NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F039752

Metagenome / Metatranscriptome Family F039752

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039752
Family Type Metagenome / Metatranscriptome
Number of Sequences 163
Average Sequence Length 88 residues
Representative Sequence RVALAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRKF
Number of Associated Samples 139
Number of Associated Scaffolds 163

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.24 %
% of genes near scaffold ends (potentially truncated) 87.73 %
% of genes from short scaffolds (< 2000 bps) 86.50 %
Associated GOLD sequencing projects 130
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.773 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(10.429 % of family members)
Environment Ontology (ENVO) Unclassified
(28.834 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.037 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.44%    β-sheet: 1.75%    Coil/Unstructured: 72.81%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 163 Family Scaffolds
PF01565FAD_binding_4 1.84
PF12867DinB_2 1.84
PF11175DUF2961 1.84
PF03551PadR 1.23
PF09900DUF2127 1.23
PF03150CCP_MauG 1.23
PF00005ABC_tran 1.23
PF00326Peptidase_S9 1.23
PF14023DUF4239 0.61
PF07592DDE_Tnp_ISAZ013 0.61
PF01261AP_endonuc_2 0.61
PF13460NAD_binding_10 0.61
PF01161PBP 0.61
PF00248Aldo_ket_red 0.61
PF01120Alpha_L_fucos 0.61
PF00144Beta-lactamase 0.61
PF07843DUF1634 0.61
PF10041DUF2277 0.61
PF00480ROK 0.61
PF01750HycI 0.61
PF06739SBBP 0.61
PF12704MacB_PCD 0.61
PF05569Peptidase_M56 0.61
PF13442Cytochrome_CBB3 0.61
PF07963N_methyl 0.61
PF00733Asn_synthase 0.61
PF12973Cupin_7 0.61
PF13924Lipocalin_5 0.61
PF07859Abhydrolase_3 0.61
PF00072Response_reg 0.61
PF02211NHase_beta 0.61
PF04041Glyco_hydro_130 0.61
PF01557FAA_hydrolase 0.61
PF00730HhH-GPD 0.61
PF13561adh_short_C2 0.61
PF02734Dak2 0.61
PF13519VWA_2 0.61
PF03449GreA_GreB_N 0.61
PF01979Amidohydro_1 0.61
PF00128Alpha-amylase 0.61
PF03702AnmK 0.61
PF13435Cytochrome_C554 0.61
PF07681DoxX 0.61
PF00892EamA 0.61
PF03746LamB_YcsF 0.61
PF13620CarboxypepD_reg 0.61
PF00135COesterase 0.61
PF14067LssY_C 0.61
PF13518HTH_28 0.61

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 163 Family Scaffolds
COG1858Cytochrome c peroxidasePosttranslational modification, protein turnover, chaperones [O] 1.23
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 1.23
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 1.23
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 1.23
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.23
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.61
COG1881Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) familyGeneral function prediction only [R] 0.61
COG2152Predicted glycosyl hydrolase, GH43/DUF377 familyCarbohydrate transport and metabolism [G] 0.61
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 0.61
COG4272Uncharacterized membrane proteinFunction unknown [S] 0.61
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.61
COG2367Beta-lactamase class ADefense mechanisms [V] 0.61
COG23771,6-Anhydro-N-acetylmuramate kinaseCell wall/membrane/envelope biogenesis [M] 0.61
COG3280Maltooligosyltrehalose synthaseCarbohydrate transport and metabolism [G] 0.61
COG3669Alpha-L-fucosidaseCarbohydrate transport and metabolism [G] 0.61
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.61
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.61
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.61
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.61
COG15405-oxoprolinase subunit AAmino acid transport and metabolism [E] 0.61
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 0.61
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 0.61
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.61
COG0782Transcription elongation factor, GreA/GreB familyTranscription [K] 0.61
COG0680Ni,Fe-hydrogenase maturation factorEnergy production and conversion [C] 0.61
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.61
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 0.61
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 0.61
COG0177Endonuclease IIIReplication, recombination and repair [L] 0.61


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.77 %
UnclassifiedrootN/A1.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_100008257All Organisms → cellular organisms → Bacteria8286Open in IMG/M
3300004081|Ga0063454_100880250All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300005337|Ga0070682_101088249All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300005364|Ga0070673_102249729All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300005367|Ga0070667_100962465All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300005435|Ga0070714_100059946All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3264Open in IMG/M
3300005529|Ga0070741_10710036All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300005534|Ga0070735_10779864All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300005553|Ga0066695_10255083All Organisms → cellular organisms → Bacteria1107Open in IMG/M
