| Basic Information | |
|---|---|
| Family ID | F039844 |
| Family Type | Metagenome |
| Number of Sequences | 163 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKPQEWRQKLGDCVRDLFLSPEMEHFYSVPMTLERARIYLLQLGLYVR |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 163 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.16 % |
| % of genes near scaffold ends (potentially truncated) | 97.55 % |
| % of genes from short scaffolds (< 2000 bps) | 92.02 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.319 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (11.656 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.448 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.810 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.74% β-sheet: 0.00% Coil/Unstructured: 55.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 163 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 20.86 |
| PF09084 | NMT1 | 4.91 |
| PF03241 | HpaB | 3.68 |
| PF07452 | CHRD | 1.84 |
| PF13701 | DDE_Tnp_1_4 | 1.84 |
| PF03070 | TENA_THI-4 | 1.84 |
| PF13379 | NMT1_2 | 1.23 |
| PF01075 | Glyco_transf_9 | 1.23 |
| PF07995 | GSDH | 1.23 |
| PF00005 | ABC_tran | 0.61 |
| PF00857 | Isochorismatase | 0.61 |
| PF00128 | Alpha-amylase | 0.61 |
| PF04008 | Adenosine_kin | 0.61 |
| PF00313 | CSD | 0.61 |
| PF11794 | HpaB_N | 0.61 |
| PF02776 | TPP_enzyme_N | 0.61 |
| PF00296 | Bac_luciferase | 0.61 |
| PF13607 | Succ_CoA_lig | 0.61 |
| PF09994 | DUF2235 | 0.61 |
| PF01548 | DEDD_Tnp_IS110 | 0.61 |
| PF01471 | PG_binding_1 | 0.61 |
| PF04264 | YceI | 0.61 |
| PF04972 | BON | 0.61 |
| PF13594 | Obsolete Pfam Family | 0.61 |
| PF01402 | RHH_1 | 0.61 |
| PF00156 | Pribosyltran | 0.61 |
| PF05977 | MFS_3 | 0.61 |
| PF00140 | Sigma70_r1_2 | 0.61 |
| PF01321 | Creatinase_N | 0.61 |
| PF13561 | adh_short_C2 | 0.61 |
| PF00582 | Usp | 0.61 |
| PF03320 | FBPase_glpX | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 163 Family Scaffolds |
|---|---|---|---|
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.91 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.91 |
| COG2368 | Aromatic ring hydroxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.68 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 1.23 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 1.23 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.61 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.61 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.61 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.61 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.61 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.61 |
| COG1839 | Adenosine/AMP kinase | Nucleotide transport and metabolism [F] | 0.61 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.61 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.61 |
| COG1494 | Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase or related protein | Carbohydrate transport and metabolism [G] | 0.61 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.61 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.61 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.61 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.32 % |
| Unclassified | root | N/A | 3.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_103411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1595 | Open in IMG/M |
| 3300000956|JGI10216J12902_120957277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300003999|Ga0055469_10059234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1024 | Open in IMG/M |
| 3300004052|Ga0055490_10241120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300005093|Ga0062594_102956702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300005276|Ga0065717_1014092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300005289|Ga0065704_10010907 | All Organisms → cellular organisms → Bacteria | 3553 | Open in IMG/M |
| 3300005340|Ga0070689_101824838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300005353|Ga0070669_100489839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1018 | Open in IMG/M |
| 3300005437|Ga0070710_11323181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300005444|Ga0070694_100674740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 838 | Open in IMG/M |
| 3300005561|Ga0066699_10315391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1115 | Open in IMG/M |
| 3300005575|Ga0066702_10330528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 928 | Open in IMG/M |
| 3300005586|Ga0066691_10799051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300005713|Ga0066905_100255495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1349 | Open in IMG/M |
