NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F039851

Metagenome / Metatranscriptome Family F039851

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039851
Family Type Metagenome / Metatranscriptome
Number of Sequences 163
Average Sequence Length 39 residues
Representative Sequence MDRRTFLAGTGAVLLAAPLAAEAQQAAKVARIGYL
Number of Associated Samples 120
Number of Associated Scaffolds 163

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 93.33 %
% of genes near scaffold ends (potentially truncated) 66.26 %
% of genes from short scaffolds (< 2000 bps) 64.42 %
Associated GOLD sequencing projects 118
AlphaFold2 3D model prediction Yes
3D model pTM-score0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (64.417 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(21.472 % of family members)
Environment Ontology (ENVO) Unclassified
(33.742 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(33.742 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 26.98%    β-sheet: 0.00%    Coil/Unstructured: 73.02%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 163 Family Scaffolds
PF04392ABC_sub_bind 41.10
PF12867DinB_2 3.07
PF04303PrpF 1.84
PF02518HATPase_c 1.84
PF00924MS_channel 1.23
PF01548DEDD_Tnp_IS110 1.23
PF09995MPAB_Lcp_cat 1.23
PF00296Bac_luciferase 1.23
PF03992ABM 1.23
PF02371Transposase_20 1.23
PF04226Transgly_assoc 1.23
PF00596Aldolase_II 1.23
PF05494MlaC 0.61
PF03988DUF347 0.61
PF02416TatA_B_E 0.61
PF08734GYD 0.61
PF01568Molydop_binding 0.61
PF13240zinc_ribbon_2 0.61
PF07883Cupin_2 0.61
PF00753Lactamase_B 0.61
PF12773DZR 0.61
PF13541ChlI 0.61
PF03328HpcH_HpaI 0.61
PF01850PIN 0.61
PF00589Phage_integrase 0.61
PF05163DinB 0.61
PF07978NIPSNAP 0.61
PF13501SoxY 0.61
PF14659Phage_int_SAM_3 0.61
PF00578AhpC-TSA 0.61
PF13432TPR_16 0.61
PF00497SBP_bac_3 0.61
PF00072Response_reg 0.61

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 163 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 41.10
COG3547TransposaseMobilome: prophages, transposons [X] 2.45
COG28282-Methylaconitate cis-trans-isomerase PrpF (2-methyl citrate pathway)Energy production and conversion [C] 1.84
COG0668Small-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 1.23
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.23
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 1.23
COG3264Small-conductance mechanosensitive channel MscKCell wall/membrane/envelope biogenesis [M] 1.23
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 0.61
COG1826Twin-arginine protein secretion pathway components TatA and TatBIntracellular trafficking, secretion, and vesicular transport [U] 0.61
COG2301Citrate lyase beta subunitCarbohydrate transport and metabolism [G] 0.61
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.61
COG2854Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter MlaCell wall/membrane/envelope biogenesis [M] 0.61
COG38362-keto-3-deoxy-L-rhamnonate aldolase RhmACarbohydrate transport and metabolism [G] 0.61
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 0.61
COG4705Uncharacterized membrane-anchored proteinFunction unknown [S] 0.61


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.42 %
UnclassifiedrootN/A35.58 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090009|LWAnN_F624WLL02G1IN9All Organisms → cellular organisms → Bacteria516Open in IMG/M
2088090014|GPIPI_17427372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium moriokaense2629Open in IMG/M
2199352025|deepsgr__Contig_170177All Organisms → cellular organisms → Bacteria1816Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100660223Not Available739Open in IMG/M
3300000955|JGI1027J12803_106348681All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300003994|Ga0055435_10226898All Organisms → cellular organisms → Bacteria → Proteobacteria544Open in IMG/M
