NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F039844

Metagenome Family F039844

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039844
Family Type Metagenome
Number of Sequences 163
Average Sequence Length 47 residues
Representative Sequence MKPQEWRQKLGDCVRDLFLSPEMEHFYSVPMTLERARIYLLQLGLYVR
Number of Associated Samples 132
Number of Associated Scaffolds 163

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.16 %
% of genes near scaffold ends (potentially truncated) 97.55 %
% of genes from short scaffolds (< 2000 bps) 92.02 %
Associated GOLD sequencing projects 126
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.319 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(11.656 % of family members)
Environment Ontology (ENVO) Unclassified
(29.448 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(36.810 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.74%    β-sheet: 0.00%    Coil/Unstructured: 55.26%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 163 Family Scaffolds
PF00072Response_reg 20.86
PF09084NMT1 4.91
PF03241HpaB 3.68
PF07452CHRD 1.84
PF13701DDE_Tnp_1_4 1.84
PF03070TENA_THI-4 1.84
PF13379NMT1_2 1.23
PF01075Glyco_transf_9 1.23
PF07995GSDH 1.23
PF00005ABC_tran 0.61
PF00857Isochorismatase 0.61
PF00128Alpha-amylase 0.61
PF04008Adenosine_kin 0.61
PF00313CSD 0.61
PF11794HpaB_N 0.61
PF02776TPP_enzyme_N 0.61
PF00296Bac_luciferase 0.61
PF13607Succ_CoA_lig 0.61
PF09994DUF2235 0.61
PF01548DEDD_Tnp_IS110 0.61
PF01471PG_binding_1 0.61
PF04264YceI 0.61
PF04972BON 0.61
PF13594Obsolete Pfam Family 0.61
PF01402RHH_1 0.61
PF00156Pribosyltran 0.61
PF05977MFS_3 0.61
PF00140Sigma70_r1_2 0.61
PF01321Creatinase_N 0.61
PF13561adh_short_C2 0.61
PF00582Usp 0.61
PF03320FBPase_glpX 0.61

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 163 Family Scaffolds
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 4.91
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 4.91
COG2368Aromatic ring hydroxylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 3.68
COG0859ADP-heptose:LPS heptosyltransferaseCell wall/membrane/envelope biogenesis [M] 1.23
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 1.23
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.61
COG3547TransposaseMobilome: prophages, transposons [X] 0.61
COG3280Maltooligosyltrehalose synthaseCarbohydrate transport and metabolism [G] 0.61
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.61
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.61
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.61
COG1839Adenosine/AMP kinaseNucleotide transport and metabolism [F] 0.61
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 0.61
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 0.61
COG1494Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase or related proteinCarbohydrate transport and metabolism [G] 0.61
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.61
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.61
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 0.61
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 0.61


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.32 %
UnclassifiedrootN/A3.68 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_103411All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1595Open in IMG/M
3300000956|JGI10216J12902_120957277All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300003999|Ga0055469_10059234All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1024Open in IMG/M
3300004052|Ga0055490_10241120All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300005093|Ga0062594_102956702All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300005276|Ga0065717_1014092All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium544Open in IMG/M
3300005289|Ga0065704_10010907All Organisms → cellular organisms → Bacteria3553Open in IMG/M
3300005340|Ga0070689_101824838All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium555Open in IMG/M
3300005353|Ga0070669_100489839All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1018Open in IMG/M
3300005437|Ga0070710_11323181All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300005444|Ga0070694_100674740All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium838Open in IMG/M
3300005561|Ga0066699_10315391All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1115Open in IMG/M
3300005575|Ga0066702_10330528All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium928Open in IMG/M
3300005586|Ga0066691_10799051All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300005713|Ga0066905_100255495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41349Open in IMG/M
3300005713|Ga0066905_101035149All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium726Open in IMG/M
