| Basic Information | |
|---|---|
| Family ID | F039847 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 163 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MNENNRVLSRQNARELTPAEVDHVTGNINTLTICSWNPSTSTKDCDTVG |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 69.94 % |
| % of genes near scaffold ends (potentially truncated) | 26.99 % |
| % of genes from short scaffolds (< 2000 bps) | 87.12 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.215 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (20.245 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.607 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.761 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 33.77% Coil/Unstructured: 66.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF13517 | FG-GAP_3 | 2.00 |
| PF01797 | Y1_Tnp | 1.33 |
| PF01965 | DJ-1_PfpI | 1.33 |
| PF12704 | MacB_PCD | 0.67 |
| PF13649 | Methyltransf_25 | 0.67 |
| PF12681 | Glyoxalase_2 | 0.67 |
| PF01799 | Fer2_2 | 0.67 |
| PF17148 | DUF5117 | 0.67 |
| PF07676 | PD40 | 0.67 |
| PF01208 | URO-D | 0.67 |
| PF00266 | Aminotran_5 | 0.67 |
| PF02586 | SRAP | 0.67 |
| PF03795 | YCII | 0.67 |
| PF07238 | PilZ | 0.67 |
| PF15780 | ASH | 0.67 |
| PF16313 | DUF4953 | 0.67 |
| PF02604 | PhdYeFM_antitox | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.33 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.67 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.67 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.67 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.67 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.21 % |
| All Organisms | root | All Organisms | 44.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001305|C688J14111_10000815 | All Organisms → cellular organisms → Bacteria | 8123 | Open in IMG/M |
| 3300003324|soilH2_10231567 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300003573|Ga0007412J51696_1065537 | Not Available | 576 | Open in IMG/M |
| 3300004114|Ga0062593_101381125 | Not Available | 751 | Open in IMG/M |
| 3300004479|Ga0062595_100167855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1307 | Open in IMG/M |
| 3300004479|Ga0062595_101911450 | Not Available | 569 | Open in IMG/M |
| 3300004799|Ga0058863_11766759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 540 | Open in IMG/M |
| 3300004799|Ga0058863_11900772 | Not Available | 501 | Open in IMG/M |
| 3300004799|Ga0058863_11900772 | Not Available | 501 | Open in IMG/M |
| 3300004800|Ga0058861_10091250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1368 | Open in IMG/M |
| 3300004803|Ga0058862_10063758 | Not Available | 678 | Open in IMG/M |
| 3300004803|Ga0058862_12369589 | Not Available | 553 | Open in IMG/M |
| 3300004803|Ga0058862_12812192 | Not Available | 730 | Open in IMG/M |
| 3300004803|Ga0058862_12812192 | Not Available | 730 | Open in IMG/M |
| 3300005336|Ga0070680_100437786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1116 | Open in IMG/M |
| 3300005338|Ga0068868_100628340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 954 | Open in IMG/M |
| 3300005434|Ga0070709_10064506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2342 | Open in IMG/M |
| 3300005434|Ga0070709_10064506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2342 | Open in IMG/M |
| 3300005434|Ga0070709_10511584 | Not Available | 914 | Open in IMG/M |
| 3300005434|Ga0070709_10680958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 799 | Open in IMG/M |
| 3300005435|Ga0070714_100846909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 887 | Open in IMG/M |
| 3300005435|Ga0070714_101210188 | Not Available | 737 | Open in IMG/M |
| 3300005436|Ga0070713_100104754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2456 | Open in IMG/M |
| 3300005436|Ga0070713_100105382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2449 | Open in IMG/M |
| 3300005436|Ga0070713_100576885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1067 | Open in IMG/M |
| 3300005436|Ga0070713_100576885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1067 | Open in IMG/M |
| 3300005436|Ga0070713_100599483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1046 | Open in IMG/M |
| 3300005439|Ga0070711_100036524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 3291 | Open in IMG/M |
| 3300005439|Ga0070711_100298215 | Not Available | 1281 | Open in IMG/M |