| 3300005713|Ga0066905_101035149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300005713|Ga0066905_102075310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300005718|Ga0068866_10262201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1062 | Open in IMG/M |
| 3300005764|Ga0066903_102615250 | Not Available | 978 | Open in IMG/M |
| 3300005937|Ga0081455_10054497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3408 | Open in IMG/M |
| 3300005937|Ga0081455_10157362 | Not Available | 1745 | Open in IMG/M |
| 3300006163|Ga0070715_10444963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 730 | Open in IMG/M |
| 3300006844|Ga0075428_101177013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 808 | Open in IMG/M |
| 3300006847|Ga0075431_100021043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6667 | Open in IMG/M |
| 3300006853|Ga0075420_101595969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300006854|Ga0075425_100307112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1826 | Open in IMG/M |
| 3300006903|Ga0075426_10390011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1027 | Open in IMG/M |
| 3300006903|Ga0075426_11359191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300006903|Ga0075426_11427660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca | 526 | Open in IMG/M |
| 3300006914|Ga0075436_101377608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300006969|Ga0075419_10804180 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300007076|Ga0075435_101067903 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300009012|Ga0066710_102264664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 791 | Open in IMG/M |
| 3300009012|Ga0066710_102758404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 697 | Open in IMG/M |
| 3300009012|Ga0066710_103946206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300009053|Ga0105095_10031190 | All Organisms → cellular organisms → Bacteria | 2868 | Open in IMG/M |
| 3300009078|Ga0105106_10627063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 770 | Open in IMG/M |
| 3300009087|Ga0105107_10143287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1681 | Open in IMG/M |
| 3300009100|Ga0075418_10159130 | All Organisms → cellular organisms → Bacteria | 2404 | Open in IMG/M |
| 3300009137|Ga0066709_101061785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1189 | Open in IMG/M |
| 3300009137|Ga0066709_103775682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300009146|Ga0105091_10729490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300009147|Ga0114129_10820169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1185 | Open in IMG/M |
| 3300009147|Ga0114129_11475231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium 62_21 | 837 | Open in IMG/M |
| 3300009147|Ga0114129_11547087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 814 | Open in IMG/M |
| 3300009147|Ga0114129_11892366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 724 | Open in IMG/M |
| 3300009147|Ga0114129_12908318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300009157|Ga0105092_10523794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300009162|Ga0075423_11102134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 845 | Open in IMG/M |
| 3300009162|Ga0075423_13164459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300009176|Ga0105242_11945924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300009551|Ga0105238_10483702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1237 | Open in IMG/M |
| 3300009553|Ga0105249_11443191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 760 | Open in IMG/M |
| 3300009553|Ga0105249_12420951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300009610|Ga0105340_1551796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300009777|Ga0105164_10129139 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300009792|Ga0126374_11730926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300009818|Ga0105072_1007535 | Not Available | 1876 | Open in IMG/M |
| 3300009836|Ga0105068_1024029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1046 | Open in IMG/M |
| 3300010036|Ga0126305_11188031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300010043|Ga0126380_11334787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300010046|Ga0126384_10492261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1055 | Open in IMG/M |
| 3300010047|Ga0126382_10716428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 841 | Open in IMG/M |