3300005713|Ga0066905_102075310All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium528Open in IMG/M
3300005718|Ga0068866_10262201All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1062Open in IMG/M
3300005764|Ga0066903_102615250Not Available978Open in IMG/M
3300005937|Ga0081455_10054497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3408Open in IMG/M
3300005937|Ga0081455_10157362Not Available1745Open in IMG/M
3300006163|Ga0070715_10444963All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium730Open in IMG/M
3300006844|Ga0075428_101177013All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium808Open in IMG/M
3300006847|Ga0075431_100021043All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria6667Open in IMG/M
3300006853|Ga0075420_101595969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium559Open in IMG/M
3300006854|Ga0075425_100307112All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1826Open in IMG/M
3300006903|Ga0075426_10390011All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1027Open in IMG/M
3300006903|Ga0075426_11359191All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium539Open in IMG/M
3300006903|Ga0075426_11427660All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca526Open in IMG/M
3300006914|Ga0075436_101377608All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300006969|Ga0075419_10804180All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300007076|Ga0075435_101067903All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300009012|Ga0066710_102264664All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium791Open in IMG/M
3300009012|Ga0066710_102758404All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium697Open in IMG/M
3300009012|Ga0066710_103946206All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium555Open in IMG/M
3300009053|Ga0105095_10031190All Organisms → cellular organisms → Bacteria2868Open in IMG/M
3300009078|Ga0105106_10627063All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium770Open in IMG/M
3300009087|Ga0105107_10143287All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1681Open in IMG/M
3300009100|Ga0075418_10159130All Organisms → cellular organisms → Bacteria2404Open in IMG/M
3300009137|Ga0066709_101061785All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1189Open in IMG/M
3300009137|Ga0066709_103775682All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium550Open in IMG/M
3300009146|Ga0105091_10729490All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium522Open in IMG/M
3300009147|Ga0114129_10820169All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1185Open in IMG/M
3300009147|Ga0114129_11475231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium 62_21837Open in IMG/M
3300009147|Ga0114129_11547087All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium814Open in IMG/M
3300009147|Ga0114129_11892366All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium724Open in IMG/M
3300009147|Ga0114129_12908318All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium566Open in IMG/M
3300009157|Ga0105092_10523794All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium681Open in IMG/M
3300009162|Ga0075423_11102134All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium845Open in IMG/M
3300009162|Ga0075423_13164459All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300009176|Ga0105242_11945924All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium629Open in IMG/M
3300009551|Ga0105238_10483702All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1237Open in IMG/M
3300009553|Ga0105249_11443191All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium760Open in IMG/M
3300009553|Ga0105249_12420951All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium597Open in IMG/M
3300009610|Ga0105340_1551796All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium515Open in IMG/M
3300009777|Ga0105164_10129139All Organisms → cellular organisms → Bacteria1304Open in IMG/M
3300009792|Ga0126374_11730926All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300009818|Ga0105072_1007535Not Available1876Open in IMG/M
3300009836|Ga0105068_1024029All Organisms → cellular organisms → Bacteria → Proteobacteria1046Open in IMG/M
3300010036|Ga0126305_11188031All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium527Open in IMG/M
3300010043|Ga0126380_11334787All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium626Open in IMG/M
3300010046|Ga0126384_10492261All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1055Open in IMG/M
3300010047|Ga0126382_10716428All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium841Open in IMG/M