| 3300005439|Ga0070711_100298215 | Not Available | 1281 | Open in IMG/M |
| 3300005439|Ga0070711_100583824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 931 | Open in IMG/M |
| 3300005439|Ga0070711_100724513 | Not Available | 839 | Open in IMG/M |
| 3300005439|Ga0070711_100779344 | Not Available | 810 | Open in IMG/M |
| 3300005458|Ga0070681_10187413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1989 | Open in IMG/M |
| 3300005458|Ga0070681_10195934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1939 | Open in IMG/M |
| 3300005458|Ga0070681_10984758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 763 | Open in IMG/M |
| 3300005526|Ga0073909_10183708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 894 | Open in IMG/M |
| 3300005526|Ga0073909_10183708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 894 | Open in IMG/M |
| 3300005526|Ga0073909_10430900 | Not Available | 626 | Open in IMG/M |
| 3300005526|Ga0073909_10646003 | Not Available | 526 | Open in IMG/M |
| 3300005529|Ga0070741_10003983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 35300 | Open in IMG/M |
| 3300005535|Ga0070684_100848912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 855 | Open in IMG/M |
| 3300005537|Ga0070730_10125145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1760 | Open in IMG/M |
| 3300005539|Ga0068853_100218957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1738 | Open in IMG/M |
| 3300005542|Ga0070732_10070669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2035 | Open in IMG/M |
| 3300005542|Ga0070732_10929359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 531 | Open in IMG/M |
| 3300005547|Ga0070693_100257737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1159 | Open in IMG/M |
| 3300005575|Ga0066702_10061658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2050 | Open in IMG/M |
| 3300005834|Ga0068851_10216877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1073 | Open in IMG/M |
| 3300006028|Ga0070717_10109979 | Not Available | 2350 | Open in IMG/M |
| 3300006028|Ga0070717_10440933 | Not Available | 1173 | Open in IMG/M |
| 3300006028|Ga0070717_10559849 | Not Available | 1035 | Open in IMG/M |
| 3300006028|Ga0070717_11891502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 538 | Open in IMG/M |
| 3300006046|Ga0066652_100532414 | Not Available | 1097 | Open in IMG/M |
| 3300006050|Ga0075028_100045630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2087 | Open in IMG/M |
| 3300006163|Ga0070715_10327586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 829 | Open in IMG/M |
| 3300006173|Ga0070716_101285745 | Not Available | 591 | Open in IMG/M |
| 3300006175|Ga0070712_100138356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1855 | Open in IMG/M |
| 3300006175|Ga0070712_101180996 | Not Available | 665 | Open in IMG/M |
| 3300006800|Ga0066660_10903148 | Not Available | 719 | Open in IMG/M |
| 3300006806|Ga0079220_10895012 | Not Available | 688 | Open in IMG/M |
| 3300006954|Ga0079219_10240080 | Not Available | 1067 | Open in IMG/M |
| 3300006954|Ga0079219_10637571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 791 | Open in IMG/M |
| 3300009176|Ga0105242_10056969 | All Organisms → cellular organisms → Bacteria | 3198 | Open in IMG/M |
| 3300009545|Ga0105237_11235938 | Not Available | 753 | Open in IMG/M |
| 3300010154|Ga0127503_10706785 | Not Available | 648 | Open in IMG/M |
| 3300010359|Ga0126376_10234966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1547 | Open in IMG/M |
| 3300010359|Ga0126376_13042691 | Not Available | 518 | Open in IMG/M |
| 3300010359|Ga0126376_13042691 | Not Available | 518 | Open in IMG/M |
| 3300010371|Ga0134125_10123373 | All Organisms → cellular organisms → Bacteria | 2884 | Open in IMG/M |
| 3300010371|Ga0134125_10453274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1422 | Open in IMG/M |
| 3300010373|Ga0134128_10115451 | All Organisms → cellular organisms → Bacteria | 3047 | Open in IMG/M |
| 3300010373|Ga0134128_10190821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2311 | Open in IMG/M |
| 3300010373|Ga0134128_12726853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 545 | Open in IMG/M |
| 3300010373|Ga0134128_13047845 | Not Available | 515 | Open in IMG/M |
| 3300010375|Ga0105239_10534815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1334 | Open in IMG/M |
| 3300011120|Ga0150983_10703639 | Not Available | 551 | Open in IMG/M |