3300004633|Ga0066395_10421464All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300005332|Ga0066388_102236868All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300005363|Ga0008090_15198892All Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
3300005437|Ga0070710_10936954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales627Open in IMG/M
3300005713|Ga0066905_100148782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1683Open in IMG/M
3300005719|Ga0068861_100881903Not Available846Open in IMG/M
3300005764|Ga0066903_102059217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1098Open in IMG/M
3300005841|Ga0068863_100134940All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2358Open in IMG/M
3300005841|Ga0068863_100205350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1896Open in IMG/M
3300005844|Ga0068862_101471005All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium686Open in IMG/M
3300006046|Ga0066652_100281752All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1468Open in IMG/M
3300006163|Ga0070715_10161790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1107Open in IMG/M
3300006755|Ga0079222_11445819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium640Open in IMG/M
3300007076|Ga0075435_100137533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2047Open in IMG/M
3300009012|Ga0066710_100139606All Organisms → cellular organisms → Bacteria3345Open in IMG/M
3300009038|Ga0099829_10060150All Organisms → cellular organisms → Bacteria2846Open in IMG/M
3300009038|Ga0099829_11182163All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300009089|Ga0099828_10363635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1304Open in IMG/M
3300009089|Ga0099828_11129096All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300009162|Ga0075423_12014433All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300010046|Ga0126384_10432837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1119Open in IMG/M
3300010046|Ga0126384_11227652Not Available692Open in IMG/M
3300010046|Ga0126384_11823164All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium578Open in IMG/M
3300010047|Ga0126382_11131735All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13696Open in IMG/M
3300010358|Ga0126370_11520677All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium637Open in IMG/M
3300010358|Ga0126370_12080901Not Available557Open in IMG/M
3300010360|Ga0126372_10532137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1111Open in IMG/M
3300010360|Ga0126372_12887720All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium532Open in IMG/M
3300010361|Ga0126378_10060594All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium3577Open in IMG/M
3300010366|Ga0126379_11208371All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium862Open in IMG/M
3300010391|Ga0136847_10150711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.33339Open in IMG/M
3300010403|Ga0134123_10301218Not Available1422Open in IMG/M
3300011106|Ga0151489_1469485All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300011269|Ga0137392_10004678All Organisms → cellular organisms → Bacteria8533Open in IMG/M
3300011269|Ga0137392_11108112All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300011271|Ga0137393_10949565All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300012096|Ga0137389_10854959All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300012189|Ga0137388_11850861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300012199|Ga0137383_10381427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1033Open in IMG/M
3300012199|Ga0137383_10470098All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300012202|Ga0137363_11333232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium606Open in IMG/M
3300012205|Ga0137362_10360524All Organisms → cellular organisms → Bacteria1259Open in IMG/M