3300010358|Ga0126370_11461354All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300010360|Ga0126372_12103111All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium612Open in IMG/M
3300010366|Ga0126379_12167734All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300010366|Ga0126379_12347812All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300010376|Ga0126381_100561098All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1619Open in IMG/M
3300010376|Ga0126381_101068867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41165Open in IMG/M
3300010376|Ga0126381_104473408All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium540Open in IMG/M
3300010376|Ga0126381_104746471All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M
3300010397|Ga0134124_12605664Not Available548Open in IMG/M
3300010398|Ga0126383_10029284All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium4346Open in IMG/M
3300010398|Ga0126383_10364469Not Available1470Open in IMG/M
3300010399|Ga0134127_11654818All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium715Open in IMG/M
3300010399|Ga0134127_12698751All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium576Open in IMG/M
3300010401|Ga0134121_11626018All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium666Open in IMG/M
3300011430|Ga0137423_1068567All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1052Open in IMG/M
3300011434|Ga0137464_1071249All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium996Open in IMG/M
3300012160|Ga0137349_1069666All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium641Open in IMG/M
3300012172|Ga0137320_1059930All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium795Open in IMG/M
3300012209|Ga0137379_10629342All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium979Open in IMG/M
3300012211|Ga0137377_11489824All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium603Open in IMG/M
3300012353|Ga0137367_11096657All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium538Open in IMG/M
3300012354|Ga0137366_10071826All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2637Open in IMG/M
3300012355|Ga0137369_10523635All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium834Open in IMG/M
3300012361|Ga0137360_11565382All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium564Open in IMG/M
3300012488|Ga0157343_1037030All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300012582|Ga0137358_10055376All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2648Open in IMG/M
3300012925|Ga0137419_11095576All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium663Open in IMG/M
3300012929|Ga0137404_11699697All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium586Open in IMG/M
3300012930|Ga0137407_12137764All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium535Open in IMG/M
3300012948|Ga0126375_10488576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4915Open in IMG/M
3300012961|Ga0164302_11556394All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium547Open in IMG/M
3300012971|Ga0126369_10814597All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300013306|Ga0163162_10293323All Organisms → cellular organisms → Bacteria1758Open in IMG/M
3300014866|Ga0180090_1058255All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium671Open in IMG/M
3300014873|Ga0180066_1078898All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300014873|Ga0180066_1080062All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium668Open in IMG/M
3300015264|Ga0137403_10003283All Organisms → cellular organisms → Bacteria19446Open in IMG/M
3300015264|Ga0137403_10635140All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium931Open in IMG/M
3300015372|Ga0132256_102351195All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium636Open in IMG/M
3300015374|Ga0132255_102096912All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium861Open in IMG/M
3300015374|Ga0132255_103584112All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium660Open in IMG/M
3300016422|Ga0182039_10600138All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium962Open in IMG/M
3300018076|Ga0184609_10177122All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300018078|Ga0184612_10017646All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira3649Open in IMG/M
3300018078|Ga0184612_10231389All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium957Open in IMG/M
3300018081|Ga0184625_10041534All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2285Open in IMG/M
3300018082|Ga0184639_10082590All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1689Open in IMG/M
3300018084|Ga0184629_10094320All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1455Open in IMG/M
3300018084|Ga0184629_10193058All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1050Open in IMG/M