| 3300010358|Ga0126370_11461354 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300010360|Ga0126372_12103111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300010366|Ga0126379_12167734 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300010366|Ga0126379_12347812 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300010376|Ga0126381_100561098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1619 | Open in IMG/M |
| 3300010376|Ga0126381_101068867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1165 | Open in IMG/M |
| 3300010376|Ga0126381_104473408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300010376|Ga0126381_104746471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300010397|Ga0134124_12605664 | Not Available | 548 | Open in IMG/M |
| 3300010398|Ga0126383_10029284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4346 | Open in IMG/M |
| 3300010398|Ga0126383_10364469 | Not Available | 1470 | Open in IMG/M |
| 3300010399|Ga0134127_11654818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 715 | Open in IMG/M |
| 3300010399|Ga0134127_12698751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300010401|Ga0134121_11626018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 666 | Open in IMG/M |
| 3300011430|Ga0137423_1068567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1052 | Open in IMG/M |
| 3300011434|Ga0137464_1071249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 996 | Open in IMG/M |
| 3300012160|Ga0137349_1069666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300012172|Ga0137320_1059930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 795 | Open in IMG/M |
| 3300012209|Ga0137379_10629342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 979 | Open in IMG/M |
| 3300012211|Ga0137377_11489824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300012353|Ga0137367_11096657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300012354|Ga0137366_10071826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2637 | Open in IMG/M |
| 3300012355|Ga0137369_10523635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 834 | Open in IMG/M |
| 3300012361|Ga0137360_11565382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300012488|Ga0157343_1037030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300012582|Ga0137358_10055376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2648 | Open in IMG/M |
| 3300012925|Ga0137419_11095576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300012929|Ga0137404_11699697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300012930|Ga0137407_12137764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300012948|Ga0126375_10488576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 915 | Open in IMG/M |
| 3300012961|Ga0164302_11556394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300012971|Ga0126369_10814597 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300013306|Ga0163162_10293323 | All Organisms → cellular organisms → Bacteria | 1758 | Open in IMG/M |
| 3300014866|Ga0180090_1058255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 671 | Open in IMG/M |
| 3300014873|Ga0180066_1078898 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300014873|Ga0180066_1080062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 668 | Open in IMG/M |
| 3300015264|Ga0137403_10003283 | All Organisms → cellular organisms → Bacteria | 19446 | Open in IMG/M |
| 3300015264|Ga0137403_10635140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 931 | Open in IMG/M |
| 3300015372|Ga0132256_102351195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300015374|Ga0132255_102096912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 861 | Open in IMG/M |
| 3300015374|Ga0132255_103584112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 660 | Open in IMG/M |
| 3300016422|Ga0182039_10600138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 962 | Open in IMG/M |
| 3300018076|Ga0184609_10177122 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300018078|Ga0184612_10017646 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 3649 | Open in IMG/M |
| 3300018078|Ga0184612_10231389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 957 | Open in IMG/M |
| 3300018081|Ga0184625_10041534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2285 | Open in IMG/M |
| 3300018082|Ga0184639_10082590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1689 | Open in IMG/M |
| 3300018084|Ga0184629_10094320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1455 | Open in IMG/M |
| 3300018084|Ga0184629_10193058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1050 | Open in IMG/M |
| 3300018433|Ga0066667_11400308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300020003|Ga0193739_1029157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1433 | Open in IMG/M |
| 3300020003|Ga0193739_1064269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 939 | Open in IMG/M |