3300012205|Ga0137362_10367055All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1247Open in IMG/M
3300012207|Ga0137381_10352905All Organisms → cellular organisms → Bacteria → Proteobacteria1282Open in IMG/M
3300012207|Ga0137381_10603123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria957Open in IMG/M
3300012207|Ga0137381_10753168All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300012209|Ga0137379_10834448All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium826Open in IMG/M
3300012211|Ga0137377_10755380All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300012354|Ga0137366_10055613All Organisms → cellular organisms → Bacteria3029Open in IMG/M
3300012359|Ga0137385_10403667All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium symbiodeficiens1165Open in IMG/M
3300012361|Ga0137360_10534763Not Available1000Open in IMG/M
3300012362|Ga0137361_10792820All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300012917|Ga0137395_10287213All Organisms → cellular organisms → Bacteria1163Open in IMG/M
3300012927|Ga0137416_10661094All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium915Open in IMG/M
3300012929|Ga0137404_11685419All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300012930|Ga0137407_12291678Not Available516Open in IMG/M
3300012944|Ga0137410_11822981Not Available537Open in IMG/M
3300012948|Ga0126375_10876338All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300012948|Ga0126375_11134147All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13646Open in IMG/M
3300012948|Ga0126375_11796604All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300012948|Ga0126375_12008011Not Available511Open in IMG/M
3300012976|Ga0134076_10459610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium576Open in IMG/M
3300014882|Ga0180069_1043620Not Available997Open in IMG/M
3300014884|Ga0180104_1212340Not Available577Open in IMG/M
3300015374|Ga0132255_101685596All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium962Open in IMG/M
3300015374|Ga0132255_104803278All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium572Open in IMG/M
3300018051|Ga0184620_10122161All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300018052|Ga0184638_1024481All Organisms → cellular organisms → Bacteria2153Open in IMG/M
3300018078|Ga0184612_10359100All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria738Open in IMG/M
3300018084|Ga0184629_10023998All Organisms → cellular organisms → Bacteria2565Open in IMG/M
3300025313|Ga0209431_10570097All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300025910|Ga0207684_10025634All Organisms → cellular organisms → Bacteria5025Open in IMG/M
3300025935|Ga0207709_11394847All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium580Open in IMG/M
3300026018|Ga0208418_1032612All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria552Open in IMG/M
3300026317|Ga0209154_1052232All Organisms → cellular organisms → Bacteria1819Open in IMG/M
3300026334|Ga0209377_1080576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1384Open in IMG/M
3300026469|Ga0257169_1045617All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300026497|Ga0257164_1042890All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300026529|Ga0209806_1069810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1586Open in IMG/M
3300026538|Ga0209056_10354618All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300026555|Ga0179593_1172387All Organisms → cellular organisms → Bacteria2871Open in IMG/M
3300027862|Ga0209701_10212758All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300027882|Ga0209590_10189826All Organisms → cellular organisms → Bacteria1294Open in IMG/M
3300028047|Ga0209526_10264794All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1172Open in IMG/M
3300031231|Ga0170824_125724282All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium573Open in IMG/M