3300018433|Ga0066667_11400308All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium614Open in IMG/M
3300020003|Ga0193739_1029157All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1433Open in IMG/M
3300020003|Ga0193739_1064269All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium939Open in IMG/M
3300020004|Ga0193755_1132449All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium770Open in IMG/M
3300020027|Ga0193752_1248049All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium652Open in IMG/M
3300021078|Ga0210381_10074679All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300021445|Ga0182009_10315957All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300022756|Ga0222622_11116229All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium580Open in IMG/M
3300025899|Ga0207642_10771052All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M
3300025903|Ga0207680_11142160All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300025915|Ga0207693_10703546Not Available782Open in IMG/M
3300025933|Ga0207706_11348502All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium588Open in IMG/M
3300025933|Ga0207706_11542884All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium540Open in IMG/M
3300026052|Ga0208289_1019300All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300027716|Ga0209682_10161722All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium580Open in IMG/M
3300027722|Ga0209819_10353272All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300027731|Ga0209592_1284362All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium568Open in IMG/M
3300027748|Ga0209689_1148863All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1128Open in IMG/M
3300027875|Ga0209283_10655723All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300027880|Ga0209481_10716899All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium520Open in IMG/M
3300027886|Ga0209486_10049731All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2095Open in IMG/M
3300027979|Ga0209705_10329451All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium772Open in IMG/M
3300028380|Ga0268265_11477174All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium683Open in IMG/M
3300028380|Ga0268265_11589183All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium659Open in IMG/M
3300028381|Ga0268264_12137168All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium568Open in IMG/M
3300030606|Ga0299906_10776236All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium714Open in IMG/M
3300030619|Ga0268386_10762604All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium623Open in IMG/M
3300031226|Ga0307497_10586041All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300031720|Ga0307469_10218648All Organisms → cellular organisms → Bacteria1504Open in IMG/M
3300031820|Ga0307473_10241641All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1101Open in IMG/M
3300031854|Ga0310904_11171022All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium553Open in IMG/M
3300031858|Ga0310892_10446299All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium852Open in IMG/M
3300031908|Ga0310900_10494737All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium949Open in IMG/M
3300031943|Ga0310885_10448629All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium695Open in IMG/M
3300031965|Ga0326597_11441994All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium664Open in IMG/M
3300031965|Ga0326597_11715168All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium593Open in IMG/M
3300032004|Ga0307414_10860743All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium829Open in IMG/M
3300032013|Ga0310906_10505547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium 62_21818Open in IMG/M
3300032157|Ga0315912_10358043All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1153Open in IMG/M
3300032179|Ga0310889_10728952All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium519Open in IMG/M
3300032770|Ga0335085_12498296All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300033004|Ga0335084_10463967All Organisms → cellular organisms → Bacteria1302Open in IMG/M
3300033158|Ga0335077_10620565All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300033419|Ga0316601_100907483All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium876Open in IMG/M
3300033475|Ga0310811_10161331All Organisms → cellular organisms → Bacteria2803Open in IMG/M
3300034090|Ga0326723_0315159All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium703Open in IMG/M
3300034150|Ga0364933_122988All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium663Open in IMG/M
3300034150|Ga0364933_147749All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium607Open in IMG/M
