGTGAVVFAAPLAVQAQQPKKVWRIGFLAAGT |
| Ga0137363_113332321 | 3300012202 | Vadose Zone Soil | VIDRRTFLAGTGAVLLAAPLAAEGQQGGKVDRIGHI |
| Ga0137362_103605242 | 3300012205 | Vadose Zone Soil | VIDRRTFIAGTGAVILAAPLAAEGQLAKKVYRIR* |
| Ga0137362_103670553 | 3300012205 | Vadose Zone Soil | MHAVMDRRTFLAGTGAALLSTSLAAEAQQAGKVWRIGY |
| Ga0137381_103529053 | 3300012207 | Vadose Zone Soil | MDRRTFLAGTGAVVFAAPLAVQAQQPKKVWRIGFLA |
| Ga0137381_106031232 | 3300012207 | Vadose Zone Soil | MDRRAFLTGTGAVLLAAPLAAEAQQAGKAYRVGILVIA |
| Ga0137381_107531682 | 3300012207 | Vadose Zone Soil | LIDRRTFLAGAGAALLAAPLAAEAQQATKVARIGYLGNTLGAP |
| Ga0137379_108344482 | 3300012209 | Vadose Zone Soil | MERRAFLTGTGALLLAAPLAAEAQETGKGLASVCS |
| Ga0137377_107553801 | 3300012211 | Vadose Zone Soil | MMERRAFLAGTGAVLLAAPLAAQAQTVGTVRRIGVVGGAN |
| Ga0137366_100556131 | 3300012354 | Vadose Zone Soil | MDRRTFLAGTGAVFLAASLAAEAQQPGKKVWIGVLSQGLPDPPPG |
| Ga0137385_104036672 | 3300012359 | Vadose Zone Soil | MDRRTFLAGTGAVLLAAPLAAQAEQADRVFRIGVL |
| Ga0137360_105347632 | 3300012361 | Vadose Zone Soil | VIDRRTFLAGTSAVLLAAPFAAEAQQTEKVWRIGW |
| Ga0137361_107928201 | 3300012362 | Vadose Zone Soil | VERRAFLAGAGAVLLAAPLAAEAQQAGKVYRVGILGEKAS |
| Ga0137361_113340041 | 3300012362 | Vadose Zone Soil | VIDRRTFLVGTGALLLAAPLAAEAQQAKKVWRIGLLS |
| Ga0137395_102872132 | 3300012917 | Vadose Zone Soil | VIDRRTFLAGTGAVLLAAPLAAETQQAGKVARVGYLSPN |
| Ga0137416_106610941 | 3300012927 | Vadose Zone Soil | MDRSFIAGATALLTAPLVAEAQQAGTVPRIGFLQG |
| Ga0137416_114485721 | 3300012927 | Vadose Zone Soil | MERRAFLAGTGAVLLASPLAVEAQQPRVYRVGVVMQGGP |
| Ga0137404_106840613 | 3300012929 | Vadose Zone Soil | MDRRVFLSALSGGLLAAPLAAEAQKPEKKARVGILNLGS |
| Ga0137404_116854191 | 3300012929 | Vadose Zone Soil | MDRRTFLAGTGAVLLAAPLAAEGQKSEKKARVGIL |
| Ga0137407_122916782 | 3300012930 | Vadose Zone Soil | VIDRRTFLAGTGGVFLAAPLAAEAQPTGKVHRIGFLAFSPP |
| Ga0137410_118229811 | 3300012944 | Vadose Zone Soil | VIDRRTFLAGTGAVLLAAPPPGEGQPAGKVPRIALL |
| Ga0126375_101996693 | 3300012948 | Tropical Forest Soil | MDRRTFLAGTGVVLLTAPLAGEAQQAKKVWRIGFLSSRSSPANL |
| Ga0126375_108763382 | 3300012948 | Tropical Forest Soil | VDRRTFLAGTGAVLLAAPLAAEGQQAGKVARIGYSF* |
| Ga0126375_111341472 | 3300012948 | Tropical Forest Soil | VNRRTFLAGTGAVLLAAPLSAKAQPAGKVYRIGYLSSGS |
| Ga0126375_117966042 | 3300012948 | Tropical Forest Soil | VERRTFLAGTGAVLLAAPLVAEAQQPGKVHRIGFLSG |