| 3300020004|Ga0193755_1132449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 770 | Open in IMG/M |
| 3300020027|Ga0193752_1248049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300021078|Ga0210381_10074679 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300021445|Ga0182009_10315957 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300022756|Ga0222622_11116229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300025899|Ga0207642_10771052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300025903|Ga0207680_11142160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300025915|Ga0207693_10703546 | Not Available | 782 | Open in IMG/M |
| 3300025933|Ga0207706_11348502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300025933|Ga0207706_11542884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300026052|Ga0208289_1019300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300027716|Ga0209682_10161722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300027722|Ga0209819_10353272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300027731|Ga0209592_1284362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300027748|Ga0209689_1148863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1128 | Open in IMG/M |
| 3300027875|Ga0209283_10655723 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300027880|Ga0209481_10716899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300027886|Ga0209486_10049731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2095 | Open in IMG/M |
| 3300027979|Ga0209705_10329451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 772 | Open in IMG/M |
| 3300028380|Ga0268265_11477174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300028380|Ga0268265_11589183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300028381|Ga0268264_12137168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300030606|Ga0299906_10776236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 714 | Open in IMG/M |
| 3300030619|Ga0268386_10762604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300031226|Ga0307497_10586041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300031720|Ga0307469_10218648 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300031820|Ga0307473_10241641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1101 | Open in IMG/M |
| 3300031854|Ga0310904_11171022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300031858|Ga0310892_10446299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 852 | Open in IMG/M |
| 3300031908|Ga0310900_10494737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 949 | Open in IMG/M |
| 3300031943|Ga0310885_10448629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 695 | Open in IMG/M |
| 3300031965|Ga0326597_11441994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300031965|Ga0326597_11715168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300032004|Ga0307414_10860743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 829 | Open in IMG/M |
| 3300032013|Ga0310906_10505547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium 62_21 | 818 | Open in IMG/M |
| 3300032157|Ga0315912_10358043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1153 | Open in IMG/M |
| 3300032179|Ga0310889_10728952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300032770|Ga0335085_12498296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300033004|Ga0335084_10463967 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300033158|Ga0335077_10620565 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300033419|Ga0316601_100907483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 876 | Open in IMG/M |
| 3300033475|Ga0310811_10161331 | All Organisms → cellular organisms → Bacteria | 2803 | Open in IMG/M |
| 3300034090|Ga0326723_0315159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 703 | Open in IMG/M |
| 3300034150|Ga0364933_122988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300034150|Ga0364933_147749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300034151|Ga0364935_0075183 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300034151|Ga0364935_0111747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 846 | Open in IMG/M |