3300034151|Ga0364935_0075183All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300034151|Ga0364935_0111747All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium846Open in IMG/M
3300034354|Ga0364943_0098906All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1016Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere11.66%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.82%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.36%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.29%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment4.91%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil4.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.07%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment3.07%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.45%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.45%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.45%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.84%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.23%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.23%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.23%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.23%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.23%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.23%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.23%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.23%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.61%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.61%
WastewaterEnvironmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater0.61%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.61%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.61%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.61%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.61%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.61%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.61%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.61%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.61%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003999Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2EnvironmentalOpen in IMG/M
3300004052Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005276Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5Host-AssociatedOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009777Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking waterEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300009836Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300011434Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2EnvironmentalOpen in IMG/M
3300012160Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2EnvironmentalOpen in IMG/M
3300012172Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2EnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012488Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610Host-AssociatedOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014866Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10DEnvironmentalOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020027Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026052Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027716Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027731Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_015964102199352025SoilVQAQEWRQALGECVRDFFRTPEMEHFYSIKMTAERARIYLCSWAFMPPAT
JGI10216J12902_12095727713300000956SoilMKAQEWRQALGECVRNFFRTPEMEHFYSVKMTRER
Ga0055469_1005923413300003999Natural And Restored WetlandsMRAQEWRQQLGECVRDLFLSPEMQSFYSIKLTTERARIYLLQLGLYVRQRRNYWPQ
Ga0055490_1024112023300004052Natural And Restored WetlandsVAQESGGKIMKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTMDRARIYLLQ
Ga0062594_10295670213300005093SoilMKPQEWRQKLGECVRNLFLSPEMETFYSIEMTTARARIYLLQLSLYVRQRRN
Ga0065717_101409213300005276Arabidopsis RhizosphereMKTQEWRQSLGDCVRDFFRTPEMEHFYSVKLTRERARIYLLQLGLYARQR
Ga0065704_1001090733300005289Switchgrass RhizosphereMKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTIERARIYLLQLGIYVRQRRNFWP
Ga0070689_10182483813300005340Switchgrass RhizosphereMKPQEWRQKLGDCVRDLFLSPEMQHFYSIPMTTDRARIYLLQLSLYVR
Ga0070669_10048983933300005353Switchgrass RhizosphereMKPQEWRQQLGDCVRDLFLSPEMQYFYSIPMTTDRAKIYLLQLS
Ga0070710_1132318113300005437Corn, Switchgrass And Miscanthus RhizosphereMKPQEWRQKLGDCVRDLFLSPEMQHFYSIPITTERARIYLLQLSLY
Ga0070694_10067474033300005444Corn, Switchgrass And Miscanthus RhizosphereMKPQEWRQKLGDCVRDLFLSPEMEHFYSVPMTLERARIYLLQLGLYVR
Ga0066699_1031539113300005561SoilMKSQEWRQQLGDCVRDLFLSPEMEHFYSIKMTLERARIYLLQLGIYVRQRRN
Ga0066702_1033052823300005575SoilMNVQQWRQVLGECVRDFFRTPEMEHFYSIKMTPERARIYLL*
Ga0066691_1079905123300005586SoilMKPQEWRQKLGDCVRDLFLSPEMQHFYSIPMTTARARIYLLQLSLYVRQRRNFWPQVAAN