| Ga0126375_120080112 | 3300012948 | Tropical Forest Soil | MIRLWFAGTGAVLLAAPLAVEAQPAGKVARVGLLGLFT |
| Ga0134076_104596102 | 3300012976 | Grasslands Soil | MDRRTFLAGTGAVLLAAPLAAEAQQAAKVARIGYL |
| Ga0134087_101506891 | 3300012977 | Grasslands Soil | MDRRTFMGALTGGFLVAPLSAEAQKSEKMARVGILGI |
| Ga0180069_10436202 | 3300014882 | Soil | MIDRRTFLAGPGAVLLAAPFGAQAQQAAKVHRIGFLSAARSL* |
| Ga0180104_12123401 | 3300014884 | Soil | LIDRRTFLAGTGAVLLAAPLAAEAQKSERTARVGILGIG |
| Ga0132255_1016855961 | 3300015374 | Arabidopsis Rhizosphere | MDRRTFLAGTGAMFLAAPLAAEAQQAKKVYRIGWMIGSSI |
| Ga0132255_1048032782 | 3300015374 | Arabidopsis Rhizosphere | VIARRTFLAGTGAVLLAAPLAAGAQQAKKVYRLGYLSAGS |
| Ga0184620_101221612 | 3300018051 | Groundwater Sediment | VIDRRTFLAGTGAVLLAAPLAAQEQPAGKVWRIGQ |
| Ga0184638_10244811 | 3300018052 | Groundwater Sediment | MNRRTFLAGTGALLAAPLAAQAQTAGKVYRIAVLGLT |
| Ga0184612_103591002 | 3300018078 | Groundwater Sediment | VIDRRSFLAGTGAVLLAAPLAAEAQQAAKIARIGYLA |
| Ga0184629_100239985 | 3300018084 | Groundwater Sediment | MIDRRTFLAGTGAVLLAAPFGAQAQQAAKVHRIGFLSAVRSL |
| Ga0210400_111513201 | 3300021170 | Soil | MDRRTFIAGITGGLLAAPLAAEAQKSEKMARVGILGVG |
| Ga0210384_100630714 | 3300021432 | Soil | MIDRRAFISGITLSLLAAPLAAEAQKSEKMVRVGILGVGPAPSP |
| Ga0209431_105700971 | 3300025313 | Soil | VIDRRTFLAGTGVALLAAPFAAEAQQAAKIARIGYLS |
| Ga0207684_100256346 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MERRAFLAGTGAVLAAAPLTAGAQQSSDKVYRVTVI |
| Ga0207693_106501601 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MERRTFLAGTGAMLLAAPLAAEAQKPRKTARVGYLLVGPANSAPSQ |
| Ga0207709_113948472 | 3300025935 | Miscanthus Rhizosphere | MIDRRTFLAGTGAVLLAAPFGAEAQQASGQPRLGWLS |
| Ga0207665_110554521 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VNRRAFIGTVTGGLLAAPLAAEAQKSEQKSEKMARVGILGIGPAPN |
| Ga0208418_10326122 | 3300026018 | Natural And Restored Wetlands | MIDRRAFLAGTGAMLLAAPLAAEAQPTNKVARIGV |
| Ga0209154_10522323 | 3300026317 | Soil | MTSVMDRRTFLAGTGAMFLATPLGAEAQPATIRDRC |
| Ga0209377_10805761 | 3300026334 | Soil | MTSVMDRRTFLAGTGAMFLATPLAAEAQPATIRDR |
| Ga0257162_10301251 | 3300026340 | Soil | MDRRVFLSALSGGLLAAPLAAEAQKSEKKARVGILNPGS |
| Ga0257167_10229373 | 3300026376 | Soil | MDRRAFLSALSGGLLAAPLAAEAQKSEKKARVGIL |
| Ga0257169_10456172 | 3300026469 | Soil | MDRRTFLAGTGAVLLAAPLVAEAQQAGKVFRIGSVN |
| Ga0257172_10724873 | 3300026482 | Soil | VERRVFIRTVSGGLLAAPLAAEAQLARKVARVGILFWEMG |
| Ga0257160_10680521 | 3300026489 | Soil | MDRRVFLSALSGGLLAAPLAAEAQKSEKKACVGILNLGSVP |