3300005587|Ga0066654_10869119All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300005591|Ga0070761_10429906All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300005602|Ga0070762_10093127All Organisms → cellular organisms → Bacteria1732Open in IMG/M
3300005712|Ga0070764_10739170All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans608Open in IMG/M
3300005712|Ga0070764_10996557All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300005921|Ga0070766_10259672All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1104Open in IMG/M
3300006041|Ga0075023_100525402All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300006174|Ga0075014_100812582All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300006175|Ga0070712_100452720All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300006237|Ga0097621_100460978All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300006800|Ga0066660_10879423All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans730Open in IMG/M
3300009029|Ga0066793_10799338All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6536Open in IMG/M
3300009093|Ga0105240_11106401All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300009137|Ga0066709_103425301All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans576Open in IMG/M
3300009137|Ga0066709_103901106All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300009500|Ga0116229_10399757All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans1147Open in IMG/M
3300009623|Ga0116133_1080578All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis818Open in IMG/M
3300009635|Ga0116117_1168365All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6569Open in IMG/M
3300009643|Ga0116110_1037068All Organisms → cellular organisms → Bacteria1800Open in IMG/M
3300009672|Ga0116215_1312382All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6682Open in IMG/M
3300009709|Ga0116227_11202141All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans570Open in IMG/M
3300009759|Ga0116101_1076398All Organisms → cellular organisms → Bacteria → Acidobacteria753Open in IMG/M
3300009764|Ga0116134_1131537All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6890Open in IMG/M
3300010359|Ga0126376_12711606All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6545Open in IMG/M
3300010361|Ga0126378_12317442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans613Open in IMG/M
3300010371|Ga0134125_11833052All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans660Open in IMG/M
3300010375|Ga0105239_11663808All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans738Open in IMG/M
3300010376|Ga0126381_101268648All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Dongia → Dongia mobilis1065Open in IMG/M
3300010376|Ga0126381_102264413All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis781Open in IMG/M
3300010379|Ga0136449_101222871All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1180Open in IMG/M
3300010379|Ga0136449_102282491All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6785Open in IMG/M
3300011120|Ga0150983_12850576All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans503Open in IMG/M
3300011269|Ga0137392_11602426All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis509Open in IMG/M
3300012096|Ga0137389_10723283All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis855Open in IMG/M
3300012212|Ga0150985_109222349All Organisms → cellular organisms → Bacteria1930Open in IMG/M
3300012469|Ga0150984_112836154All Organisms → cellular organisms → Bacteria1749Open in IMG/M
3300012891|Ga0157305_10181423All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans590Open in IMG/M
3300012923|Ga0137359_10933493All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans747Open in IMG/M
3300012971|Ga0126369_12195246All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6639Open in IMG/M
3300013297|Ga0157378_10149558All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2175Open in IMG/M
3300014151|Ga0181539_1090728All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61308Open in IMG/M
3300014152|Ga0181533_1027520All Organisms → cellular organisms → Bacteria3398Open in IMG/M
3300014160|Ga0181517_10497390All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis617Open in IMG/M
3300014162|Ga0181538_10124360All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1500Open in IMG/M
3300014162|Ga0181538_10183576All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1183Open in IMG/M
3300014164|Ga0181532_10116477All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61643Open in IMG/M
3300014165|Ga0181523_10424966All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis738Open in IMG/M
3300014168|Ga0181534_10337353All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6821Open in IMG/M
3300014199|Ga0181535_10156534All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1424Open in IMG/M
3300014199|Ga0181535_10586655All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia640Open in IMG/M