Ga0066905_10025549523300005713Tropical Forest SoilMKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTTQRARIYLLQLGIYVRQRRNFW
Ga0066905_10103514923300005713Tropical Forest SoilMKSQEWRQKLGDCVRDLFLSPEMQHFYSVEMTTQRARIYLLQLG
Ga0066905_10207531013300005713Tropical Forest SoilMKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTTQRA
Ga0068866_1026220113300005718Miscanthus RhizosphereMKPQEWRQKLGDCVRYLFLSPEMKHFYSTPMTTARARIYVLQLG
Ga0066903_10261525023300005764Tropical Forest SoilMKAQEWRQALGECVRDFFRTPEMEHFYSIKMSRERARIY
Ga0081455_1005449773300005937Tabebuia Heterophylla RhizosphereMKAQEWRQALGECVRDFFRTPEMEHFYSIKITRERARIY
Ga0081455_1015736253300005937Tabebuia Heterophylla RhizosphereMKPQEWRQKLGDCVRNLFLSPEMQHFYSIEMTTERARIYLLQL
Ga0070715_1044496323300006163Corn, Switchgrass And Miscanthus RhizosphereVQAQEWRQALGECVRDFFRTPEMEHFYSIKMTPERARIYLLQLGLYARQRRN
Ga0075428_10117701333300006844Populus RhizosphereALGECVRDFFRTLEMEHFYSIKLTLERARIYLLQLGFYARHRRNN*
Ga0075431_10002104373300006847Populus RhizosphereMKPQEWRQKLGDCVRYLFLSPEMKHFYSTPMTTTRAQIYVLQLGLYVRQRRN
Ga0075420_10159596913300006853Populus RhizosphereMKPQEWRQKLGDCVRDLFQSPEMEHFYSIQMTVQRAQIYLLQLGLYVRQRRNFWPQ
Ga0075425_10030711213300006854Populus RhizosphereMKPQEWRQKLGDCVRYLFLSPEMKHFYSTPMTTARAQIYVLQLGLYV
Ga0075426_1039001113300006903Populus RhizosphereMKPQEWRQQLGDCVRDLFLSPEMQYFYSIPMTTDRAKIYLLQLSLY
Ga0075426_1135919113300006903Populus RhizosphereMKPQEWRQQLGERVRDLFRSPEMEQFYSVPLTLER
Ga0075426_1142766013300006903Populus RhizosphereMKAQEWRQALGECVRDFFRTPEMEHFYSIKMTRDRARIYLLQ
Ga0075436_10137760813300006914Populus RhizosphereMKPEEWRQKLGDCVRDLFLSPEMEGFYALEMTKKRAQIYLSQLGIYVRQRRNYWPQVAAN
Ga0075419_1080418013300006969Populus RhizosphereMKAQQWRRALGECVRDFFRTPEMEHFYSVKMTPQRARIYL
Ga0075435_10106790333300007076Populus RhizosphereMKAQEWRQALGECVRDFFRTPEMAHFYLVKLTRERARIYLLQLGLYARQRRNNWPQV
Ga0066710_10226466413300009012Grasslands SoilMKAQEWRQGLGECVRDFFRTPEMEHFSSVKLTPERARV
Ga0066710_10275840413300009012Grasslands SoilMKSQEWRQQLGDCVRDLFLSPEMEHFYSIKMTLERARIYLLQLGIY
Ga0066710_10394620623300009012Grasslands SoilMKSQEWRQQLGDCVRDLFLSPEMEHFYSIKMTLERARI
Ga0105095_1003119043300009053Freshwater SedimentMKPQEWRQQLGECVRDLFRSPEMEQFYSIPMTLDRARIYLLQLGLYVR
Ga0105106_1062706313300009078Freshwater SedimentMNPQEWRQQLGECVRDLFRSPEMEQFYAVKLTEKRAQIYLLQLSLY
Ga0105107_1014328713300009087Freshwater SedimentMKPQEWRQQLGECVRDLFRSPEMEQFYSIPMTLDRARIYLLQLGLYVRQRRNFWPQV
Ga0075418_1015913033300009100Populus RhizosphereMMKPQEWRQQLGERVRDLFRSPEMEQFYSVPLTLNRARIYLLQL
Ga0066709_10106178513300009137Grasslands SoilMNVQQWRQVLGECVRDFFRTPEMEHFYSIKMTPERARIYLLQL
Ga0066709_10377568213300009137Grasslands SoilMKSQEWRQQLGDCVRDLFLSPEMEHFYSIKMTLERARIY
Ga0105091_1072949013300009146Freshwater SedimentMKAQEWRQTLGEVVRDFFRTPEMEQFYSLKMTRERARI
Ga0114129_1082016913300009147Populus RhizosphereMRSIVDGGTLMTPQEWRQKLGECVRDLFQSPEMEQFYSVKMTQSRAQIYLLQLSLY
Ga0114129_1147523113300009147Populus RhizosphereMKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTTQRAR
Ga0114129_1154708713300009147Populus RhizosphereMKPQEWRQKLGDSVRDLFLSPEMQHFYSIEMTTERAQIYLLQLGIYVRQRRNF
Ga0114129_1189236613300009147Populus RhizosphereMKPQEWRQKLGDCVRDLFLSSEMEHFYSLEMTTKR
Ga0114129_1290831823300009147Populus RhizosphereMKAQEWRQVLGECVRDFFRTLEMEHFYSIKLTLERARIYLLQLGFYARHRRNN*
Ga0105092_1052379413300009157Freshwater SedimentMKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTTERARIYLLQLGI
Ga0075423_1110213413300009162Populus RhizosphereMNAQQWRQALGECVRDFFRTSDMEHFYSIKMTPERA
Ga0075423_1316445913300009162Populus RhizosphereMKAQEWRQALGECVRDFFRTPEMEHFYSIKLTPERARI
Ga0105242_1194592423300009176Miscanthus RhizosphereMKAQQWREALGECVRDFFRTPEMEYFYSIKMTTERARIYLSQLALYARQRRNNW
Ga0105238_1048370243300009551Corn RhizosphereMKPQEWRQQLGDCVRDLFLSPEMQYFYSIPMTTDRAKIYLLQLSLYVRQRRN
Ga0105249_1144319113300009553Switchgrass RhizosphereMKPQEWRQKLGDCVRHLFLSPEMKHFYSTPMTTARAQIYVLQLG
Ga0105249_1242095123300009553Switchgrass RhizosphereVQAQEWRQALGECVRDFFHTPEMEHFYSIKMTPERARIYLL
Ga0105340_155179613300009610SoilMKPQEWRQKLGDCVRDLFLSPEMEHFYSIKMTTERARIYL
Ga0105164_1012913913300009777WastewaterMQAKEWRQKLGDLVRELFLSPEMEAFYATKVTPERARLY
Ga0126374_1173092613300009792Tropical Forest SoilMKPQEWRQKLGDCVRDLFLSPEMEHFYSIPMTKERARI
Ga0105072_100753523300009818Groundwater SandMKAQQWRQALGECVRDFFRTPEMEHFYSIKLTPERARIYLLQLG
Ga0105068_102402923300009836Groundwater SandMKAQQWRQALGECVRDFFRTPEMEHFYAVKLTPERARIYLSQ
Ga0126305_1118803113300010036Serpentine SoilMNPQEWRQELGECVRDLFRSPEMEQFYNVKLTQKRAQIYLLQL
Ga0126380_1133478723300010043Tropical Forest SoilMKAQEWRQKLGECVRDFFRTPEMEHFYSIKMTRER
Ga0126384_1049226123300010046Tropical Forest SoilMKVPEWRQALGECVRDFFRTPEMEHFYSIKMSRERARIYLLQL*
Ga0126382_1071642823300010047Tropical Forest SoilMKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTTQRARIYLLQLGIYVRQRRNFWP