| 3300034354|Ga0364943_0098906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1016 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.36% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.29% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.91% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.07% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 3.07% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.45% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.84% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.23% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.23% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.23% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.61% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.61% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.61% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.61% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.61% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.61% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.61% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 | Host-Associated | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300012160 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2 | Environmental | Open in IMG/M |
| 3300012172 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2 | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014866 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10D | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020027 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026052 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_01596410 | 2199352025 | Soil | VQAQEWRQALGECVRDFFRTPEMEHFYSIKMTAERARIYLCSWAFMPPAT |
| JGI10216J12902_1209572771 | 3300000956 | Soil | MKAQEWRQALGECVRNFFRTPEMEHFYSVKMTRER |
| Ga0055469_100592341 | 3300003999 | Natural And Restored Wetlands | MRAQEWRQQLGECVRDLFLSPEMQSFYSIKLTTERARIYLLQLGLYVRQRRNYWPQ |
| Ga0055490_102411202 | 3300004052 | Natural And Restored Wetlands | VAQESGGKIMKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTMDRARIYLLQ |
| Ga0062594_1029567021 | 3300005093 | Soil | MKPQEWRQKLGECVRNLFLSPEMETFYSIEMTTARARIYLLQLSLYVRQRRN |
| Ga0065717_10140921 | 3300005276 | Arabidopsis Rhizosphere | MKTQEWRQSLGDCVRDFFRTPEMEHFYSVKLTRERARIYLLQLGLYARQR |
| Ga0065704_100109073 | 3300005289 | Switchgrass Rhizosphere | MKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTIERARIYLLQLGIYVRQRRNFWP |
| Ga0070689_1018248381 | 3300005340 | Switchgrass Rhizosphere | MKPQEWRQKLGDCVRDLFLSPEMQHFYSIPMTTDRARIYLLQLSLYVR |
| Ga0070669_1004898393 | 3300005353 | Switchgrass Rhizosphere | MKPQEWRQQLGDCVRDLFLSPEMQYFYSIPMTTDRAKIYLLQLS |
| Ga0070710_113231811 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPQEWRQKLGDCVRDLFLSPEMQHFYSIPITTERARIYLLQLSLY |
| Ga0070694_1006747403 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPQEWRQKLGDCVRDLFLSPEMEHFYSVPMTLERARIYLLQLGLYVR |
| Ga0066699_103153911 | 3300005561 | Soil | MKSQEWRQQLGDCVRDLFLSPEMEHFYSIKMTLERARIYLLQLGIYVRQRRN |
| Ga0066702_103305282 | 3300005575 | Soil | MNVQQWRQVLGECVRDFFRTPEMEHFYSIKMTPERARIYLL* |
| Ga0066691_107990512 | 3300005586 | Soil | MKPQEWRQKLGDCVRDLFLSPEMQHFYSIPMTTARARIYLLQLSLYVRQRRNFWPQVAAN |
| Ga0066905_1002554952 | 3300005713 | Tropical Forest Soil | MKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTTQRARIYLLQLGIYVRQRRNFW |
| Ga0066905_1010351492 | 3300005713 | Tropical Forest Soil | MKSQEWRQKLGDCVRDLFLSPEMQHFYSVEMTTQRARIYLLQLG |
| Ga0066905_1020753101 | 3300005713 | Tropical Forest Soil | MKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTTQRA |
| Ga0068866_102622011 | 3300005718 | Miscanthus Rhizosphere | MKPQEWRQKLGDCVRYLFLSPEMKHFYSTPMTTARARIYVLQLG |
| Ga0066903_1026152502 | 3300005764 | Tropical Forest Soil | MKAQEWRQALGECVRDFFRTPEMEHFYSIKMSRERARIY |
| Ga0081455_100544977 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKAQEWRQALGECVRDFFRTPEMEHFYSIKITRERARIY |
| Ga0081455_101573625 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKPQEWRQKLGDCVRNLFLSPEMQHFYSIEMTTERARIYLLQL |
| Ga0070715_104449632 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VQAQEWRQALGECVRDFFRTPEMEHFYSIKMTPERARIYLLQLGLYARQRRN |
| Ga0075428_1011770133 | 3300006844 | Populus Rhizosphere | ALGECVRDFFRTLEMEHFYSIKLTLERARIYLLQLGFYARHRRNN* |
| Ga0075431_1000210437 | 3300006847 | Populus Rhizosphere | MKPQEWRQKLGDCVRYLFLSPEMKHFYSTPMTTTRAQIYVLQLGLYVRQRRN |
| Ga0075420_1015959691 | 3300006853 | Populus Rhizosphere | MKPQEWRQKLGDCVRDLFQSPEMEHFYSIQMTVQRAQIYLLQLGLYVRQRRNFWPQ |
| Ga0075425_1003071121 | 3300006854 | Populus Rhizosphere | MKPQEWRQKLGDCVRYLFLSPEMKHFYSTPMTTARAQIYVLQLGLYV |
| Ga0075426_103900111 | 3300006903 | Populus Rhizosphere | MKPQEWRQQLGDCVRDLFLSPEMQYFYSIPMTTDRAKIYLLQLSLY |
| Ga0075426_113591911 | 3300006903 | Populus Rhizosphere | MKPQEWRQQLGERVRDLFRSPEMEQFYSVPLTLER |
| Ga0075426_114276601 | 3300006903 | Populus Rhizosphere | MKAQEWRQALGECVRDFFRTPEMEHFYSIKMTRDRARIYLLQ |
| Ga0075436_1013776081 | 3300006914 | Populus Rhizosphere | MKPEEWRQKLGDCVRDLFLSPEMEGFYALEMTKKRAQIYLSQLGIYVRQRRNYWPQVAAN |
| Ga0075419_108041801 | 3300006969 | Populus Rhizosphere | MKAQQWRRALGECVRDFFRTPEMEHFYSVKMTPQRARIYL |