| 3300011120|Ga0150983_14745030 | Not Available | 626 | Open in IMG/M |
| 3300012212|Ga0150985_104116404 | Not Available | 832 | Open in IMG/M |
| 3300012212|Ga0150985_106670091 | Not Available | 954 | Open in IMG/M |
| 3300012212|Ga0150985_108898770 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300012212|Ga0150985_123102962 | Not Available | 643 | Open in IMG/M |
| 3300012469|Ga0150984_108216631 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300012944|Ga0137410_10871477 | Not Available | 760 | Open in IMG/M |
| 3300012984|Ga0164309_11294341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 616 | Open in IMG/M |
| 3300012984|Ga0164309_11294341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 616 | Open in IMG/M |
| 3300012986|Ga0164304_10059182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2124 | Open in IMG/M |
| 3300012986|Ga0164304_10606778 | Not Available | 818 | Open in IMG/M |
| 3300012988|Ga0164306_12015343 | Not Available | 502 | Open in IMG/M |
| 3300013052|Ga0154014_146662 | Not Available | 602 | Open in IMG/M |
| 3300013105|Ga0157369_12273209 | Not Available | 550 | Open in IMG/M |
| 3300013296|Ga0157374_11664205 | Not Available | 663 | Open in IMG/M |
| 3300013306|Ga0163162_11404185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 794 | Open in IMG/M |
| 3300016270|Ga0182036_10618355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 870 | Open in IMG/M |
| 3300017930|Ga0187825_10209969 | Not Available | 703 | Open in IMG/M |
| 3300017930|Ga0187825_10209969 | Not Available | 703 | Open in IMG/M |
| 3300020069|Ga0197907_10349465 | Not Available | 730 | Open in IMG/M |
| 3300020069|Ga0197907_11211113 | Not Available | 541 | Open in IMG/M |
| 3300020069|Ga0197907_11275469 | Not Available | 501 | Open in IMG/M |
| 3300020070|Ga0206356_10386849 | Not Available | 552 | Open in IMG/M |
| 3300020070|Ga0206356_11216426 | Not Available | 888 | Open in IMG/M |
| 3300020070|Ga0206356_11216426 | Not Available | 888 | Open in IMG/M |
| 3300020077|Ga0206351_10079725 | Not Available | 742 | Open in IMG/M |
| 3300020077|Ga0206351_10719485 | Not Available | 655 | Open in IMG/M |
| 3300020078|Ga0206352_11160765 | Not Available | 865 | Open in IMG/M |
| 3300020078|Ga0206352_11362682 | Not Available | 517 | Open in IMG/M |
| 3300020080|Ga0206350_11032190 | Not Available | 537 | Open in IMG/M |
| 3300020610|Ga0154015_1535785 | Not Available | 574 | Open in IMG/M |
| 3300021170|Ga0210400_10312733 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300021170|Ga0210400_10551827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 950 | Open in IMG/M |
| 3300021560|Ga0126371_10262956 | Not Available | 1843 | Open in IMG/M |
| 3300021560|Ga0126371_11666379 | Not Available | 762 | Open in IMG/M |
| 3300021560|Ga0126371_11666379 | Not Available | 762 | Open in IMG/M |
| 3300021560|Ga0126371_11845680 | Not Available | 725 | Open in IMG/M |
| 3300021560|Ga0126371_11845680 | Not Available | 725 | Open in IMG/M |
| 3300021560|Ga0126371_12367887 | Not Available | 642 | Open in IMG/M |
| 3300022467|Ga0224712_10519163 | Not Available | 577 | Open in IMG/M |
| 3300022467|Ga0224712_10668764 | Not Available | 510 | Open in IMG/M |
| 3300022504|Ga0242642_1099694 | Not Available | 507 | Open in IMG/M |
| 3300025906|Ga0207699_10680549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 752 | Open in IMG/M |
| 3300025912|Ga0207707_10589986 | Not Available | 941 | Open in IMG/M |
| 3300025914|Ga0207671_11428183 | Not Available | 536 | Open in IMG/M |
| 3300025915|Ga0207693_10850738 | Not Available | 701 | Open in IMG/M |
| 3300025916|Ga0207663_10147748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1645 | Open in IMG/M |
| 3300025916|Ga0207663_10519881 | Not Available | 927 | Open in IMG/M |
| 3300025916|Ga0207663_10540573 | Not Available | 910 | Open in IMG/M |
| 3300025917|Ga0207660_10117599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2009 | Open in IMG/M |
| 3300025928|Ga0207700_10009224 | All Organisms → cellular organisms → Bacteria | 6153 | Open in IMG/M |
| 3300025928|Ga0207700_10098882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2322 | Open in IMG/M |
| 3300025928|Ga0207700_10491241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1085 | Open in IMG/M |
| 3300025928|Ga0207700_11126632 | Not Available | 701 | Open in IMG/M |