Ga0126370_1146135413300010358Tropical Forest SoilMKAQEWREVLGECVRDFFLTPEMEHFYSIKMTRERAQIY
Ga0126372_1210311113300010360Tropical Forest SoilMKAQEWRQALGECVRDFFRTPEMEHFYSIKMSRERARIYLLQL
Ga0126379_1216773413300010366Tropical Forest SoilMKAQEWREVLGECVRDFFLTPEMEHFYSIKMTREQAQIYLLQ
Ga0126379_1234781213300010366Tropical Forest SoilMKAQEWRQALGECVRDFFLTPEMEHFYSIKMTREQAQIYLLQL
Ga0126381_10056109813300010376Tropical Forest SoilMKPQEWRQKLGDCVRDLFLSPEMEHFYSIPMTKERARIYL
Ga0126381_10106886733300010376Tropical Forest SoilMKPQEWRQKLGDCVRDLFLSPEMQQFYSIEMTTQRARIYLLQLGIYVRQRRNFWPQV
Ga0126381_10447340813300010376Tropical Forest SoilMKAQEWRQALGECVRDFFLTPEMEHFYSIKMTGERARIYLLQLGLYALQRR
Ga0126381_10474647113300010376Tropical Forest SoilMKAQEWRQALGDCVRAFFLTPEMEHFYSIKMTGERARIYLLQLGLYALQRR
Ga0134124_1260566423300010397Terrestrial SoilMKPQEWRQKLGDCVRDLFMSPEMETFYSIEMTTARARIYLLQLSLYVRQRRNYWP
Ga0126383_1002928483300010398Tropical Forest SoilMKPQEWRQKLGDCVRGLFLSPEMEHFYSLEMTKKRAQIYLSQLG
Ga0126383_1036446933300010398Tropical Forest SoilMKAQEWRQALGECVRDFFRTPEMEHFYSIKMSRERARIYL
Ga0134127_1165481823300010399Terrestrial SoilMKAQQWRQALGEGVRNFFRTPEMEHFYSIKMTPERARIYLSQLGLYARQRRN
Ga0134127_1269875123300010399Terrestrial SoilMKPQEWRQKLGDCVRDLFQSPEMEHFYSIQMTVQRAQIYLLQLGLYVRQRRNFW
Ga0134121_1162601823300010401Terrestrial SoilMTPQEWRQKLGDCVRDLFRSPEMEQFYAVKLTEKRAQIYLLQLSLYVRKRRDFWPQVAAN
Ga0137423_106856713300011430SoilMKPQEWRQQLGECVRDLFRSPEMEQFYSMPMTLDRARIYLLQLGLYVRQRRN
Ga0137464_107124913300011434SoilMKPQEWRQQLGECVRDLFRSPEMVQFYNVKMTQKRVQIY
Ga0137349_106966623300012160SoilMIMNPQEWRQQLGECVRDLFRSPEMEQFYSVKLSEKRAQIYLLQL
Ga0137320_105993023300012172SoilMKPQEWRQALGDCVRDLFRSPEMEQFYSVQMTQRRAQIYLLQLSLYVRKRRDFWPQVAAN
Ga0137379_1062934223300012209Vadose Zone SoilMKQQEWRQKLGDCVRDLFLAPEMKHFYSIPMTTERARIYLLQLSL
Ga0137377_1148982413300012211Vadose Zone SoilMKSQEWRQQLGDCVRDLFLSPEMEHFYSIKMTLERARIYLLQLGIYVRQRRNFWPQVAA
Ga0137367_1109665713300012353Vadose Zone SoilMKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTTERARIYLLQLGIYVRQRRNFWPQVAA
Ga0137366_1007182613300012354Vadose Zone SoilMKPQEWRQKLGDCVRDLFLSPEMKHFYSIPMTTERARIYLLQLSLYVRQR
Ga0137369_1052363523300012355Vadose Zone SoilMKAQQWRHALGECVRDFFRTPEMEHFYSIKLIPERARIYLLQLGLYARQRRNNWP
Ga0137360_1156538213300012361Vadose Zone SoilMKPQEWRQKLGDCVRGLFLSPEMEGFYALEMTKKRAQIYLSQLGIYVRQRRNYWPQVAAN
Ga0157343_103703013300012488Arabidopsis RhizosphereMKTQEWRQSLGDCVRDFFRTPEMEHFYSVKLTRERARIYLL
Ga0137358_1005537613300012582Vadose Zone SoilMKPQEWRQKLGDCVRDLFLSPEMQHFYSIPMTTARARIYLLQLSLY
Ga0137419_1109557613300012925Vadose Zone SoilVQAQEWRQALGECVRDFFRTPEMEHFYSIKMTPERARIYLLQLGLYARQRRNN
Ga0137404_1169969733300012929Vadose Zone SoilVQAQQWRQALGECVRDFFRTPEMKHFYSIKMTAERARIYLLQLGLY
Ga0137407_1213776413300012930Vadose Zone SoilMKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTMERARIYLLQLGIYVRQRRNFWPQVAAN
Ga0126375_1048857623300012948Tropical Forest SoilMKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTTQRARIYLLQLGIYVRQR
Ga0164302_1155639413300012961SoilVQAQEWRQALGECVRDFFRTPEMEHFYSIKMTPERARIYLLQLGLY
Ga0126369_1081459723300012971Tropical Forest SoilMKPQEWRQKLGDCVRGLFLSPEMEHFYSLEMTKKRAQIYLSQLGIYVRQRRN
Ga0163162_1029332313300013306Switchgrass RhizosphereMKPQEWRQKLGDCVRYLFLSPEMKHFYSTPMTTARAQIY
Ga0180090_105825513300014866SoilMIMNPQEWRQQLGECVRDLFRSPEMEQFYSVKLSEKRAQIYLLQLSLYVRKRRDF
Ga0180066_107889823300014873SoilMKAEQWREKLGGLVRGLFLSPEMKQFYSTKVTKERAQIYLSQLGI
Ga0180066_108006223300014873SoilMKPQEWRQQLGDCVRALFLSPEMEHFYSIKMTTERARIYLLQLGIYVRQ
Ga0137403_10003283203300015264Vadose Zone SoilMKPQEWRQKLGDCVRDLFLSPEMKHFYSIPMTTERARIYLLQLSLYVRQRR
Ga0137403_1063514023300015264Vadose Zone SoilMKPQEWRQKLGDCVRYLFLSPEMKHFYSTPMTTARAQIYVLQLG
Ga0132256_10235119513300015372Arabidopsis RhizosphereMKPQEWRQQLGERVRDLFRSPEMEQFYSIPLTLDRARIYLLQLGLYVRQRRNFWPQVA
Ga0132255_10209691223300015374Arabidopsis RhizosphereMKPQEWRQELGDCVRYLFLSPEMKHFYSTPMTTARAQIYVLQLGLYVRQ
Ga0132255_10358411213300015374Arabidopsis RhizosphereVQAQEWRQALGECVRNFFRTPEMEHFYSIKMTAERARIYLLQLGLYARQR
Ga0182039_1060013823300016422SoilMKPQEWRQKLGDRVRDLFLSPEMEHFYSIPMTKERARIYLLQLSLYVRQRRNFWPQVAA
Ga0184609_1017712223300018076Groundwater SedimentMKVQQWRQALGECVRDFFRTPEMEHFYSIKLTPARARIYLSQLGLYARQRRNNWP
Ga0184612_1001764613300018078Groundwater SedimentMKPQEWRQKLGDCVRDLFQSPEMEQFYSVKMTQKRAQIYLLQLSLYVRKR
Ga0184612_1023138913300018078Groundwater SedimentMKAQEWRQALGQCVRDFFRTPEMEHFYSIKLTPARARI
Ga0184625_1004153433300018081Groundwater SedimentMKAQEWRQALGECVRDFFRTPEMEHFYSVTLTRERARIYLLQLGLYARQRRN
Ga0184639_1008259023300018082Groundwater SedimentMKPQEWRQKLGDCVRDLFQSPEMEQFYSVPMTQRRAQIYLLQLSLYVRKRRDFWPQ
Ga0184629_1009432013300018084Groundwater SedimentMKPQEWRQALGDCVRDLFQSPEMEQFYSVQMTQRRAQIYLLQLSLYVRKRRDFWPQVA