| Ga0075435_1010679033 | 3300007076 | Populus Rhizosphere | MKAQEWRQALGECVRDFFRTPEMAHFYLVKLTRERARIYLLQLGLYARQRRNNWPQV |
| Ga0066710_1022646641 | 3300009012 | Grasslands Soil | MKAQEWRQGLGECVRDFFRTPEMEHFSSVKLTPERARV |
| Ga0066710_1027584041 | 3300009012 | Grasslands Soil | MKSQEWRQQLGDCVRDLFLSPEMEHFYSIKMTLERARIYLLQLGIY |
| Ga0066710_1039462062 | 3300009012 | Grasslands Soil | MKSQEWRQQLGDCVRDLFLSPEMEHFYSIKMTLERARI |
| Ga0105095_100311904 | 3300009053 | Freshwater Sediment | MKPQEWRQQLGECVRDLFRSPEMEQFYSIPMTLDRARIYLLQLGLYVR |
| Ga0105106_106270631 | 3300009078 | Freshwater Sediment | MNPQEWRQQLGECVRDLFRSPEMEQFYAVKLTEKRAQIYLLQLSLY |
| Ga0105107_101432871 | 3300009087 | Freshwater Sediment | MKPQEWRQQLGECVRDLFRSPEMEQFYSIPMTLDRARIYLLQLGLYVRQRRNFWPQV |
| Ga0075418_101591303 | 3300009100 | Populus Rhizosphere | MMKPQEWRQQLGERVRDLFRSPEMEQFYSVPLTLNRARIYLLQL |
| Ga0066709_1010617851 | 3300009137 | Grasslands Soil | MNVQQWRQVLGECVRDFFRTPEMEHFYSIKMTPERARIYLLQL |
| Ga0066709_1037756821 | 3300009137 | Grasslands Soil | MKSQEWRQQLGDCVRDLFLSPEMEHFYSIKMTLERARIY |
| Ga0105091_107294901 | 3300009146 | Freshwater Sediment | MKAQEWRQTLGEVVRDFFRTPEMEQFYSLKMTRERARI |
| Ga0114129_108201691 | 3300009147 | Populus Rhizosphere | MRSIVDGGTLMTPQEWRQKLGECVRDLFQSPEMEQFYSVKMTQSRAQIYLLQLSLY |
| Ga0114129_114752311 | 3300009147 | Populus Rhizosphere | MKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTTQRAR |
| Ga0114129_115470871 | 3300009147 | Populus Rhizosphere | MKPQEWRQKLGDSVRDLFLSPEMQHFYSIEMTTERAQIYLLQLGIYVRQRRNF |
| Ga0114129_118923661 | 3300009147 | Populus Rhizosphere | MKPQEWRQKLGDCVRDLFLSSEMEHFYSLEMTTKR |
| Ga0114129_129083182 | 3300009147 | Populus Rhizosphere | MKAQEWRQVLGECVRDFFRTLEMEHFYSIKLTLERARIYLLQLGFYARHRRNN* |
| Ga0105092_105237941 | 3300009157 | Freshwater Sediment | MKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTTERARIYLLQLGI |
| Ga0075423_111021341 | 3300009162 | Populus Rhizosphere | MNAQQWRQALGECVRDFFRTSDMEHFYSIKMTPERA |
| Ga0075423_131644591 | 3300009162 | Populus Rhizosphere | MKAQEWRQALGECVRDFFRTPEMEHFYSIKLTPERARI |
| Ga0105242_119459242 | 3300009176 | Miscanthus Rhizosphere | MKAQQWREALGECVRDFFRTPEMEYFYSIKMTTERARIYLSQLALYARQRRNNW |
| Ga0105238_104837024 | 3300009551 | Corn Rhizosphere | MKPQEWRQQLGDCVRDLFLSPEMQYFYSIPMTTDRAKIYLLQLSLYVRQRRN |
| Ga0105249_114431911 | 3300009553 | Switchgrass Rhizosphere | MKPQEWRQKLGDCVRHLFLSPEMKHFYSTPMTTARAQIYVLQLG |
| Ga0105249_124209512 | 3300009553 | Switchgrass Rhizosphere | VQAQEWRQALGECVRDFFHTPEMEHFYSIKMTPERARIYLL |
| Ga0105340_15517961 | 3300009610 | Soil | MKPQEWRQKLGDCVRDLFLSPEMEHFYSIKMTTERARIYL |
| Ga0105164_101291391 | 3300009777 | Wastewater | MQAKEWRQKLGDLVRELFLSPEMEAFYATKVTPERARLY |
| Ga0126374_117309261 | 3300009792 | Tropical Forest Soil | MKPQEWRQKLGDCVRDLFLSPEMEHFYSIPMTKERARI |
| Ga0105072_10075352 | 3300009818 | Groundwater Sand | MKAQQWRQALGECVRDFFRTPEMEHFYSIKLTPERARIYLLQLG |
| Ga0105068_10240292 | 3300009836 | Groundwater Sand | MKAQQWRQALGECVRDFFRTPEMEHFYAVKLTPERARIYLSQ |
| Ga0126305_111880311 | 3300010036 | Serpentine Soil | MNPQEWRQELGECVRDLFRSPEMEQFYNVKLTQKRAQIYLLQL |
| Ga0126380_113347872 | 3300010043 | Tropical Forest Soil | MKAQEWRQKLGECVRDFFRTPEMEHFYSIKMTRER |
| Ga0126384_104922612 | 3300010046 | Tropical Forest Soil | MKVPEWRQALGECVRDFFRTPEMEHFYSIKMSRERARIYLLQL* |
| Ga0126382_107164282 | 3300010047 | Tropical Forest Soil | MKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTTQRARIYLLQLGIYVRQRRNFWP |
| Ga0126370_114613541 | 3300010358 | Tropical Forest Soil | MKAQEWREVLGECVRDFFLTPEMEHFYSIKMTRERAQIY |
| Ga0126372_121031111 | 3300010360 | Tropical Forest Soil | MKAQEWRQALGECVRDFFRTPEMEHFYSIKMSRERARIYLLQL |
| Ga0126379_121677341 | 3300010366 | Tropical Forest Soil | MKAQEWREVLGECVRDFFLTPEMEHFYSIKMTREQAQIYLLQ |
| Ga0126379_123478121 | 3300010366 | Tropical Forest Soil | MKAQEWRQALGECVRDFFLTPEMEHFYSIKMTREQAQIYLLQL |
| Ga0126381_1005610981 | 3300010376 | Tropical Forest Soil | MKPQEWRQKLGDCVRDLFLSPEMEHFYSIPMTKERARIYL |
| Ga0126381_1010688673 | 3300010376 | Tropical Forest Soil | MKPQEWRQKLGDCVRDLFLSPEMQQFYSIEMTTQRARIYLLQLGIYVRQRRNFWPQV |
| Ga0126381_1044734081 | 3300010376 | Tropical Forest Soil | MKAQEWRQALGECVRDFFLTPEMEHFYSIKMTGERARIYLLQLGLYALQRR |
| Ga0126381_1047464711 | 3300010376 | Tropical Forest Soil | MKAQEWRQALGDCVRAFFLTPEMEHFYSIKMTGERARIYLLQLGLYALQRR |
| Ga0134124_126056642 | 3300010397 | Terrestrial Soil | MKPQEWRQKLGDCVRDLFMSPEMETFYSIEMTTARARIYLLQLSLYVRQRRNYWP |
| Ga0126383_100292848 | 3300010398 | Tropical Forest Soil | MKPQEWRQKLGDCVRGLFLSPEMEHFYSLEMTKKRAQIYLSQLG |
| Ga0126383_103644693 | 3300010398 | Tropical Forest Soil | MKAQEWRQALGECVRDFFRTPEMEHFYSIKMSRERARIYL |
| Ga0134127_116548182 | 3300010399 | Terrestrial Soil | MKAQQWRQALGEGVRNFFRTPEMEHFYSIKMTPERARIYLSQLGLYARQRRN |