| 3300025929|Ga0207664_11793555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 536 | Open in IMG/M |
| 3300025945|Ga0207679_11469642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 625 | Open in IMG/M |
| 3300025945|Ga0207679_11976710 | Not Available | 531 | Open in IMG/M |
| 3300026527|Ga0209059_1345152 | Not Available | 505 | Open in IMG/M |
| 3300026557|Ga0179587_10919360 | Not Available | 577 | Open in IMG/M |
| 3300027775|Ga0209177_10512909 | Not Available | 502 | Open in IMG/M |
| 3300027821|Ga0209811_10055209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1365 | Open in IMG/M |
| 3300027842|Ga0209580_10019389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3011 | Open in IMG/M |
| 3300027842|Ga0209580_10064760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1727 | Open in IMG/M |
| 3300027842|Ga0209580_10099026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1409 | Open in IMG/M |
| 3300027842|Ga0209580_10186567 | All Organisms → Viruses → Predicted Viral | 1027 | Open in IMG/M |
| 3300027842|Ga0209580_10577671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 558 | Open in IMG/M |
| 3300027857|Ga0209166_10097416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1645 | Open in IMG/M |
| 3300030916|Ga0075386_12165683 | Not Available | 533 | Open in IMG/M |
| 3300030916|Ga0075386_12199011 | Not Available | 747 | Open in IMG/M |
| 3300030916|Ga0075386_12199011 | Not Available | 747 | Open in IMG/M |
| 3300030935|Ga0075401_10031870 | Not Available | 706 | Open in IMG/M |
| 3300030937|Ga0138302_1267356 | Not Available | 734 | Open in IMG/M |
| 3300030946|Ga0075379_10837989 | Not Available | 587 | Open in IMG/M |
| 3300030991|Ga0073994_12113615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 895 | Open in IMG/M |
| 3300031057|Ga0170834_106898173 | Not Available | 647 | Open in IMG/M |
| 3300031122|Ga0170822_13653952 | Not Available | 546 | Open in IMG/M |
| 3300031122|Ga0170822_15869318 | Not Available | 759 | Open in IMG/M |
| 3300031231|Ga0170824_104735223 | Not Available | 727 | Open in IMG/M |
| 3300031446|Ga0170820_13301281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2119 | Open in IMG/M |
| 3300031469|Ga0170819_11494962 | Not Available | 682 | Open in IMG/M |
| 3300031474|Ga0170818_108828841 | Not Available | 508 | Open in IMG/M |
| 3300031942|Ga0310916_10931907 | Not Available | 727 | Open in IMG/M |
| 3300031954|Ga0306926_10767456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1165 | Open in IMG/M |
| 3300032261|Ga0306920_102545109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 703 | Open in IMG/M |
| 3300032261|Ga0306920_102848033 | Not Available | 657 | Open in IMG/M |
| 3300033412|Ga0310810_10535896 | Not Available | 1150 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 20.25% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 9.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 9.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.29% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.29% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 4.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.07% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.84% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.23% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.23% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.61% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003573 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Bulk_28 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013052 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030935 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030946 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J14111_100008155 | 3300001305 | Soil | MNENNRVLSRQNARELTPAEVDHVNGNINTLTICSWNPVGGKDCDTVG* |
| soilH2_102315672 | 3300003324 | Sugarcane Root And Bulk Soil | MSENNRVLSRQNARELTPAEVDHVSGNINTLTICSWGPTPSTKDCDTVG* |
| Ga0007412J51696_10655371 | 3300003573 | Avena Fatua Rhizosphere | KEGKTMNENNRVLSRQNARELTPAEVEHVSGNINTLTICSWNPSTSTKDCDTVG* |
| Ga0062593_1013811252 | 3300004114 | Soil | MNENNRVLSRQNARELTPAEVDHVSGNINTLTICSWNPSSSTKDCDTVG* |
| Ga0062595_1001678553 | 3300004479 | Soil | MNENNRVLSRQNSRELTPAEVEHVSGNINTLTICSWNPTLGTKDCDTVG* |
| Ga0062595_1019114501 | 3300004479 | Soil | MNENNRVLSRQNARELTAAEVEHVTGNINTLTICSWNPSTSTKDCDTVG* |
| Ga0058863_117667591 | 3300004799 | Host-Associated | MRSAASLGTPQLLMKKEGKTMNENNRVLSRQNARELTPAEVEHVSGNINTLTICSWNPTLGTKDCDTVG* |