3300014200|Ga0181526_10561206All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6722Open in IMG/M
3300014326|Ga0157380_12188302All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300014487|Ga0182000_10296951All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis671Open in IMG/M
3300014491|Ga0182014_10032172All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4004Open in IMG/M
3300014491|Ga0182014_10049345All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA62921Open in IMG/M
3300014492|Ga0182013_10230826All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1087Open in IMG/M
3300014492|Ga0182013_10431431All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6700Open in IMG/M
3300014501|Ga0182024_10745430All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1202Open in IMG/M
3300014654|Ga0181525_10567004All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans631Open in IMG/M
3300014838|Ga0182030_10671108All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans980Open in IMG/M
3300014839|Ga0182027_10633800All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1143Open in IMG/M
3300015242|Ga0137412_10727574All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis736Open in IMG/M
3300016319|Ga0182033_10431051All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1121Open in IMG/M
3300016319|Ga0182033_11612423All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis587Open in IMG/M
3300016750|Ga0181505_10177753All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA62321Open in IMG/M
3300017935|Ga0187848_10322644All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis642Open in IMG/M
3300017938|Ga0187854_10040370All Organisms → cellular organisms → Bacteria → Acidobacteria2392Open in IMG/M
3300017943|Ga0187819_10698994All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis572Open in IMG/M
3300017946|Ga0187879_10104944All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61618Open in IMG/M
3300017946|Ga0187879_10264065All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis958Open in IMG/M
3300017946|Ga0187879_10370064All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6794Open in IMG/M
3300017946|Ga0187879_10752382All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6543Open in IMG/M
3300017948|Ga0187847_10334362All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans829Open in IMG/M
3300017988|Ga0181520_10268238All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61295Open in IMG/M
3300017988|Ga0181520_11074354All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis530Open in IMG/M
3300017993|Ga0187823_10236229All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis613Open in IMG/M
3300017995|Ga0187816_10117237All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin60761146Open in IMG/M
3300018007|Ga0187805_10487961All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis577Open in IMG/M
3300018008|Ga0187888_1326923All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis586Open in IMG/M
3300018023|Ga0187889_10268074All Organisms → cellular organisms → Bacteria → Acidobacteria763Open in IMG/M
3300018037|Ga0187883_10021718All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis3540Open in IMG/M
3300018038|Ga0187855_10136637All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1467Open in IMG/M
3300018038|Ga0187855_10800011All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans550Open in IMG/M
3300018040|Ga0187862_10081180All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2283Open in IMG/M
3300018042|Ga0187871_10118715All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1512Open in IMG/M
3300018042|Ga0187871_10281652All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis921Open in IMG/M
3300018086|Ga0187769_11141816All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6590Open in IMG/M
3300019256|Ga0181508_1109878All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6520Open in IMG/M
3300019788|Ga0182028_1251126All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1740Open in IMG/M
3300021374|Ga0213881_10303567All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans713Open in IMG/M
3300021388|Ga0213875_10603114All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans530Open in IMG/M
3300021406|Ga0210386_11472034All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans568Open in IMG/M
3300021407|Ga0210383_10065876All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans3027Open in IMG/M
3300021407|Ga0210383_10427768All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans1143Open in IMG/M
3300021433|Ga0210391_10988268All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6655Open in IMG/M
3300021439|Ga0213879_10169433All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans640Open in IMG/M
3300021478|Ga0210402_11944347All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis514Open in IMG/M
3300022557|Ga0212123_10234543All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans1330Open in IMG/M
3300024227|Ga0228598_1130821All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans511Open in IMG/M