Ga0184629_1019305823300018084Groundwater SedimentMNPQEWRQQLGECVRDLFRSPEMEQFYAVKLTEKRAQIYLLQLSLYVRKRRDFWPQVA
Ga0066667_1140030823300018433Grasslands SoilMNVQQWRQVLGECVRDFFRTPEMEHFYSIKMTPERARIYLLQLGLYARQRRN
Ga0193739_102915713300020003SoilMKPQEWRQKLGDCVRDLFLSPEMTHFYSIPMTTERARIYLLQLSLYVRQRRNFWPQVAAN
Ga0193739_106426913300020003SoilMKPQEWRQKLGDCVRDLFLSPEMEHFYSIKMTTERARIYLLQLSLYTRKRRDFWPQVARN
Ga0193755_113244923300020004SoilVQAQEWRQALGECVRDFFRTPEMEHFYSIKMTAERARIYLLQLG
Ga0193752_124804913300020027SoilMKAQQWRQALGECVRNFFRTPEMEHFYSIKMTPERARIYLSQLGLYARQRRNNWPQV
Ga0210381_1007467913300021078Groundwater SedimentMKPQEWRQKLGDCVRDLFLSPEMEHFYSIPMTLERARIYLLQLGLYVRQRRNFW
Ga0182009_1031595723300021445SoilMKAEQWRKELGDLVRDLFLSPEMNEFYSIKMTKERA
Ga0222622_1111622923300022756Groundwater SedimentMKPQEWRQKLGDCVRDLFLSPEMEHFYSIPMTLERARIYLLQLGLYVRQRRNFWPQV
Ga0207642_1077105223300025899Miscanthus RhizosphereMKPQEWRQKLGDCVRYLFLSPEMKHFYSTPMTTARA
Ga0207680_1114216023300025903Switchgrass RhizosphereMKPQEWRQQLGDCVRDLFLSPEMQYFYSIPMTTDRAKIYLLQLSLYVRQRRNFW
Ga0207693_1070354633300025915Corn, Switchgrass And Miscanthus RhizosphereMKPQEWRQQLGDCVRDLFLSPEMQYFYSIPMTTDR
Ga0207706_1134850213300025933Corn RhizosphereVQAQEWRQALGECVRDFFHTPEMEHFYSIKMTPQRARIYLLQ
Ga0207706_1154288413300025933Corn RhizosphereMKPQEWRQKLGDCVRYLFLSPEMKHFYSTPMTTARARIYVLQLGLYVRQR
Ga0208289_101930013300026052Natural And Restored WetlandsMKPHEWRQKLGDCVRDLFQSQEMEHFYSIPMTVERARIYLLQLSLYVRQRRNFWPQVAAN
Ga0209682_1016172213300027716Wetland SedimentMKPQEWRQQLGECVRDLFRSPEMEQFYNTKMTQKRAQIYLLQLSLYVRKRRD
Ga0209819_1035327213300027722Freshwater SedimentMKPQEWRQKLGDCVRNLFLSPEMQHFYSIEMTTERARIYLLQLK
Ga0209592_128436213300027731Freshwater SedimentMKPQEWRQQLGECVRDLFRSPEMEQFYSIPMTLDRARIYLLQLGLYVRQR
Ga0209689_114886333300027748SoilMKAQQWRQVLGECVRAFFRTSEMEHFYSIKMTPERARIYLL
Ga0209283_1065572323300027875Vadose Zone SoilMEAQEWRQELGNLVRGLFLSPEMEQFYSLKVTSERARLYLCQLCH
Ga0209481_1071689923300027880Populus RhizosphereMKAQEWRQALGECVRDFFRTPEMAHFYLVKLTRERARIYLLQLGLYARQRRNNGR
Ga0209486_1004973113300027886Agricultural SoilMKPQEWRNKLGDCVRELFQSPEMHHFYSIPMTVQRAQIY
Ga0209705_1032945113300027979Freshwater SedimentMKPQEWRQQLGECVRDLFRSPEMEQFYSIPMTLDRARIYLLQLGLYVRQRRNFWPQVA
Ga0268265_1147717413300028380Switchgrass RhizosphereMKPQEWRQKLGDCVRDLFLSPEMQHFYSIPMTTDRAR
Ga0268265_1158918323300028380Switchgrass RhizosphereMKPQEWRQKLGDCVRDLFLSPEMEHFYSVPMTLERA
Ga0268264_1213716823300028381Switchgrass RhizosphereMKPQEWRQKLGDCVRYLFLSPEMKHFYSTPMTTARAQIYVLQ
Ga0299906_1077623613300030606SoilMKPQEWRAKLGDCVRDLFQSPEMEHFYSLAMTQKRAQIYLLQ
Ga0268386_1076260413300030619SoilMKPQEWRQELGECVRDLFRSPEMEHFYSIKMTAERARIYLLQLSLYVRQRRNYWP
Ga0307497_1058604123300031226SoilVQAQEWRQALGECVRDFFRTPEMEHFYSIKMTPER
Ga0307469_1021864823300031720Hardwood Forest SoilMKAQEWRQALGGCVRDFFRTPEMEHFYSVKLTRERARIYLLQLGLYARQRR
Ga0307473_1024164123300031820Hardwood Forest SoilMKAQQWRQVLGECVRDFFRTAEMEHFYSIRMTPERARIYLLQLGLYARQRRNNWPQVAA
Ga0310904_1117102213300031854SoilMQPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTVERARIYLLQLGI
Ga0310892_1044629923300031858SoilMNAQQWRQALGECVRDFFRTSDMEHFYSIKMTPERARIYLLQLG
Ga0310900_1049473733300031908SoilMKPQEWRQQLGECVRDLFRSPEMEQFYSIPMTLNRA
Ga0310885_1044862913300031943SoilMKTQEWRQSLGDCVRDFFRTPEMEHFYSVKLTRER
Ga0326597_1144199413300031965SoilMKPQEWRQKLGDCVRDLFQSPEMEQFYAVKMTQKRAQVYLLQL
Ga0326597_1171516813300031965SoilMKPHEWRQALGDCVRDLFQSPEMEQFYSVPMTQGRAQIYLLQLSLYVRKRRDFWPQVAA
Ga0307414_1086074313300032004RhizosphereMKPQEWRQQLGECVRDLFRSPEMEQFYNVKLTQKR
Ga0310906_1050554713300032013SoilMQPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTVERARIYLLQ
Ga0315912_1035804313300032157SoilMKPQEWRQQLGECVRDLFRSPEMEQFYNVKMTQKRAQIYLLQLSLYVRKRRDFWPQVA
Ga0310889_1072895223300032179SoilMKPQEWRQQLGECVRDLFRSPEMEQFYNLKLTQKRAQIYLLQLSLYVRKRRDFW
Ga0335085_1249829613300032770SoilMKPQEWRQKLGDCVRDLFLSPEMEHFYSIPMTLNRARIYLLQLGIYVRQRRNFWPQVAAN
Ga0335084_1046396713300033004SoilMKPQEWRQKLGDRVRDLFLSPEMEHFYSLKMTTERARIYLSQLGIYVRQRRNYW
Ga0335077_1062056513300033158SoilMKPQEWRQKLGDCVRDLFLSPEMERFYGITMTKKRAQIYLSQLGLYVRQRR
Ga0316601_10090748313300033419SoilMKPQEWRQQLGECVRDLFRSPEMEQFYSIPMTLDRARIYLLQ
Ga0310811_1016133113300033475SoilMKPQEWRQQLGDCVRDLFLSPEMQYFYSIPMTTDRAKIYLLQLSLYVRQRRNFWPQVAAN
Ga0326723_0315159_542_7033300034090Peat SoilMKPQEWRQQLGECVRDLFRSPEMEQFYSISMTLDRARIYLLQLGLYVRQRRNFW
Ga0364933_122988_542_6613300034150SedimentMKPQEWRQKLGDCVRDLFLSPEMQHFYSIEMTTQRARIYL
Ga0364933_147749_2_1063300034150SedimentMKAQEWRQALGECVRDFFRTPEMEHFYSVKLTRER
Ga0364935_0075183_1_1683300034151SedimentMKPQEWRHELGDCVRDLFLSPEMQHFYSIEMTMERARIYLLQLGIYVRQRRNFWPQ
Ga0364935_0111747_1_1353300034151SedimentMKAQESRQSLGDCVRDFFRTPEMEHFYSVKLTRERARIYLLQLGL
Ga0364943_0098906_882_10163300034354SedimentMKAQEWRQSLGDCVRDFFRTPEMEHFYSVKLTRERARIYLLQLGL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.