| Ga0058863_119007721 | 3300004799 | Host-Associated | MNDNNNRVLSRQNARELTAAEVDHVTGSINTLTICSATPKTGTNDCDTVG* |
| Ga0058863_119007722 | 3300004799 | Host-Associated | MNNDNRVLSRQNARELTPAEVDHVTGNINTLTICSWNPSTSTKDCDTVG* |
| Ga0058861_100912501 | 3300004800 | Host-Associated | MNENNRVLSRQNARELTPAEVDHVTGNINTLTICSSGPTPGTKDCDTVG* |
| Ga0058862_100637581 | 3300004803 | Host-Associated | MKENNRVLSRQNARELTPAEVDHITGSINTLTICSASPKTGTNDCDTIG* |
| Ga0058862_123695892 | 3300004803 | Host-Associated | MNDNNNRVLSRQNARELTPAEVDHVTGSINTLTICSATPKTGTNDCDTVG* |
| Ga0058862_128121922 | 3300004803 | Host-Associated | MNENNRVLSRQNARELTPAEVDYVTGSINTLTICSSSPKTGTNDCDTVG* |
| Ga0058862_128121923 | 3300004803 | Host-Associated | MNENNRVLSRQNARELTLAEVEHVTGNINTLTICSWNPSTSTKDCDTVG* |
| Ga0070680_1004377862 | 3300005336 | Corn Rhizosphere | MRSAASLGTPQLLMKKEGKTMNENSRVLSRQNARELTPAEVEHVSGNINTLTICSWNPTLGTKDCDTVG* |
| Ga0068868_1006283403 | 3300005338 | Miscanthus Rhizosphere | KERTMKENNRVLSRQNARELTPAEVDYVTGSINTLTICSSSPKTGTNDCDTVG* |
| Ga0070709_100645062 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKENNRVLSRQNARELTPAEVEHVTGSINTLTICSSSPKVGTNDCDTVG* |
| Ga0070709_100645063 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKENNRVLSRQNARELTPAEVEHVTGNINTLTICSWNPVGGKDCDTVG* |
| Ga0070709_105115842 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENNRVLSRQNARELTPAEVEHVVGNINTLTICSSMPSTGTKDCDTVG* |
| Ga0070709_106809581 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | NNRVLSRQNARELTPAEVEHVTGNINTLTICSWNPVGGKDCDTVG* |
| Ga0070714_1008469091 | 3300005435 | Agricultural Soil | SRQNARELTPAEVDYVTGSINTLTICSSSPKTGTNDCDTVG* |
| Ga0070714_1012101881 | 3300005435 | Agricultural Soil | MNENNRVLSRQNARELTAAEVDHVTGNINTLTICSWNPSTSTKDCDTVG* |
| Ga0070713_1001047543 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKENNRVLSRQNARELTPAEVDHVVGNINTLTICSSNPSTGIKDCDTVG* |
| Ga0070713_1001053822 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKENNRVLSRQNARELTPAEVEHVAGSINTLTICSSSPKVGTNDCDTVG* |
| Ga0070713_1005768852 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNDNRVLSRRNARELTPAEVDHVTGNINTLTICSWNPSTSTKDCDTVG* |
| Ga0070713_1005768853 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENNNRVLSRQNARELTPAEVDHVTGSINTLTICSASPKTGTNDCDTVG* |
| Ga0070713_1005994833 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKENNRVLSRQNARELTPAEVDHVTGSINTLTICSASPKTGTNDCDTLG* |
| Ga0070711_1000365245 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGNNENNRVLSRQNARELTPAEVDHVTGSINTLTICSASPKPGTNDCDTVG* |
| Ga0070711_1002982151 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNDKRVLSRQNARELTPAEVEHVTGNINTLTICSWNPIGGKDCD |
| Ga0070711_1002982152 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENNRVLSRQNARELTPAEVEHVTGSINTLTICSSSPKVGTNDCDTVG* |
| Ga0070711_1005838242 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDNNNRVLSRQNARELTSAEVDHVTGSINTLTICSATPKTGTNDCDTVG* |
| Ga0070711_1007245131 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MNESNRVLSRQNARELTPAEVEHVSGNINTLTICSWNPTLGAKDCDTVG* |
| Ga0070711_1007793442 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDNNNRILSRQNARELTPAEVDHVTGNINTLTICSWNPSSSTKDCDTVG* |
| Ga0070681_101874131 | 3300005458 | Corn Rhizosphere | MNENNRVLSRQNARELTPAEVDHVTGNINTLTICSWNPSTSTKDCDTVG* |
| Ga0070681_101959343 | 3300005458 | Corn Rhizosphere | MKENNRVLSRQNARELTPAEVEHVSGNINTLTICSWNPTLGTKDCDTVG* |
| Ga0070681_109847583 | 3300005458 | Corn Rhizosphere | MNENNRVLSRQNARELSPAEVEHVTGNINTLTICSWNPSTSTKDCDTVG* |
| Ga0073909_101837081 | 3300005526 | Surface Soil | RVLSRQNARELTPAEVDHVTGSINTLTICSASPKIGTNDCDTLG* |
| Ga0073909_101837082 | 3300005526 | Surface Soil | VNNDNRVLSRQNARELTPAEVEHVSGNINTLTICSWNPTLGTKDCDTVG* |
| Ga0073909_104309002 | 3300005526 | Surface Soil | MNENNRVLSRQNARELTPAEVDHVRGSINTLTICSASPATGTNDCDTVG* |
| Ga0073909_106460032 | 3300005526 | Surface Soil | MNDNNRVLSRRNARELTPAEVDHVTGSINTLTICSTTPKTGTTDCDTVG* |
| Ga0070741_1000398332 | 3300005529 | Surface Soil | MQESNRVLSRRNARELTPAEVDHVSGNINTLTICSWGPSPGTKDCDTVG* |
| Ga0070684_1008489121 | 3300005535 | Corn Rhizosphere | MNNDNRVLSRQNARELTPAEVEHVSGNINTLTICSWNPTLGTKDCDTVG* |
| Ga0070730_101251453 | 3300005537 | Surface Soil | MNENNRVLSRQNARELTPAEVDHVTGNINTLTICSWNPASGIKDCDTVG* |
| Ga0068853_1002189572 | 3300005539 | Corn Rhizosphere | MKKEGKTMNENSRVLSRQNARELTPAEVEHVSGNINTLTICSWNPTLGTKDCDTVG* |