3300025473|Ga0208190_1069206All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis716Open in IMG/M
3300025911|Ga0207654_11311550All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans528Open in IMG/M
3300025913|Ga0207695_11754297All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans502Open in IMG/M
3300025915|Ga0207693_10835685All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia709Open in IMG/M
3300025920|Ga0207649_11387439All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans556Open in IMG/M
3300025960|Ga0207651_11468685All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans614Open in IMG/M
3300025986|Ga0207658_10877271All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans816Open in IMG/M
3300026551|Ga0209648_10748604All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans533Open in IMG/M
3300026552|Ga0209577_10689968All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans580Open in IMG/M
3300027641|Ga0208827_1007357All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4279Open in IMG/M
3300027884|Ga0209275_10682889All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis591Open in IMG/M
3300027894|Ga0209068_10446398All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis742Open in IMG/M
3300027895|Ga0209624_10334669All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans1009Open in IMG/M
3300027895|Ga0209624_11059058All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans523Open in IMG/M
3300028380|Ga0268265_11910537All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans600Open in IMG/M
3300028560|Ga0302144_10208423All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis633Open in IMG/M
3300028785|Ga0302201_10152454All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans991Open in IMG/M
3300028800|Ga0265338_10603081All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6765Open in IMG/M
3300028860|Ga0302199_1142859All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6749Open in IMG/M
3300028874|Ga0302155_10067670All Organisms → cellular organisms → Bacteria → Acidobacteria1616Open in IMG/M
3300029913|Ga0311362_10915673All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans701Open in IMG/M
3300029919|Ga0302141_1029966All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1492Open in IMG/M
3300029922|Ga0311363_11351680All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans585Open in IMG/M
3300029951|Ga0311371_11884266All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis641Open in IMG/M
3300029953|Ga0311343_10000597All Organisms → cellular organisms → Bacteria64014Open in IMG/M
3300029954|Ga0311331_10206035All Organisms → cellular organisms → Bacteria2234Open in IMG/M
3300029954|Ga0311331_11198357All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans641Open in IMG/M
3300029986|Ga0302188_10174020All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans920Open in IMG/M
3300029986|Ga0302188_10205354All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis832Open in IMG/M
3300030051|Ga0302195_10084873All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1627Open in IMG/M
3300030518|Ga0302275_10135739All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1567Open in IMG/M
3300030580|Ga0311355_10647738All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6990Open in IMG/M
3300031233|Ga0302307_10413938All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6685Open in IMG/M
3300031234|Ga0302325_12684991All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans588Open in IMG/M
3300031236|Ga0302324_100041329All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8483Open in IMG/M
3300031236|Ga0302324_101397151All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis917Open in IMG/M
3300031238|Ga0265332_10011147All Organisms → cellular organisms → Bacteria3995Open in IMG/M
3300031525|Ga0302326_11216343All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans1035Open in IMG/M
3300031525|Ga0302326_13624141All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6510Open in IMG/M
3300031708|Ga0310686_113556826All Organisms → cellular organisms → Bacteria5681Open in IMG/M
3300031708|Ga0310686_119765889All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans1419Open in IMG/M
3300031910|Ga0306923_10179130All Organisms → cellular organisms → Bacteria → Acidobacteria2421Open in IMG/M
3300031954|Ga0306926_10320833All Organisms → cellular organisms → Bacteria1916Open in IMG/M
3300032160|Ga0311301_11741023All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6747Open in IMG/M
3300032205|Ga0307472_102451809All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6530Open in IMG/M
3300032783|Ga0335079_10088918All Organisms → cellular organisms → Bacteria3506Open in IMG/M
3300032892|Ga0335081_10455403All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter1626Open in IMG/M
3300032892|Ga0335081_10652670All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin60761287Open in IMG/M
3300032892|Ga0335081_12704737All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis506Open in IMG/M