3300031720|Ga0307469_10794512All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300031720|Ga0307469_11434517All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium659Open in IMG/M
3300031740|Ga0307468_100179756All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1403Open in IMG/M
3300031740|Ga0307468_100470028All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300031740|Ga0307468_101359508All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300031740|Ga0307468_101452302All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300031780|Ga0318508_1216860Not Available549Open in IMG/M
3300031820|Ga0307473_10530089Not Available800Open in IMG/M
3300031910|Ga0306923_10103626All Organisms → cellular organisms → Bacteria → Proteobacteria3212Open in IMG/M
3300031949|Ga0214473_10788394All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300032174|Ga0307470_10297509Not Available1093Open in IMG/M
3300032180|Ga0307471_100082302All Organisms → cellular organisms → Bacteria2838Open in IMG/M
3300032180|Ga0307471_100644075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1221Open in IMG/M
3300032180|Ga0307471_100822397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1096Open in IMG/M
3300032180|Ga0307471_100903332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1050Open in IMG/M
3300032180|Ga0307471_101390988All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300032180|Ga0307471_102290045All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium681Open in IMG/M
3300032180|Ga0307471_102343224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium674Open in IMG/M
3300032180|Ga0307471_102674136All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium633Open in IMG/M
3300032180|Ga0307471_104255958All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300032205|Ga0307472_101703707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium623Open in IMG/M
3300032205|Ga0307472_101734313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium618Open in IMG/M
3300032342|Ga0315286_11769228All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300032401|Ga0315275_10800165All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300032516|Ga0315273_11902410All Organisms → cellular organisms → Bacteria → Proteobacteria711Open in IMG/M
3300033004|Ga0335084_11901614All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300033500|Ga0326730_1112486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria505Open in IMG/M
3300033501|Ga0326732_1044463All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300034178|Ga0364934_0265577Not Available650Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil21.47%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil14.11%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.75%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment4.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.68%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.68%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.68%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.45%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.84%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment1.23%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.23%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.23%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.23%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.23%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.23%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.23%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.23%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment0.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.61%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.61%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.61%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.61%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.61%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.61%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.61%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.61%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090009Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C-methane anaerobic+nitrateEnvironmentalOpen in IMG/M