| Ga0134127_126987512 | 3300010399 | Terrestrial Soil | MKPQEWRQKLGDCVRDLFQSPEMEHFYSIQMTVQRAQIYLLQLGLYVRQRRNFW |
| Ga0134121_116260182 | 3300010401 | Terrestrial Soil | MTPQEWRQKLGDCVRDLFRSPEMEQFYAVKLTEKRAQIYLLQLSLYVRKRRDFWPQVAAN |
| Ga0137423_10685671 | 3300011430 | Soil | MKPQEWRQQLGECVRDLFRSPEMEQFYSMPMTLDRARIYLLQLGLYVRQRRN |
| Ga0137464_10712491 | 3300011434 | Soil | MKPQEWRQQLGECVRDLFRSPEMVQFYNVKMTQKRVQIY |
| Ga0137349_10696662 | 3300012160 | Soil | MIMNPQEWRQQLGECVRDLFRSPEMEQFYSVKLSEKRAQIYLLQL |
| Ga0137320_10599302 | 3300012172 | Soil | MKPQEWRQALGDCVRDLFRSPEMEQFYSVQMTQRRAQIYLLQLSLYVRKRRDFWPQVAAN |
| Ga0137379_106293422 | 3300012209 | Vadose Zone Soil | MKQQEWRQKLGDCVRDLFLAPEMKHFYSIPMTTERARIYLLQLSL |
| Ga0137377_114898241 | 3300012211 | Vadose Zone Soil | MKSQEWRQQLGDCVRDLFLSPEMEHFYSIKMTLERARIYLLQLGIYVRQRRNFWPQVAA |
| Ga0137367_110966571 | 3300012353 | Vadose Zone Soil | MKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTTERARIYLLQLGIYVRQRRNFWPQVAA |
| Ga0137366_100718261 | 3300012354 | Vadose Zone Soil | MKPQEWRQKLGDCVRDLFLSPEMKHFYSIPMTTERARIYLLQLSLYVRQR |
| Ga0137369_105236352 | 3300012355 | Vadose Zone Soil | MKAQQWRHALGECVRDFFRTPEMEHFYSIKLIPERARIYLLQLGLYARQRRNNWP |
| Ga0137360_115653821 | 3300012361 | Vadose Zone Soil | MKPQEWRQKLGDCVRGLFLSPEMEGFYALEMTKKRAQIYLSQLGIYVRQRRNYWPQVAAN |
| Ga0157343_10370301 | 3300012488 | Arabidopsis Rhizosphere | MKTQEWRQSLGDCVRDFFRTPEMEHFYSVKLTRERARIYLL |
| Ga0137358_100553761 | 3300012582 | Vadose Zone Soil | MKPQEWRQKLGDCVRDLFLSPEMQHFYSIPMTTARARIYLLQLSLY |
| Ga0137419_110955761 | 3300012925 | Vadose Zone Soil | VQAQEWRQALGECVRDFFRTPEMEHFYSIKMTPERARIYLLQLGLYARQRRNN |
| Ga0137404_116996973 | 3300012929 | Vadose Zone Soil | VQAQQWRQALGECVRDFFRTPEMKHFYSIKMTAERARIYLLQLGLY |
| Ga0137407_121377641 | 3300012930 | Vadose Zone Soil | MKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTMERARIYLLQLGIYVRQRRNFWPQVAAN |
| Ga0126375_104885762 | 3300012948 | Tropical Forest Soil | MKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTTQRARIYLLQLGIYVRQR |
| Ga0164302_115563941 | 3300012961 | Soil | VQAQEWRQALGECVRDFFRTPEMEHFYSIKMTPERARIYLLQLGLY |
| Ga0126369_108145972 | 3300012971 | Tropical Forest Soil | MKPQEWRQKLGDCVRGLFLSPEMEHFYSLEMTKKRAQIYLSQLGIYVRQRRN |
| Ga0163162_102933231 | 3300013306 | Switchgrass Rhizosphere | MKPQEWRQKLGDCVRYLFLSPEMKHFYSTPMTTARAQIY |
| Ga0180090_10582551 | 3300014866 | Soil | MIMNPQEWRQQLGECVRDLFRSPEMEQFYSVKLSEKRAQIYLLQLSLYVRKRRDF |
| Ga0180066_10788982 | 3300014873 | Soil | MKAEQWREKLGGLVRGLFLSPEMKQFYSTKVTKERAQIYLSQLGI |
| Ga0180066_10800622 | 3300014873 | Soil | MKPQEWRQQLGDCVRALFLSPEMEHFYSIKMTTERARIYLLQLGIYVRQ |
| Ga0137403_1000328320 | 3300015264 | Vadose Zone Soil | MKPQEWRQKLGDCVRDLFLSPEMKHFYSIPMTTERARIYLLQLSLYVRQRR |
| Ga0137403_106351402 | 3300015264 | Vadose Zone Soil | MKPQEWRQKLGDCVRYLFLSPEMKHFYSTPMTTARAQIYVLQLG |
| Ga0132256_1023511951 | 3300015372 | Arabidopsis Rhizosphere | MKPQEWRQQLGERVRDLFRSPEMEQFYSIPLTLDRARIYLLQLGLYVRQRRNFWPQVA |
| Ga0132255_1020969122 | 3300015374 | Arabidopsis Rhizosphere | MKPQEWRQELGDCVRYLFLSPEMKHFYSTPMTTARAQIYVLQLGLYVRQ |
| Ga0132255_1035841121 | 3300015374 | Arabidopsis Rhizosphere | VQAQEWRQALGECVRNFFRTPEMEHFYSIKMTAERARIYLLQLGLYARQR |
| Ga0182039_106001382 | 3300016422 | Soil | MKPQEWRQKLGDRVRDLFLSPEMEHFYSIPMTKERARIYLLQLSLYVRQRRNFWPQVAA |
| Ga0184609_101771222 | 3300018076 | Groundwater Sediment | MKVQQWRQALGECVRDFFRTPEMEHFYSIKLTPARARIYLSQLGLYARQRRNNWP |
| Ga0184612_100176461 | 3300018078 | Groundwater Sediment | MKPQEWRQKLGDCVRDLFQSPEMEQFYSVKMTQKRAQIYLLQLSLYVRKR |
| Ga0184612_102313891 | 3300018078 | Groundwater Sediment | MKAQEWRQALGQCVRDFFRTPEMEHFYSIKLTPARARI |
| Ga0184625_100415343 | 3300018081 | Groundwater Sediment | MKAQEWRQALGECVRDFFRTPEMEHFYSVTLTRERARIYLLQLGLYARQRRN |
| Ga0184639_100825902 | 3300018082 | Groundwater Sediment | MKPQEWRQKLGDCVRDLFQSPEMEQFYSVPMTQRRAQIYLLQLSLYVRKRRDFWPQ |
| Ga0184629_100943201 | 3300018084 | Groundwater Sediment | MKPQEWRQALGDCVRDLFQSPEMEQFYSVQMTQRRAQIYLLQLSLYVRKRRDFWPQVA |
| Ga0184629_101930582 | 3300018084 | Groundwater Sediment | MNPQEWRQQLGECVRDLFRSPEMEQFYAVKLTEKRAQIYLLQLSLYVRKRRDFWPQVA |
| Ga0066667_114003082 | 3300018433 | Grasslands Soil | MNVQQWRQVLGECVRDFFRTPEMEHFYSIKMTPERARIYLLQLGLYARQRRN |
| Ga0193739_10291571 | 3300020003 | Soil | MKPQEWRQKLGDCVRDLFLSPEMTHFYSIPMTTERARIYLLQLSLYVRQRRNFWPQVAAN |
| Ga0193739_10642691 | 3300020003 | Soil | MKPQEWRQKLGDCVRDLFLSPEMEHFYSIKMTTERARIYLLQLSLYTRKRRDFWPQVARN |
| Ga0193755_11324492 | 3300020004 | Soil | VQAQEWRQALGECVRDFFRTPEMEHFYSIKMTAERARIYLLQLG |
| Ga0193752_12480491 | 3300020027 | Soil | MKAQQWRQALGECVRNFFRTPEMEHFYSIKMTPERARIYLSQLGLYARQRRNNWPQV |
| Ga0210381_100746791 | 3300021078 | Groundwater Sediment | MKPQEWRQKLGDCVRDLFLSPEMEHFYSIPMTLERARIYLLQLGLYVRQRRNFW |