3300032895|Ga0335074_10584507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1122Open in IMG/M
3300033405|Ga0326727_11205815All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6527Open in IMG/M
3300033818|Ga0334804_024187All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis2046Open in IMG/M
3300034282|Ga0370492_0132352All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans1020Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland10.43%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog9.20%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog7.98%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.29%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.07%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.07%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.07%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog3.07%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.45%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.45%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.45%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.45%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.84%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.84%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.23%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.23%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.23%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.23%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated1.23%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.61%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.61%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.61%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.61%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.61%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.61%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.61%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.61%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.61%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.61%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.61%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.61%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.61%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.61%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.61%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.61%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.61%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009500Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009709Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300019256Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300025473Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028860Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3EnvironmentalOpen in IMG/M
3300028874Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1EnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029919Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029986Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1EnvironmentalOpen in IMG/M
3300030051Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2EnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031238Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaGHost-AssociatedOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_100008257103300002245Forest SoilMKFGSDCRVALAIQRAENPQGKCEVYHYNTDGTLDWGYFQVNTVHLKRPGLNLRDLLDCKANIDFAYQLFQEKRGFAAWSTYNSGKYRQFMESR*
Ga0063454_10088025013300004081SoilQRAENSQGKCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYVEKHNFTPWSTFKNGSYRRYLRD*
Ga0070682_10108824923300005337Corn RhizosphereAIQRAENPQGKCEIYHYNADGTLDWGYFQINTVHLKRRGLNLRDLLDCKANIDFAYRLYTENHGFTAWATFNSGKYKRYLRRD*
Ga0070673_10224972923300005364Switchgrass RhizosphereSAWQQYACRKFGSDCRLALAIQRAENPQGKCEIYHYNSDGTLDWGYFQINTVHLKRPGINLRDLLDCKANIDFAYQLYKEKGGFSPWSTFNNGAYRHFIGP*
Ga0070667_10096246513300005367Switchgrass RhizosphereAENAPGKCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKTNIDFAYQLYVERGGFTPWSTYNNGAYRKFMGH*
Ga0070714_10005994613300005435Agricultural SoilSAWQEYACRKFGSDCRVALAIQRAENPQGKCEIYHYNTDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYRERGGFTPWSTYNSGMYRRFLGPE*
Ga0070741_1071003623300005529Surface SoilACRKFGADCRLALAIQRAENPQGKCEIYHYNSDGTLDWGYFQINTVHLQRPGLNLRDLLDCRANIDFAYQLYQEKKGFTPWSTYNSGKYRQFLASQ*
Ga0070735_1077986413300005534Surface SoilENPRGACEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYRERGFEPWTTYTSGAYRQYLRNF*
Ga0066695_1025508323300005553SoilAENPQGKCEIYHYNSDGTLDWGYFQINTVHLKRPGINLRDLLDCKANIDFAYQLYREKRGFTPWSTFNNGEYRQFMGQ*
Ga0066654_1086911913300005587SoilVALAIQRAENPQGKCEIYHYNTNGTLDWGYFQINTVHLKRPGLNLRDLLDCRTNIDFAFQLYTEEHGFTAWSTYNSGAYRRFLHE*
Ga0070761_1042990633300005591SoilENPQGKCEVYHYNADGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLFQEKRGFTAWSTYNSGKYRHFMESR*
Ga0070762_1009312713300005602SoilMKFGSDCRVALAIQRAENAQGKCEIYHYNTDGTLDWGYFQINTVHLERPGLNLRDLLDCKANIDFAYQLFEEKHGFTAWSTYNSGKYRQFMESR*
Ga0070764_1073917013300005712SoilIQRAENPQGKCEIYHYNRDGTLDWGYFQINTVHLQRPGLNLRDLLDCKANIDFAWQLFQEKRGFTPWSTYNSGKYRQFLETR*