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004022Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014882Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10DEnvironmentalOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026018Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026340Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-AEnvironmentalOpen in IMG/M
3300026376Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-BEnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300026482Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-BEnvironmentalOpen in IMG/M
3300026489Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-AEnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033500Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fractionEnvironmentalOpen in IMG/M
3300033501Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF12FN SIP fractionEnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
LWAnN_070207302088090009Freshwater SedimentMDRRAFLAGTGAVLLAAPLAAEAQKSEKKARVGILGVGP
GPIPI_032448202088090014SoilMDRRTFLAGTSAVLVAAPRAAEAIEDKPARIGVLSS
deepsgr_028641902199352025SoilMDRRTFLAGTGAILFAVPLVTEAQPGGKTWQIGFLTGRRAPA
INPhiseqgaiiFebDRAFT_10066022313300000364SoilLAGTGAVLLAGPSAAEAQQPRKVYRVGWIIGKIHG*
JGI1027J12803_10634868133300000955SoilLIDRRTFLAGTGVVLLVSPLAAEAQFPEKVPRVGYLSP
JGI12053J15887_1031037223300001661Forest SoilMDRRSFLGIVGTGLLAAPLAAEAQKSEKMPRVGILNIGPAPSPQE
Ga0055435_1022689813300003994Natural And Restored WetlandsVIDRRTVLAGTGAVLLATPLVPEAQQARKVPRVGILGSAPTP
Ga0055432_1016077723300004022Natural And Restored WetlandsVIDRRTFLAGTGVVLLAAPVAAEAQKSQKMARVGILGIGPAPSPQ
Ga0066398_1012053323300004268Tropical Forest SoilVISRRAFVASLTGGLLTAPPAAEAQKSEKIARVGILGIGSAPSPQE
Ga0066395_1042146413300004633Tropical Forest SoilVDRRTFLAGTGGGLLATPLAAEAQPTARVYRVGFLSPGPAPH
Ga0066388_10223686833300005332Tropical Forest SoilVRRRRFLQVAGAGLLAAPLAAQAQPAGRVRRIGVLHITPDP
Ga0066388_10745864813300005332Tropical Forest SoilMERRTFLAGTGAVLLATPVPAEPQQLPKTYRIGVMIGSSPSAA
Ga0070687_10138591423300005343Switchgrass RhizosphereMIDRRAFLAGTGAVLLAAPLAAEAQKSEKKARVGILGLGPTPTPQE
Ga0008090_1519889213300005363Tropical Rainforest SoilMDRRTFLAGTGAVLLAAPLAAWAQPAKKPWRIGVLGLGQVTSEM
Ga0070710_1093695413300005437Corn, Switchgrass And Miscanthus RhizosphereLIDRRIFLAGTGAVLLAAPLTAEGQQPGKVYRIGWLASGS
Ga0066905_10014878213300005713Tropical Forest SoilMDRRTFLAGTGALLLATPLGAEAQQARKVHRIGFLP
Ga0068861_10088190313300005719Switchgrass RhizosphereMIDRRAFLAGTGAVLLAAPLAAEAQKSEKKARVGILGLG
Ga0066903_10205921723300005764Tropical Forest SoilMDRRTFLAGTSAVLLAAPLAVEAQQPRRVYRIALLYAG
Ga0068863_10013494043300005841Switchgrass RhizosphereMDRRTFLAGTGAVLLAAPLSAGAQQAGRVYKIGFL*
Ga0068863_10020535013300005841Switchgrass RhizosphereVIDRRRFLAGRAAVLLAAPLAAEAQPVGTTYRIGFLGGA
Ga0068862_10147100513300005844Switchgrass RhizosphereMTSVMDRRTFLAGTGAVLLAAPLAAEGQQAGKVWRI
Ga0070717_1197629523300006028Corn, Switchgrass And Miscanthus RhizosphereMERRTFLRVITGGLLAAPITAEAQKSEKMARVGILGIGPAPS
Ga0066652_10028175233300006046SoilMIDRRTFLAGTGAVILAAPLAAEGQPARLYRVGVVLE
Ga0070715_1016179013300006163Corn, Switchgrass And Miscanthus RhizosphereVIDRRTFLAGTGAVLLAAPLAAQAQQPGKVSRLGYLGVNRPEE
Ga0079222_1144581923300006755Agricultural SoilMDRRTFLAGTGAVLLAAPLAAEGQQAAKVPRIGYLGLNRA
Ga0075425_10154917413300006854Populus RhizosphereMISRRAFIGFVAGGLLVAPLAAEAQKSQKMARVGILGI
Ga0075424_10152722013300006904Populus RhizosphereMDRRALLAGATALLAAPLAAEGQPAGKVWRIGFLHP