| Ga0070732_100706693 | 3300005542 | Surface Soil | MNENNRVLSRQNARELTPAEVDHVTGNINTLTICSWNPYSSTKDCDTVG* |
| Ga0070732_109293593 | 3300005542 | Surface Soil | LTPAEVDHVVGNINTLTICSSNPSTGIKDCDTVG* |
| Ga0070693_1002577372 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENNRVLSRQNARELTPAEVEHVSGNINTLTICSWNPTLGTKDCDTVG* |
| Ga0066702_100616583 | 3300005575 | Soil | MNENNRVLSRQNARELTPAEVEHVSGNINTLTICSWNPSTSTKDCDTVG* |
| Ga0068851_102168773 | 3300005834 | Corn Rhizosphere | GNAMNENNRVLSRQNARELTPAEVDHVTGNINTLTICSSGPTPGTKDCDTVG* |
| Ga0070717_101099793 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENNNNRVLSRQNARELTAAEVDHVTGSINTLTICSSGPTPGTKDCDTVG* |
| Ga0070717_104409331 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGNNRVLSRQNARELTPAEVDHVSGNINTLTICSWNPSSSTKDCDTVG* |
| Ga0070717_105598492 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENNRVLSRQNARELTPAEVEHVVGNINTLTICSWGPSPGTKDCDTVG* |
| Ga0070717_118915021 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | NARELTPAEVEHVVGNINTLTICSSMPSTGTKDCDTVG* |
| Ga0066652_1005324142 | 3300006046 | Soil | MIMNDNNRVLSRRNARELTPAEVDHVTGSINTLTICSTTPKTGTTDCDTVG* |
| Ga0075028_1000456303 | 3300006050 | Watersheds | MNGNNRVLSRQNARELTPAEVDHVSGNINTLTICSWDPYRGTKDCDTVG* |
| Ga0070715_103275861 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDNNNRVLSRQNARELTPAEVDHVSGNINTLTICSWNPYQGIKDCDTVG* |
| Ga0070716_1012857451 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENNRVLSRQNARELTPAEVDHVTGNINTLTICSWNPSSSTKDCDTVG* |
| Ga0070712_1001383564 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKENNRVLSRQNARELTAAEVDHVTGNINTLTICSWNPSTSTKDCDTVG* |
| Ga0070712_1011809961 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KTMKENNRVLSRQNARELTPAEVEHVTGSINTLTICSSSPKVGTNDCDTVG* |
| Ga0066660_109031482 | 3300006800 | Soil | MKENNRVLSRQNARELTPAEVEHVSGNINTLTICSWNPSTSTKDCDTVG* |
| Ga0079220_108950122 | 3300006806 | Agricultural Soil | MKENNKENNRVLSRQNARELTPAEVDHVSGNINTLTICSWNPYQGTKDCDTVG* |
| Ga0079219_102400802 | 3300006954 | Agricultural Soil | MNESNRVLSRQNARELTPAEVDHVTGSINTLTICSASPKIGTNDCDTLG* |
| Ga0079219_106375712 | 3300006954 | Agricultural Soil | MNENNRVLSRQNARELTPAEVDHVSGNINTLTICSWNPYSGTKDCDTVG* |
| Ga0105242_100569691 | 3300009176 | Miscanthus Rhizosphere | MNENSRVLSRQNARELTPAEVEHVSGNINTLTICSWNPTLGTKDCDTVG* |
| Ga0105237_112359381 | 3300009545 | Corn Rhizosphere | MKKEGKTMNENSRVLSRQNARELTPAEVEHVTGNINTLTICSWNPSTSTKDC |
| Ga0127503_107067852 | 3300010154 | Soil | MNENNRVLSRQNARELTPAEVDHVTGNINTLTICSANPTVGTKDCDTVG* |
| Ga0126376_102349661 | 3300010359 | Tropical Forest Soil | MNENHRVLSRQNARELTPAEVDHVTGNINTLTICSSSPTTGTKDCDTVG* |
| Ga0126376_130426911 | 3300010359 | Tropical Forest Soil | MNGNNRVLSRQNARELTPAEVDHVSGSINTLTICSWGPAPGNKDGDTV |
| Ga0126376_130426912 | 3300010359 | Tropical Forest Soil | MNGNNRVLSRQNARELTTAEVDHVKGSINTLTICSAAPTKGGGTTNDCDTVG* |
| Ga0134125_101233735 | 3300010371 | Terrestrial Soil | ELTPAEVDHVSGNINTLTICSWNPVGGKDCDTVG* |
| Ga0134125_104532741 | 3300010371 | Terrestrial Soil | ARELTPAEVDHVSGNINTLTICSWGPTPGTKDCDTVG* |
| Ga0134128_101154514 | 3300010373 | Terrestrial Soil | MNENNRVLSRQNARELTPAEVDHVTGSINTLTICSAGPKTGTNDCDTIG* |
| Ga0134128_101908212 | 3300010373 | Terrestrial Soil | MNENNRVLSRQNARELTPAEVDHVSGNINTLTICSWNPVGGKDCDTVG* |
| Ga0134128_127268532 | 3300010373 | Terrestrial Soil | LTPAEVDHVTGSINTLTICSATPKTGTNDCDTVG* |
| Ga0134128_130478452 | 3300010373 | Terrestrial Soil | MNNDNRVLSRQNARELTPAEVDHVSGNINTLTICSWGPTPGTKDCDTVG* |
| Ga0105239_105348151 | 3300010375 | Corn Rhizosphere | ENNRVLSRQNARELTPAEVDHVTGSINTLTICSSSPKVGTNDCDTVG* |
| Ga0150983_107036391 | 3300011120 | Forest Soil | MKEGKTMNENNRVLSRQNARELTPAEVEHVTGNINTLTICSWNPSTSTKDCDTVG* |
| Ga0150983_147450302 | 3300011120 | Forest Soil | MKEGKTMNENNRVLSRQNARELTPAEVDHVSGNINTLTICSWNPVQGTKDCDTVG* |
| Ga0150985_1041164041 | 3300012212 | Avena Fatua Rhizosphere | MKGRKYMNENNRVLSRQNARELTPAEVDHVNGNINTLTICSWNPVGGKDCDTVG* |
| Ga0150985_1066700911 | 3300012212 | Avena Fatua Rhizosphere | MNENKRVLSRQNARELTPAEVEHVTGNINTLTICSWNPTSGTKDCDTVG* |
| Ga0150985_1088987702 | 3300012212 | Avena Fatua Rhizosphere | MPLIGFHTADQRKEMIMNDNNRVLSRRNARELTPAEVDHVTGIINTFTICSTTPKTGTTDCDTVG* |
| Ga0150985_1231029621 | 3300012212 | Avena Fatua Rhizosphere | VLSRQNARELTPAEVEHVSGNINTLTICSWNPSTSTKDCDTVG* |
| Ga0150984_1082166312 | 3300012469 | Avena Fatua Rhizosphere | MPLIGFHTADQRKEMIMNDNNRVLSRRNARELTPAEVDHVTGSINTLTICSTTPKTGTTDCDTVG* |
| Ga0137410_108714771 | 3300012944 | Vadose Zone Soil | MNDNNRVLSRQNARELTPAEVDHVTGSINTLTICSASPKIGTNDCDTVG* |