| Ga0257164_10428902 | 3300026497 | Soil | VIDRRTFLAGTGAVLLAAPLAAEAQQAGTVCRIGIAR |
| Ga0209806_10698103 | 3300026529 | Soil | MNRRTFLAGTGAVLLAAPLAAEAQSAGKVPRVGYLS |
| Ga0209056_103546181 | 3300026538 | Soil | VIDRRTFLAGTGAVLLAAPLAVEAQPPRKTARVGVLGVGPTP |
| Ga0179593_11723872 | 3300026555 | Vadose Zone Soil | MTSVMDRRTFLAGTGAMFLAPPLAAEAQPATIRDR |
| Ga0209701_102127582 | 3300027862 | Vadose Zone Soil | VDRRRFIAGAVAVIAAPLVAEAQQAGRMRRIGVLIH |
| Ga0209590_101898261 | 3300027882 | Vadose Zone Soil | MNRRTFLAGTGAVLLAAPLSAQAQQPGKVYQVGLLS |
| Ga0209590_104136591 | 3300027882 | Vadose Zone Soil | MISRRAFFGTMAGGLLAAPLAAEAQKSEKMARVGILGIGPA |
| Ga0209526_102647941 | 3300028047 | Forest Soil | MHRRTFLAGTGAVLLAVPLAAQAQPAGNVSRIGFL |
| Ga0307504_102792961 | 3300028792 | Soil | MDRRVFLGALSGGLLAAPLAAEAQKSERKARVGILNLGS |
| Ga0170824_1257242821 | 3300031231 | Forest Soil | MDRRTFLAGTGAVLLAAPPAAEAQQAGKVPRVGFL |
| Ga0307469_107945121 | 3300031720 | Hardwood Forest Soil | MIDRRTFLAGTGAVLLAAPLAAEAQQAGKVPRIGFLSV |
| Ga0307469_114345171 | 3300031720 | Hardwood Forest Soil | MIDRRTFLAATGAVLLAAPLGAEAQPASGVPRLGWLSP |
| Ga0307469_123597761 | 3300031720 | Hardwood Forest Soil | MSESTVMDRRTFLAGTGAVLLARPLAAEAQKSEKMTHVGILGIGPAPS |
| Ga0307468_1001096543 | 3300031740 | Hardwood Forest Soil | MISRRAFIGSVAGGLLAAPLAAEAQKSEKKARVGILG |
| Ga0307468_1001797564 | 3300031740 | Hardwood Forest Soil | VIDRRTFLAGTGVMLLAAPLAAEAQSPLKVHQIGFLPSGA |
| Ga0307468_1004700281 | 3300031740 | Hardwood Forest Soil | MERRTFLAGTGAILLAAPLAAEGQQPGKVYRVGILGIKA |
| Ga0307468_1013595082 | 3300031740 | Hardwood Forest Soil | MDRRAFLAGTGAVLLAAPLAAEAQQTKKVYRIGWMIG |
| Ga0307468_1014523021 | 3300031740 | Hardwood Forest Soil | MERRTFLAGIGAVLLAAPFAAHAQKSGKTARVGVLNIGPAPSPQE |
| Ga0318508_12168602 | 3300031780 | Soil | LNRVQRRQFLIAAGGLLAAPFAAEAQRAAKVARIG |
| Ga0307473_105300891 | 3300031820 | Hardwood Forest Soil | VIDRRRFLAGTGAVLLAAPLAAQAQQAAKVYRIGMLLA |
| Ga0315290_113279741 | 3300031834 | Sediment | MDRRTFLAGTGALLLAAPRAAEAQKSEKKARVGILGVG |
| Ga0306923_101036264 | 3300031910 | Soil | MDRRRFLAGTGAVLLATPLAAWAQQAAKVYRVGLLGGS |
| Ga0310909_112989533 | 3300031947 | Soil | VICRRAFVAGLTGGLLVAPLATVAQKSEKIARVGILG |
| Ga0214473_107883942 | 3300031949 | Soil | MDRRTFLADTVAVLLAAPLAAQQAGKMPRVGVIASTTS |
| Ga0318530_102967602 | 3300031959 | Soil | VISRRAFVASLTGGLLTAPPAAEAQKSEKIARVGILGIGSAPSP |