Ga0075435_10013753353300007076Populus RhizosphereMISRRIFLAGTGAVLLAAPLAAEAQQARKVHRIGFLVYGPG
Ga0075435_10053353043300007076Populus RhizosphereMNRRTFLCGLTLGAMAAPLAAVAQKSEKMARVGILGIG
Ga0066710_10013960613300009012Grasslands SoilLLDRRTFLAGTSALLLVAPFASEAQQAKKVYKIGYLS
Ga0066710_10434978213300009012Grasslands SoilMISRRAFINTLASGLLAAPLAAEAQKSEKMARVGILG
Ga0099829_1006015013300009038Vadose Zone SoilVIDRRTFLAGTGAVLLAAPFAAQAQQGEKVWRLGVLSPG
Ga0099829_1118216323300009038Vadose Zone SoilMDRRTFLAGTGAVLLAAPRVSEAQPSGKVPRVGYLSVF
Ga0099828_1036363533300009089Vadose Zone SoilVIDRRTFLAGTGAVVLAAPLTAAAQPAGTVPRVGYLSAGS
Ga0099828_1112909623300009089Vadose Zone SoilMERRTFLAGTGTVLLAAPLKAEAQEAAKAYRIGILG*
Ga0114129_1256401113300009147Populus RhizosphereVNRRAFIGTIAGGLLTAPLAAVAQKSEQKSEKMARVGILGIGPAPNPQE
Ga0075423_1201443323300009162Populus RhizosphereVIDRRTFLAGTGAALLAAPLAGEAQQSGKVPRVGYATSTDKSI
Ga0126374_1084123523300009792Tropical Forest SoilMNRRAFVTGLGATLAAPLAAEGQPAAAVPKIGYLSPWA
Ga0126384_1043283713300010046Tropical Forest SoilVIVRRTFLAGTGAVLLAAPLAAEGQQSGKVRRVGF
Ga0126384_1122765213300010046Tropical Forest SoilMSRYMAGMKRRTFLGTVGAALLAMPLAAEAQQAGK
Ga0126384_1182316413300010046Tropical Forest SoilVINRRTFLAGTGAVLLAAPLAADAAPTRKVPVVGYLAPEAE
Ga0126382_1113173523300010047Tropical Forest SoilVIDRRTFLAGAGAVLLAAPLAAETQEAKKVYRIGYLSAGSLF
Ga0126373_1328480733300010048Tropical Forest SoilVIDRRVFVGTLSGGILATQFAAEAQKPEKMARVGILGLGPV
Ga0134063_1073489113300010335Grasslands SoilVHRRAFLAGTGAVLLTAPLVAQAQPAGRATRIGFLSPSSLHDPRTQT
Ga0126370_1152067723300010358Tropical Forest SoilMIARRTFLAGTGAVLLAVPLVAEAQQPGKLYRIGWLGLNPP
Ga0126370_1208090123300010358Tropical Forest SoilMDRRTFLAGTGAVLLAAPLAAGAQPAGKVYRVATVSWANEFS
Ga0126372_1053213723300010360Tropical Forest SoilLIDRRTFLAGTAAVVLAAPLAAEGQQPGRLYKIGY
Ga0126372_1288772013300010360Tropical Forest SoilMDRRTFLAGTGAVLLAAPLAAEAQESPKKVARVGILG
Ga0126378_1006059413300010361Tropical Forest SoilVIDRRTFLACTGAVVLAAPLVAEAQQAGEVPRIGYLLPNANR
Ga0126379_1120837113300010366Tropical Forest SoilVDRRTFLAGTGAVLLAAPLAAEAQQARKAPLIGILWNNPLA
Ga0136847_1015071153300010391Freshwater SedimentVIDRRTFLAGTGAVLLAAPLATDAQPTAKIPRIGVLQVGTA
Ga0136847_1080308753300010391Freshwater SedimentMNRRAFLAGTGAALLAAPRAAEAQKTEKKARVGILGIG
Ga0126383_1144258133300010398Tropical Forest SoilVIDRRVFVGTLSGGILATQFAAEAQKPEKMARVGILGLGPVPSPQE
Ga0134122_1309138913300010400Terrestrial SoilMHRRAFLKTLSGGLLAAPLAAEAQKSEKKARVGILN
Ga0134123_1030121823300010403Terrestrial SoilVERRIFLAGTGAVLLTRPLPAEAQQPERVYRIGFLWDS
Ga0151489_146948523300011106SoilMNRRTFLSATGAVLLAAPIEAQSATKVPRIGYLGLDLA*
Ga0137392_10004678113300011269Vadose Zone SoilVIARRAFLVGTGAVLLAAPFAAVTAQPREKVPRVGY
Ga0137392_1110811223300011269Vadose Zone SoilLIDRRTFLAGIGVVLLAPPLAAEAQQARKVYKIGS
Ga0137393_1094956523300011271Vadose Zone SoilVIDRRTFLAGTGAVLLATPLAAGAQQAGKMWRIVTMQEDFTS
Ga0137389_1085495913300012096Vadose Zone SoilVDRRTFLAGTGAVLLAAPLAAEGQPSVKLRKIGFLRPGLPPQ
Ga0137388_1185086113300012189Vadose Zone SoilLIDRRTFLAGTGAVLLAAPLAADAQQPGKVWRIGYLQAGARTPDG
Ga0137383_1038142733300012199Vadose Zone SoilVIDRRAFLAGTGAVLLAAPLAAEAQQAGKVYRVGILGEKASD
Ga0137383_1047009813300012199Vadose Zone SoilMDRRTFLAGTGAVVFAAPLAVQAQQPKKVWRIGFLAAGT
Ga0137363_1133323213300012202Vadose Zone SoilVIDRRTFLAGTGAVLLAAPLAAEGQQGGKVDRIGHI
Ga0137362_1036052423300012205Vadose Zone SoilVIDRRTFIAGTGAVILAAPLAAEGQLAKKVYRIR*
Ga0137362_1036705533300012205Vadose Zone SoilMHAVMDRRTFLAGTGAALLSTSLAAEAQQAGKVWRIGY
Ga0137381_1035290533300012207Vadose Zone SoilMDRRTFLAGTGAVVFAAPLAVQAQQPKKVWRIGFLA
Ga0137381_1060312323300012207Vadose Zone SoilMDRRAFLTGTGAVLLAAPLAAEAQQAGKAYRVGILVIA
Ga0137381_1075316823300012207Vadose Zone SoilLIDRRTFLAGAGAALLAAPLAAEAQQATKVARIGYLGNTLGAP
Ga0137379_1083444823300012209Vadose Zone SoilMERRAFLTGTGALLLAAPLAAEAQETGKGLASVCS
Ga0137377_1075538013300012211Vadose Zone SoilMMERRAFLAGTGAVLLAAPLAAQAQTVGTVRRIGVVGGAN
Ga0137366_1005561313300012354Vadose Zone SoilMDRRTFLAGTGAVFLAASLAAEAQQPGKKVWIGVLSQGLPDPPPG