| Ga0164309_112943411 | 3300012984 | Soil | VLSRQNARELTPAEVDHVTGSINTLTICSATPKTGTNDCDTVG* |
| Ga0164309_112943412 | 3300012984 | Soil | MNNDNRVLSRQNARELSPAEVNHVTGNINTLTICSWNPSTSTKDCDTVG* |
| Ga0164304_100591821 | 3300012986 | Soil | MNDNNNRVLSRQNARELTPAEVDHVTGNINTLTICSWNPSTATKDCDTVG* |
| Ga0164304_106067781 | 3300012986 | Soil | KEEKTMKENNRVLSRQNARELTPAEVEHVTGSINTLTICSSSPKVGTNDCDTVG* |
| Ga0164306_120153432 | 3300012988 | Soil | LSRQNARELTPAEVEHVTGNINTLTICSWNPVGGKDCDTVG* |
| Ga0154014_1466621 | 3300013052 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENNRVLSRQNARELSPAEVEHVTGNINTLTICSWNPSTSTRDCDTVG* |
| Ga0157369_122732093 | 3300013105 | Corn Rhizosphere | KEGKTMNENNRVLSRQNARELSPAEVEHVTGNINTLTICSWNPSTSTKDCDTVG* |
| Ga0157374_116642051 | 3300013296 | Miscanthus Rhizosphere | MKENNRVLSRQNARELTPAEVDYVTGSINTLTICSSSPKTGTNDCDTVG* |
| Ga0163162_114041852 | 3300013306 | Switchgrass Rhizosphere | SRVLSRQNARELTPAEVEHVSGNINTLTICSWNPTLGTKDCDTVG* |
| Ga0182036_106183551 | 3300016270 | Soil | MNENNRVLSRQNARELTPAEVEHVSGNINTLTICSWNPVGGKDCDTVG |
| Ga0187825_102099691 | 3300017930 | Freshwater Sediment | MNENNRVLSRQNARELTPAEVDYVTGSINTLTICSSSPKTGTNDCDTVG |
| Ga0187825_102099692 | 3300017930 | Freshwater Sediment | MNENNRVLSRQNARELTAAEVDHVTGNINTLTICSWNPSTSTKDCDTVG |
| Ga0197907_103494652 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENNRVLSRQNARELTPAEVDHVTGNINTLTICSWNPSTSTKDCDTVG |
| Ga0197907_112111132 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENNRVLSRQNARELTAAEVEHVTGNINTLTICSWNPSTSTKDCDTVG |
| Ga0197907_112754692 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | LSRQNARELSPAEVEHVTGNINTLTICSWNPSTSTKDCDTVG |
| Ga0206356_103868491 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENNRVLSRQNARELTPAEVEHVSGNINTLTICSWNPTLGTKDCDTVG |
| Ga0206356_112164261 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTDNRVLSRQNARELTPAEVEHVSGNINTLTICSWNPTLGTKDCDTVG |
| Ga0206356_112164262 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSAASNVATTTTHEKEGKTMKENNRVLSRQNARELTPAEVDHITGSINTLTICSASPKTGTNDCDTIG |
| Ga0206351_100797251 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENNRVLSRQNARELSPAEVEHVTGNINTLTICSWNPSTSTKDCDTVG |
| Ga0206351_107194851 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENNRVLSRQNARELTPAEVDHVTGNINTLTICSSGPTPGTKDCDTVG |
| Ga0206352_111607652 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENNRVLSRQNARELTLAEVEHVTGNMNTLTICSWNPSTSTKDCDTVG |
| Ga0206352_113626822 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MNESNRVLSRQNARELTPAEVDHVTGSINTLTICSAGPKTGTNDCDTIG |
| Ga0206350_110321902 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENNRVLSRQNARELTLAEVEHVTGNINTLTICSWNPSTSTKDCDTVG |
| Ga0154015_15357851 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENNRVLSRQNARELTPAEVDHVTGNINTLTICSWNPSTSTK |
| Ga0210400_103127331 | 3300021170 | Soil | MNKNNRVLSRQNARELTPAEVDHVTGNINTLTICSWNPSSSTKDCDT |
| Ga0210400_105518272 | 3300021170 | Soil | KTMNKNNRVLSRQNARELTPAEVDHVTGNINTLTICSWNPSTSTKDCDTVG |
| Ga0126371_102629562 | 3300021560 | Tropical Forest Soil | MNENNRVLSRQNARELTPAEVDHVNGNINTLTICSWNPVGGKDCDTVG |
| Ga0126371_116663791 | 3300021560 | Tropical Forest Soil | MKDNNRVLSRQNARELTPAEVDHVTGSINTLTICSASPKVGTNDCDTLG |
| Ga0126371_116663792 | 3300021560 | Tropical Forest Soil | MNNDNRVLSRQNARELTSAEVDHVSGNINTLTACSRNPILGTSDCDTLG |
| Ga0126371_118456801 | 3300021560 | Tropical Forest Soil | MNNDSRVLSRQNARELTPAEVDHVNGNINTLTICSWGPQPGTKDCDTVG |
| Ga0126371_118456802 | 3300021560 | Tropical Forest Soil | MKENNRVLSRQNARELTPAEIDHVTGNINTLTICSAGRPPLGPNDCDTVG |
| Ga0126371_123678872 | 3300021560 | Tropical Forest Soil | MKENKRVLSRQNARELTSAEVDYVNGSINTLTICSAGRPPIGPNDCDTVG |
| Ga0224712_105191631 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKENNRVLSRQNARELTPAEVDHITGSINTLTICSASPKTGTNDCDTIG |
| Ga0224712_106687641 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENNTVLSRQNARELTPAEVDYVTGSINTLTICSSSPKTGTNDCDTVG |
| Ga0242642_10996941 | 3300022504 | Soil | MNGNNRVLSRQNARELTPAEVDHVSGNINTLTICSWDPYRGTKDCDTVG |
| Ga0207699_106805491 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | NDNNNRVLSRQNARELTPAEVDHVTGSINTLTICSATPKTGTNDCDTVG |
| Ga0207707_105899861 | 3300025912 | Corn Rhizosphere | MKENNRVLSRQNARELTPAEVEHVSGNINTLTICSWNPTLGTKDCDTVG |
| Ga0207671_114281831 | 3300025914 | Corn Rhizosphere | SRQNARELTPAEVDHITGSINTLTICSASPKTGTNDCDTIG |