| Ga0182009_103159572 | 3300021445 | Soil | MKAEQWRKELGDLVRDLFLSPEMNEFYSIKMTKERA |
| Ga0222622_111162292 | 3300022756 | Groundwater Sediment | MKPQEWRQKLGDCVRDLFLSPEMEHFYSIPMTLERARIYLLQLGLYVRQRRNFWPQV |
| Ga0207642_107710522 | 3300025899 | Miscanthus Rhizosphere | MKPQEWRQKLGDCVRYLFLSPEMKHFYSTPMTTARA |
| Ga0207680_111421602 | 3300025903 | Switchgrass Rhizosphere | MKPQEWRQQLGDCVRDLFLSPEMQYFYSIPMTTDRAKIYLLQLSLYVRQRRNFW |
| Ga0207693_107035463 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPQEWRQQLGDCVRDLFLSPEMQYFYSIPMTTDR |
| Ga0207706_113485021 | 3300025933 | Corn Rhizosphere | VQAQEWRQALGECVRDFFHTPEMEHFYSIKMTPQRARIYLLQ |
| Ga0207706_115428841 | 3300025933 | Corn Rhizosphere | MKPQEWRQKLGDCVRYLFLSPEMKHFYSTPMTTARARIYVLQLGLYVRQR |
| Ga0208289_10193001 | 3300026052 | Natural And Restored Wetlands | MKPHEWRQKLGDCVRDLFQSQEMEHFYSIPMTVERARIYLLQLSLYVRQRRNFWPQVAAN |
| Ga0209682_101617221 | 3300027716 | Wetland Sediment | MKPQEWRQQLGECVRDLFRSPEMEQFYNTKMTQKRAQIYLLQLSLYVRKRRD |
| Ga0209819_103532721 | 3300027722 | Freshwater Sediment | MKPQEWRQKLGDCVRNLFLSPEMQHFYSIEMTTERARIYLLQLK |
| Ga0209592_12843621 | 3300027731 | Freshwater Sediment | MKPQEWRQQLGECVRDLFRSPEMEQFYSIPMTLDRARIYLLQLGLYVRQR |
| Ga0209689_11488633 | 3300027748 | Soil | MKAQQWRQVLGECVRAFFRTSEMEHFYSIKMTPERARIYLL |
| Ga0209283_106557232 | 3300027875 | Vadose Zone Soil | MEAQEWRQELGNLVRGLFLSPEMEQFYSLKVTSERARLYLCQLCH |
| Ga0209481_107168992 | 3300027880 | Populus Rhizosphere | MKAQEWRQALGECVRDFFRTPEMAHFYLVKLTRERARIYLLQLGLYARQRRNNGR |
| Ga0209486_100497311 | 3300027886 | Agricultural Soil | MKPQEWRNKLGDCVRELFQSPEMHHFYSIPMTVQRAQIY |
| Ga0209705_103294511 | 3300027979 | Freshwater Sediment | MKPQEWRQQLGECVRDLFRSPEMEQFYSIPMTLDRARIYLLQLGLYVRQRRNFWPQVA |
| Ga0268265_114771741 | 3300028380 | Switchgrass Rhizosphere | MKPQEWRQKLGDCVRDLFLSPEMQHFYSIPMTTDRAR |
| Ga0268265_115891832 | 3300028380 | Switchgrass Rhizosphere | MKPQEWRQKLGDCVRDLFLSPEMEHFYSVPMTLERA |
| Ga0268264_121371682 | 3300028381 | Switchgrass Rhizosphere | MKPQEWRQKLGDCVRYLFLSPEMKHFYSTPMTTARAQIYVLQ |
| Ga0299906_107762361 | 3300030606 | Soil | MKPQEWRAKLGDCVRDLFQSPEMEHFYSLAMTQKRAQIYLLQ |
| Ga0268386_107626041 | 3300030619 | Soil | MKPQEWRQELGECVRDLFRSPEMEHFYSIKMTAERARIYLLQLSLYVRQRRNYWP |
| Ga0307497_105860412 | 3300031226 | Soil | VQAQEWRQALGECVRDFFRTPEMEHFYSIKMTPER |
| Ga0307469_102186482 | 3300031720 | Hardwood Forest Soil | MKAQEWRQALGGCVRDFFRTPEMEHFYSVKLTRERARIYLLQLGLYARQRR |
| Ga0307473_102416412 | 3300031820 | Hardwood Forest Soil | MKAQQWRQVLGECVRDFFRTAEMEHFYSIRMTPERARIYLLQLGLYARQRRNNWPQVAA |
| Ga0310904_111710221 | 3300031854 | Soil | MQPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTVERARIYLLQLGI |
| Ga0310892_104462992 | 3300031858 | Soil | MNAQQWRQALGECVRDFFRTSDMEHFYSIKMTPERARIYLLQLG |
| Ga0310900_104947373 | 3300031908 | Soil | MKPQEWRQQLGECVRDLFRSPEMEQFYSIPMTLNRA |
| Ga0310885_104486291 | 3300031943 | Soil | MKTQEWRQSLGDCVRDFFRTPEMEHFYSVKLTRER |
| Ga0326597_114419941 | 3300031965 | Soil | MKPQEWRQKLGDCVRDLFQSPEMEQFYAVKMTQKRAQVYLLQL |
| Ga0326597_117151681 | 3300031965 | Soil | MKPHEWRQALGDCVRDLFQSPEMEQFYSVPMTQGRAQIYLLQLSLYVRKRRDFWPQVAA |
| Ga0307414_108607431 | 3300032004 | Rhizosphere | MKPQEWRQQLGECVRDLFRSPEMEQFYNVKLTQKR |
| Ga0310906_105055471 | 3300032013 | Soil | MQPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTVERARIYLLQ |
| Ga0315912_103580431 | 3300032157 | Soil | MKPQEWRQQLGECVRDLFRSPEMEQFYNVKMTQKRAQIYLLQLSLYVRKRRDFWPQVA |
| Ga0310889_107289522 | 3300032179 | Soil | MKPQEWRQQLGECVRDLFRSPEMEQFYNLKLTQKRAQIYLLQLSLYVRKRRDFW |
| Ga0335085_124982961 | 3300032770 | Soil | MKPQEWRQKLGDCVRDLFLSPEMEHFYSIPMTLNRARIYLLQLGIYVRQRRNFWPQVAAN |
| Ga0335084_104639671 | 3300033004 | Soil | MKPQEWRQKLGDRVRDLFLSPEMEHFYSLKMTTERARIYLSQLGIYVRQRRNYW |
| Ga0335077_106205651 | 3300033158 | Soil | MKPQEWRQKLGDCVRDLFLSPEMERFYGITMTKKRAQIYLSQLGLYVRQRR |
| Ga0316601_1009074831 | 3300033419 | Soil | MKPQEWRQQLGECVRDLFRSPEMEQFYSIPMTLDRARIYLLQ |
| Ga0310811_101613311 | 3300033475 | Soil | MKPQEWRQQLGDCVRDLFLSPEMQYFYSIPMTTDRAKIYLLQLSLYVRQRRNFWPQVAAN |
| Ga0326723_0315159_542_703 | 3300034090 | Peat Soil | MKPQEWRQQLGECVRDLFRSPEMEQFYSISMTLDRARIYLLQLGLYVRQRRNFW |
| Ga0364933_122988_542_661 | 3300034150 | Sediment | MKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTTQRARIYL |
| Ga0364933_147749_2_106 | 3300034150 | Sediment | MKAQEWRQALGECVRDFFRTPEMEHFYSVKLTRER |
| Ga0364935_0075183_1_168 | 3300034151 | Sediment | MKPQEWRHELGDCVRDLFLSPEMQHFYSIEMTMERARIYLLQLGIYVRQRRNFWPQ |
| Ga0364935_0111747_1_135 | 3300034151 | Sediment | MKAQESRQSLGDCVRDFFRTPEMEHFYSVKLTRERARIYLLQLGL |
| Ga0364943_0098906_882_1016 | 3300034354 | Sediment | MKAQEWRQSLGDCVRDFFRTPEMEHFYSVKLTRERARIYLLQLGL |
| ⦗Top⦘ |