Ga0137385_1040366723300012359Vadose Zone SoilMDRRTFLAGTGAVLLAAPLAAQAEQADRVFRIGVL
Ga0137360_1053476323300012361Vadose Zone SoilVIDRRTFLAGTSAVLLAAPFAAEAQQTEKVWRIGW
Ga0137361_1079282013300012362Vadose Zone SoilVERRAFLAGAGAVLLAAPLAAEAQQAGKVYRVGILGEKAS
Ga0137361_1133400413300012362Vadose Zone SoilVIDRRTFLVGTGALLLAAPLAAEAQQAKKVWRIGLLS
Ga0137395_1028721323300012917Vadose Zone SoilVIDRRTFLAGTGAVLLAAPLAAETQQAGKVARVGYLSPN
Ga0137416_1066109413300012927Vadose Zone SoilMDRSFIAGATALLTAPLVAEAQQAGTVPRIGFLQG
Ga0137416_1144857213300012927Vadose Zone SoilMERRAFLAGTGAVLLASPLAVEAQQPRVYRVGVVMQGGP
Ga0137404_1068406133300012929Vadose Zone SoilMDRRVFLSALSGGLLAAPLAAEAQKPEKKARVGILNLGS
Ga0137404_1168541913300012929Vadose Zone SoilMDRRTFLAGTGAVLLAAPLAAEGQKSEKKARVGIL
Ga0137407_1229167823300012930Vadose Zone SoilVIDRRTFLAGTGGVFLAAPLAAEAQPTGKVHRIGFLAFSPP
Ga0137410_1182298113300012944Vadose Zone SoilVIDRRTFLAGTGAVLLAAPPPGEGQPAGKVPRIALL
Ga0126375_1019966933300012948Tropical Forest SoilMDRRTFLAGTGVVLLTAPLAGEAQQAKKVWRIGFLSSRSSPANL
Ga0126375_1087633823300012948Tropical Forest SoilVDRRTFLAGTGAVLLAAPLAAEGQQAGKVARIGYSF*
Ga0126375_1113414723300012948Tropical Forest SoilVNRRTFLAGTGAVLLAAPLSAKAQPAGKVYRIGYLSSGS
Ga0126375_1179660423300012948Tropical Forest SoilVERRTFLAGTGAVLLAAPLVAEAQQPGKVHRIGFLSG
Ga0126375_1200801123300012948Tropical Forest SoilMIRLWFAGTGAVLLAAPLAVEAQPAGKVARVGLLGLFT
Ga0134076_1045961023300012976Grasslands SoilMDRRTFLAGTGAVLLAAPLAAEAQQAAKVARIGYL
Ga0134087_1015068913300012977Grasslands SoilMDRRTFMGALTGGFLVAPLSAEAQKSEKMARVGILGI
Ga0180069_104362023300014882SoilMIDRRTFLAGPGAVLLAAPFGAQAQQAAKVHRIGFLSAARSL*
Ga0180104_121234013300014884SoilLIDRRTFLAGTGAVLLAAPLAAEAQKSERTARVGILGIG
Ga0132255_10168559613300015374Arabidopsis RhizosphereMDRRTFLAGTGAMFLAAPLAAEAQQAKKVYRIGWMIGSSI
Ga0132255_10480327823300015374Arabidopsis RhizosphereVIARRTFLAGTGAVLLAAPLAAGAQQAKKVYRLGYLSAGS
Ga0184620_1012216123300018051Groundwater SedimentVIDRRTFLAGTGAVLLAAPLAAQEQPAGKVWRIGQ
Ga0184638_102448113300018052Groundwater SedimentMNRRTFLAGTGALLAAPLAAQAQTAGKVYRIAVLGLT
Ga0184612_1035910023300018078Groundwater SedimentVIDRRSFLAGTGAVLLAAPLAAEAQQAAKIARIGYLA
Ga0184629_1002399853300018084Groundwater SedimentMIDRRTFLAGTGAVLLAAPFGAQAQQAAKVHRIGFLSAVRSL
Ga0210400_1115132013300021170SoilMDRRTFIAGITGGLLAAPLAAEAQKSEKMARVGILGVG
Ga0210384_1006307143300021432SoilMIDRRAFISGITLSLLAAPLAAEAQKSEKMVRVGILGVGPAPSP
Ga0209431_1057009713300025313SoilVIDRRTFLAGTGVALLAAPFAAEAQQAAKIARIGYLS
Ga0207684_1002563463300025910Corn, Switchgrass And Miscanthus RhizosphereMERRAFLAGTGAVLAAAPLTAGAQQSSDKVYRVTVI
Ga0207693_1065016013300025915Corn, Switchgrass And Miscanthus RhizosphereMERRTFLAGTGAMLLAAPLAAEAQKPRKTARVGYLLVGPANSAPSQ
Ga0207709_1139484723300025935Miscanthus RhizosphereMIDRRTFLAGTGAVLLAAPFGAEAQQASGQPRLGWLS
Ga0207665_1105545213300025939Corn, Switchgrass And Miscanthus RhizosphereVNRRAFIGTVTGGLLAAPLAAEAQKSEQKSEKMARVGILGIGPAPN
Ga0208418_103261223300026018Natural And Restored WetlandsMIDRRAFLAGTGAMLLAAPLAAEAQPTNKVARIGV
Ga0209154_105223233300026317SoilMTSVMDRRTFLAGTGAMFLATPLGAEAQPATIRDRC
Ga0209377_108057613300026334SoilMTSVMDRRTFLAGTGAMFLATPLAAEAQPATIRDR
Ga0257162_103012513300026340SoilMDRRVFLSALSGGLLAAPLAAEAQKSEKKARVGILNPGS
Ga0257167_102293733300026376SoilMDRRAFLSALSGGLLAAPLAAEAQKSEKKARVGIL
Ga0257169_104561723300026469SoilMDRRTFLAGTGAVLLAAPLVAEAQQAGKVFRIGSVN
Ga0257172_107248733300026482SoilVERRVFIRTVSGGLLAAPLAAEAQLARKVARVGILFWEMG
Ga0257160_106805213300026489SoilMDRRVFLSALSGGLLAAPLAAEAQKSEKKACVGILNLGSVP
Ga0257164_104289023300026497SoilVIDRRTFLAGTGAVLLAAPLAAEAQQAGTVCRIGIAR
Ga0209806_106981033300026529SoilMNRRTFLAGTGAVLLAAPLAAEAQSAGKVPRVGYLS
Ga0209056_1035461813300026538SoilVIDRRTFLAGTGAVLLAAPLAVEAQPPRKTARVGVLGVGPTP
Ga0179593_117238723300026555Vadose Zone SoilMTSVMDRRTFLAGTGAMFLAPPLAAEAQPATIRDR
Ga0209701_1021275823300027862Vadose Zone SoilVDRRRFIAGAVAVIAAPLVAEAQQAGRMRRIGVLIH