| Ga0207693_108507381 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDNNNRVLSRQNARELTPAEVDHVTGSINTLTICSATPKTGTNDCDTVG |
| Ga0207663_101477483 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ALRKGKEKTMKENNRVLSRQNARELTPAEVEHVTGNINTLTICSWNPVGGKDCDTVG |
| Ga0207663_105198812 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MNESNRVLSRQNARELTPAEVEHVSGNINTLTICSWNPTLGAKDCDTVG |
| Ga0207663_105405732 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKENNRVLSRQNARELTAAEVDHVTGNINTLTICSWNPSTSTKDCDT |
| Ga0207660_101175993 | 3300025917 | Corn Rhizosphere | MNNDNRVLSRQNARELTPAEVEHVSGNINTLTICSWNPTLGTKDCDTVG |
| Ga0207700_100092244 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKENNRVLSRQNARELTPAEVDHVVGNINTLTICSSNPSTGIKDCDTVG |
| Ga0207700_100988822 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKENNRVLSRQNARELTPAEVDHVTGSINTLTICSASPKTGTNDCDTLG |
| Ga0207700_104912412 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RQNARELTPAEVEHVTGNINTLTICSWNPVGGKDCDTVG |
| Ga0207700_111266321 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKENNRVLSRQNARELTPAEVEHVAGSINTLTICSSSPKVGTNDCDTVG |
| Ga0207664_117935551 | 3300025929 | Agricultural Soil | RELTAAEVEHVTGNINTLTICSWNPSTSTKDCDTVG |
| Ga0207679_114696421 | 3300025945 | Corn Rhizosphere | HMNNDNRVLSRQNARELTPAEVEHVSGNINTLTICSWNPTLGTKDCDTVG |
| Ga0207679_119767101 | 3300025945 | Corn Rhizosphere | MKENNRVLSRQNARELTPAEVEHVSGNINTLTICSWNPTLGTKDC |
| Ga0209059_13451521 | 3300026527 | Soil | MKEGKTMNENNRVLSRQNARELTPAEVEHVSGNINTLTICSWNPSTSTKDCDTVG |
| Ga0179587_109193602 | 3300026557 | Vadose Zone Soil | MKENNRVLSRQNARELTPAEVDHVSGNINTLTICSWDPYRGVKDCDTVG |
| Ga0209177_105129091 | 3300027775 | Agricultural Soil | TMNESNRVLSRQNARELTPAEVDHVTGSINTLTICSASPKIGTNDCDTLG |
| Ga0209811_100552093 | 3300027821 | Surface Soil | MNENNRVLSRQNARELTPAEVDHVRGSINTLTICSASPATGTNDCDTVG |
| Ga0209580_100193891 | 3300027842 | Surface Soil | MNENNNNRVLSRQNARELTPAEVDHVVGNINTLTICSSNPSTGIKDCDTVG |
| Ga0209580_100647602 | 3300027842 | Surface Soil | MNENNRVLSRQNARELTPAEVDHVTGNINTLTICSWNPYSSTKDCDTVG |
| Ga0209580_100990262 | 3300027842 | Surface Soil | MNENNNRVLSRQNARELTPAEVDHVVGNINTLTICSSNPSTGIKDCDTVG |
| Ga0209580_101865672 | 3300027842 | Surface Soil | MNENNRVLSRQNARELTAAEVDHVTGNINTLTICSWNPSTSSKDCDTVG |
| Ga0209580_105776713 | 3300027842 | Surface Soil | TMNENNRVLSRQNARELTAAEVDHVTGNINTLTICSWNPSTSTKDCDTVG |
| Ga0209166_100974162 | 3300027857 | Surface Soil | MNENNRVLSRQNARELTPAEVDHVTGNINTLTICSWNPASGIKDCDTVG |
| Ga0075386_121656832 | 3300030916 | Soil | MNGNNGNNRVLSRQNARELTPAEVDHVTGNINTLTICSWNPSSSTKDCDTVG |
| Ga0075386_121990112 | 3300030916 | Soil | MKEGKTMNENNRVLSRQNARELTPAEVDHVSGSINTLTICSAAPIKGGGNDCDTVG |
| Ga0075386_121990113 | 3300030916 | Soil | MNNDNRVLSRQNARELTPAEVDHVTGNINTLTICSWNPSSSTKDCDTVG |
| Ga0075401_100318701 | 3300030935 | Soil | MKEGKTMNENNRVLSRQNARELTPAEVDHVTGNINTLTICSWNPVGGKDCDTVG |
| Ga0138302_12673561 | 3300030937 | Soil | MNGNNENNRVLSRQNARELTPAEVDHVTGSINTLTICSASPKTGTNDCDTVG |
| Ga0075379_108379893 | 3300030946 | Soil | KEGKTMNENNRVLSRQNARELTPAEVDHVTGNINTLTICSWNPVGGKDCDTVG |
| Ga0073994_121136152 | 3300030991 | Soil | MNENNRVLSRQNARELTPAEVDHVSGNINTLTICSWDPRSGTKDCDTVG |
| Ga0170834_1068981731 | 3300031057 | Forest Soil | AAQSQLLMKEGKTMNGNNGNNRVLSRQNARELTPAEVDHVSGNINTLTICSWNPVQGTKDCDTVG |
| Ga0170822_136539522 | 3300031122 | Forest Soil | SQLLMKEGKTMNENNRVLSRQNARELTPAEVDHVTGNINTLTICSWNPVGGKDCDTVG |
| Ga0170822_158693182 | 3300031122 | Forest Soil | MNGNNGNNRVLSRQNARELTPAEVDHITGNINTLTICSWNPSSSTKDCDTVG |
| Ga0170824_1047352232 | 3300031231 | Forest Soil | MNENNRVLSRQNARELTPAEVDHVTGSINPLTICSSSPKIGTNDCDTVG |
| Ga0170820_133012812 | 3300031446 | Forest Soil | MKEGKTMNGNNGNNRVLSRQNARELTPAEVDHVTGNINTLTICSWNPSSSTKDCDTVG |
| Ga0170819_114949621 | 3300031469 | Forest Soil | MNGNNENNSVLSRQNARELTPAEVDHVTGSINTLTICSASPKPGTNDCDT |
| Ga0170818_1088288412 | 3300031474 | Forest Soil | MNGNNENNRVLSRQNARELTPAEVDHVTGNINTLTICSSSPATGTKDCDTVG |
| Ga0310916_109319071 | 3300031942 | Soil | MQENNRVLSRQNARELTQTEIDYVVGSINTLTICSAAPTKGGGTTNDCDTVG |
| Ga0306926_107674564 | 3300031954 | Soil | SRQNARELTQTEIDYVVGSINTLTICSAAPTKGGGTTNDCDTVG |
| Ga0306920_1025451093 | 3300032261 | Soil | MNENNRVLSRRNARELTPGEIDHVVGNINTLTICSWDAIRGIKDCDTVG |
| Ga0306920_1028480332 | 3300032261 | Soil | MQENNRVLSRQNARELTQTEIDYVVGTINTMTICSAAPTRGGAPT |
| Ga0310810_105358962 | 3300033412 | Soil | MNESNRVLSRQNARELTPAEVDHVTGSINTLTICSASPKIGTNDCDTLG |
| ⦗Top⦘ |