| Ga0315278_116960481 | 3300031997 | Sediment | LIDRRTFLAGTGVVFLAAPLAAEAQKSEKMARVGILGVGSVPSP |
| Ga0315281_121185733 | 3300032163 | Sediment | MDRRTFLAGTGAVLLAAPRAAEAQKSEKKARVGILGIGPAPS |
| Ga0307470_102975092 | 3300032174 | Hardwood Forest Soil | VIERRAFLAGTGAVLLAAPLAAEVQSAEKVYRIGILT |
| Ga0307471_1000823024 | 3300032180 | Hardwood Forest Soil | MTSVICRRTFLAGTGAVLLAAPLALEAQPAKKTARVGVLGVGPT |
| Ga0307471_1006440753 | 3300032180 | Hardwood Forest Soil | VIDRRTFLAGTGTLLLAAPLGAEAQPTEKLPRVGILSP |
| Ga0307471_1008223972 | 3300032180 | Hardwood Forest Soil | MDRRTFLAGTGAVVLATPLAAEAQQAGQMPHVGFVTSNPRTATS |
| Ga0307471_1009033323 | 3300032180 | Hardwood Forest Soil | VIDRRTFLAGTGAVLLAAPLAAGAQQAEKAARVAVL |
| Ga0307471_1013909882 | 3300032180 | Hardwood Forest Soil | VIDRRTFLAGTGAVLLAAPFAAEAQQAAKVARIGYL |
| Ga0307471_1022900452 | 3300032180 | Hardwood Forest Soil | MMDRRTFLAGTGAVLLAAPFGAEAQPAGKVHHIGFLPSGASEA |
| Ga0307471_1023432242 | 3300032180 | Hardwood Forest Soil | LRENPVIDRRTFLAGTGAVLLAAPLTAGEHEAGKVWRIGYLSPG |
| Ga0307471_1026741362 | 3300032180 | Hardwood Forest Soil | MTSVIDRRTFLAGTGAVLLAAPLAAHAQQATKVPRIGF |
| Ga0307471_1028214142 | 3300032180 | Hardwood Forest Soil | VDRRGFIVAVTGGLLAAPRAAEAQKSEKKARVGVL |
| Ga0307471_1042559581 | 3300032180 | Hardwood Forest Soil | MIDRRTFLAGTGAVVLAAPFAAEAQQAGRMYRIGWL |
| Ga0307472_1008069631 | 3300032205 | Hardwood Forest Soil | MISRRAFIGSVAGGLLAAPLAAEAQRSEKMARVGILGIGTAPTPQ |
| Ga0307472_1017037071 | 3300032205 | Hardwood Forest Soil | VIDRRTFLAGTGAVLLAAPLTAGEQEAGKVWRIGYLSPGFP |
| Ga0307472_1017343132 | 3300032205 | Hardwood Forest Soil | VIDRRTFLAGTGAVLLAAPLAAEAQQEKKLPRVGIIW |
| Ga0315286_117692282 | 3300032342 | Sediment | VIDRRTFLAGTGAVLLAAPLAAEGQQARKVYRIGYLG |
| Ga0315287_114791271 | 3300032397 | Sediment | MDRRTFLAGTGALLLAAPRAAEAQKSEKKARVGILGI |
| Ga0315275_108001651 | 3300032401 | Sediment | VIDRRTFLAGTGAVLLAAPLAAEAQTGRMYRIGVIDLAGSGP |
| Ga0315275_125087121 | 3300032401 | Sediment | MRKDPLIDRRTFLAGTGVVLLAAPLAAEAQKSEKMARVGILGIG |
| Ga0315273_119024101 | 3300032516 | Sediment | MMYRRTFIAIAVGAVLAAPRRSGAQVAGKVYRIGYLGQ |
| Ga0335084_119016142 | 3300033004 | Soil | VIDRRTFLAGTGAVLLPAPLAAEAQQAAKVARIGYLTVDVAPDR |
| Ga0326730_11124861 | 3300033500 | Peat Soil | MNRRTFLAGTGAALLAAPLAAEAQQTGKLHRVGYMSVVSRQSA |
| Ga0326732_10444631 | 3300033501 | Peat Soil | MMDRRAFLTGTGAVLLAAPLVADAQQAGKVAHIGVLGDTSP |
| Ga0364934_0265577_2_118 | 3300034178 | Sediment | MERRTFLAGTGAVLLAPPLAAQQAAKVARIGYLAGNLAA |
| ⦗Top⦘ |