Ga0209590_1018982613300027882Vadose Zone SoilMNRRTFLAGTGAVLLAAPLSAQAQQPGKVYQVGLLS
Ga0209590_1041365913300027882Vadose Zone SoilMISRRAFFGTMAGGLLAAPLAAEAQKSEKMARVGILGIGPA
Ga0209526_1026479413300028047Forest SoilMHRRTFLAGTGAVLLAVPLAAQAQPAGNVSRIGFL
Ga0307504_1027929613300028792SoilMDRRVFLGALSGGLLAAPLAAEAQKSERKARVGILNLGS
Ga0170824_12572428213300031231Forest SoilMDRRTFLAGTGAVLLAAPPAAEAQQAGKVPRVGFL
Ga0307469_1079451213300031720Hardwood Forest SoilMIDRRTFLAGTGAVLLAAPLAAEAQQAGKVPRIGFLSV
Ga0307469_1143451713300031720Hardwood Forest SoilMIDRRTFLAATGAVLLAAPLGAEAQPASGVPRLGWLSP
Ga0307469_1235977613300031720Hardwood Forest SoilMSESTVMDRRTFLAGTGAVLLARPLAAEAQKSEKMTHVGILGIGPAPS
Ga0307468_10010965433300031740Hardwood Forest SoilMISRRAFIGSVAGGLLAAPLAAEAQKSEKKARVGILG
Ga0307468_10017975643300031740Hardwood Forest SoilVIDRRTFLAGTGVMLLAAPLAAEAQSPLKVHQIGFLPSGA
Ga0307468_10047002813300031740Hardwood Forest SoilMERRTFLAGTGAILLAAPLAAEGQQPGKVYRVGILGIKA
Ga0307468_10135950823300031740Hardwood Forest SoilMDRRAFLAGTGAVLLAAPLAAEAQQTKKVYRIGWMIG
Ga0307468_10145230213300031740Hardwood Forest SoilMERRTFLAGIGAVLLAAPFAAHAQKSGKTARVGVLNIGPAPSPQE
Ga0318508_121686023300031780SoilLNRVQRRQFLIAAGGLLAAPFAAEAQRAAKVARIG
Ga0307473_1053008913300031820Hardwood Forest SoilVIDRRRFLAGTGAVLLAAPLAAQAQQAAKVYRIGMLLA
Ga0315290_1132797413300031834SedimentMDRRTFLAGTGALLLAAPRAAEAQKSEKKARVGILGVG
Ga0306923_1010362643300031910SoilMDRRRFLAGTGAVLLATPLAAWAQQAAKVYRVGLLGGS
Ga0310909_1129895333300031947SoilVICRRAFVAGLTGGLLVAPLATVAQKSEKIARVGILG
Ga0214473_1078839423300031949SoilMDRRTFLADTVAVLLAAPLAAQQAGKMPRVGVIASTTS
Ga0318530_1029676023300031959SoilVISRRAFVASLTGGLLTAPPAAEAQKSEKIARVGILGIGSAPSP
Ga0315278_1169604813300031997SedimentLIDRRTFLAGTGVVFLAAPLAAEAQKSEKMARVGILGVGSVPSP
Ga0315281_1211857333300032163SedimentMDRRTFLAGTGAVLLAAPRAAEAQKSEKKARVGILGIGPAPS
Ga0307470_1029750923300032174Hardwood Forest SoilVIERRAFLAGTGAVLLAAPLAAEVQSAEKVYRIGILT
Ga0307471_10008230243300032180Hardwood Forest SoilMTSVICRRTFLAGTGAVLLAAPLALEAQPAKKTARVGVLGVGPT
Ga0307471_10064407533300032180Hardwood Forest SoilVIDRRTFLAGTGTLLLAAPLGAEAQPTEKLPRVGILSP
Ga0307471_10082239723300032180Hardwood Forest SoilMDRRTFLAGTGAVVLATPLAAEAQQAGQMPHVGFVTSNPRTATS
Ga0307471_10090333233300032180Hardwood Forest SoilVIDRRTFLAGTGAVLLAAPLAAGAQQAEKAARVAVL
Ga0307471_10139098823300032180Hardwood Forest SoilVIDRRTFLAGTGAVLLAAPFAAEAQQAAKVARIGYL
Ga0307471_10229004523300032180Hardwood Forest SoilMMDRRTFLAGTGAVLLAAPFGAEAQPAGKVHHIGFLPSGASEA
Ga0307471_10234322423300032180Hardwood Forest SoilLRENPVIDRRTFLAGTGAVLLAAPLTAGEHEAGKVWRIGYLSPG
Ga0307471_10267413623300032180Hardwood Forest SoilMTSVIDRRTFLAGTGAVLLAAPLAAHAQQATKVPRIGF
Ga0307471_10282141423300032180Hardwood Forest SoilVDRRGFIVAVTGGLLAAPRAAEAQKSEKKARVGVL
Ga0307471_10425595813300032180Hardwood Forest SoilMIDRRTFLAGTGAVVLAAPFAAEAQQAGRMYRIGWL
Ga0307472_10080696313300032205Hardwood Forest SoilMISRRAFIGSVAGGLLAAPLAAEAQRSEKMARVGILGIGTAPTPQ
Ga0307472_10170370713300032205Hardwood Forest SoilVIDRRTFLAGTGAVLLAAPLTAGEQEAGKVWRIGYLSPGFP
Ga0307472_10173431323300032205Hardwood Forest SoilVIDRRTFLAGTGAVLLAAPLAAEAQQEKKLPRVGIIW
Ga0315286_1176922823300032342SedimentVIDRRTFLAGTGAVLLAAPLAAEGQQARKVYRIGYLG
Ga0315287_1147912713300032397SedimentMDRRTFLAGTGALLLAAPRAAEAQKSEKKARVGILGI
Ga0315275_1080016513300032401SedimentVIDRRTFLAGTGAVLLAAPLAAEAQTGRMYRIGVIDLAGSGP
Ga0315275_1250871213300032401SedimentMRKDPLIDRRTFLAGTGVVLLAAPLAAEAQKSEKMARVGILGIG
Ga0315273_1190241013300032516SedimentMMYRRTFIAIAVGAVLAAPRRSGAQVAGKVYRIGYLGQ
Ga0335084_1190161423300033004SoilVIDRRTFLAGTGAVLLPAPLAAEAQQAAKVARIGYLTVDVAPDR
Ga0326730_111248613300033500Peat SoilMNRRTFLAGTGAALLAAPLAAEAQQTGKLHRVGYMSVVSRQSA
Ga0326732_104446313300033501Peat SoilMMDRRAFLTGTGAVLLAAPLVADAQQAGKVAHIGVLGDTSP
Ga0364934_0265577_2_1183300034178SedimentMERRTFLAGTGAVLLAPPLAAQQAAKVARIGYLAGNLAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.