Ga0070764_1099655723300005712SoilIALAVQRAENPRGACEIFHYNTDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYSERGFEPWSTFNSGAYRQFLRKF*
Ga0070766_1025967213300005921SoilKFGPACRTALAIQRAENPRGACEIYHYNSDGTLDWGYFQVNTVHLKRAGVNLRDLLDCKANIDFAYRLYTERGFAAWSTFNSGAYLQFLKKF*
Ga0075023_10052540213300006041WatershedsLAVQRAENPRGVCEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLNCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRRF*
Ga0075014_10081258223300006174WatershedsLSAWQEYACRQFGPNCRVALAIQRAENPQGKCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFASQLFREKGFTPWSTFNSGMYRRFLSQ*
Ga0070712_10045272013300006175Corn, Switchgrass And Miscanthus RhizosphereNPGGECEIYHHNPDGTLDWGYFQINTVHLKRPGVNLRDLLDCKKNIDFAYLLYRERGDFTAWAAYKSGAYRRALRN*
Ga0097621_10046097823300006237Miscanthus RhizosphereVALAIQRAENPQGKCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCRANIDFAYQLYQESHGFTPWSTYNSGKYRQFLKSR*
Ga0066660_1087942313300006800SoilFGPDCRLALAIQHAENPQGKCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYREKGGFTPWSTFNSGVYRQFMTQ*
Ga0066793_1079933813300009029Prmafrost SoilNPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRNLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRNF*
Ga0105240_1110640123300009093Corn RhizosphereLSAWQQYACRKFGADCRVALAIQRAENPAGKCEIYHYNSNGTLDWGYFQINTVHLRRPGMNLRDMLDCKANIDFAYQLYRESRGFTPWSTYNSGLYRKFLRAQ*
Ga0066709_10342530113300009137Grasslands SoilEYACKKFGSDCRVALAIQRAENPQGKCEIYHYNADGTLDWGYFQINTVHLQRPGLNLRDLLDCKANIDFAYQLYQEKGGFTPWSTYNSGRYRQFLASQ*
Ga0066709_10390110613300009137Grasslands SoilPACRVALAIQRAENPKGRCEIYHYNTDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLFVESHGFTPWSTYNSGAYRRFLHTYSGR*
Ga0116229_1039975743300009500Host-AssociatedQRAENPQGKCEIYHYNSDGTLDWGYFQINTVHLQRPGLNLRDLLDCRANIDFAYRLYAEHQNFSAWNTYNNGTYRKFLRR*
Ga0116133_108057823300009623PeatlandENPRGDCEIYHYNSDGTLDWGYFQINTVHLKRVGVNLHDLLDCKANIDFAYQLYTEKGFEPWTTYRSGAYLEFLRNF*
Ga0116117_116836513300009635PeatlandQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYKLYTERGFEPWTTFNSGAYRQFLRKP*
Ga0116110_103706833300009643PeatlandVALAVQRAENPKGACEVYHYNTDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTYNSGAYRQFLRTF*
Ga0116106_117697113300009645PeatlandLAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIEFAYQLYTERGFEPWTT
Ga0116215_131238213300009672Peatlands SoilACNKFGPACRVALAIQRAENPRGSCEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCRANIDFAYQLYQERGFAPWSTFNDGSYRKFLRSR*
Ga0116227_1120214113300009709Host-AssociatedQQYACRKFGSACRVALAIQRAENPQGKCEIYHYNTDGTLDWGYFQINTVHLQRPGLVLRDLLDCRANIDFAYQLYTEHHGFSPWSTYNSGAYRKFLHQ*
Ga0116101_107639813300009759PeatlandIQRAENPQGKCEIYHYNNDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYTERGFEPWSTFNSGAYRQFLRTF*
Ga0116134_113153723300009764PeatlandALAVQRAENPKGACEVYHYNTDGTLDWGYFQINTVHLKRAGVNLRGLLDCRANIDFAYQLYTERGFEPWTTYNSGAYRQFLRTF*
Ga0126376_1271160613300010359Tropical Forest SoilIALAIQRAENPRGDCEIYHYNTSDGTLDWGYFQINTVHLTRAGVNLRALLDCKANIDFAYQLYTERGFEPWTTYNNGAYRRFLRNF*
Ga0126378_1231744223300010361Tropical Forest SoilIALAIQRAENPQGKCEIYHYNTDGTLDWGYFQINTVHLQRPGLNLRDLLDCRANIDFAYQLYQEKKSFAPWSTYNNGKYRQFLTSR*
Ga0134125_1183305233300010371Terrestrial SoilWQEYACRKFGPDCRVALAIQRAENPQGKCEIYHYNTDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYRERGGFTPWSTYNSGMYRRFLGPE*
Ga0105239_1166380823300010375Corn RhizosphereAIQRAENPRGKCEIYHYNPNGTLDWGYFQINTVHLERPGLNLRDLLDCKANIDFAHQLYQEKHGFTPWSTYNNGRYRQFLKSQ*
Ga0126381_10126864823300010376Tropical Forest SoilCEVYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYVLYQERGFEPWTTYTSGAYQKYLRNP*
Ga0126381_10226441313300010376Tropical Forest SoilKFGSDCRVALAVQRAENPRGDCEIYHYNTDGTLDWGYFQINTVHLKRPGVNLRSLLDCRANIDFAYQLYTERGFEPWTTYRNGAYRRFLRNF*
Ga0136449_10122287113300010379Peatlands SoilQYACNKFGRACRLALAVQRAENPRGACEVYHYNSDGTLDWGYSQINTVHLKCAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRSFLRTF*
Ga0136449_10228249113300010379Peatlands SoilVALAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRKL*
Ga0150983_1285057623300011120Forest SoilSAWQQYACRKFGPDCRLALAIQRAENPQGKCEIYHYNSDGTLDWGYFQINTVHLKRSGLNLHDLLDCKANIDFAYQLYREKGGFTLWSTFNNGAYRQFMSE*
Ga0137392_1160242613300011269Vadose Zone SoilLAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRNLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRTF*
Ga0137389_1072328313300012096Vadose Zone SoilQQYACNKFGSACRIALAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRNLLDCRANIDFAYQLYTERGFEPWTTFNSGAYRQFLRTF*
Ga0150985_10922234913300012212Avena Fatua RhizosphereVALAIQRAENVQGKCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYVEQHGFTPWSTYNNGAYRRYMSRE*
Ga0150984_11283615413300012469Avena Fatua RhizosphereVALAIQRAENVQGKCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYVEQHGFTPWSTYNNGAYQRYMSRE*
Ga0157305_1018142313300012891SoilPLTAWQQYACRKFGADCRVALAIQRAENLAGKCEIYHYNTDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAFQLFQESRGFTPWSTYKSGRYLQYLAPR*
Ga0137359_1093349323300012923Vadose Zone SoilRVALALQRAENPEGKCEVYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYQEKRGFTPWSTYNSGKYRQFLASQ*
Ga0126369_1219524613300012971Tropical Forest SoilRAENPRGSCEIYHYNPDGTLDWGYFQINTVHLKRAGVNLRGLLDCRANIDFAYQLYTERGFEPWTTFRSGEYRRFLRNF*
Ga0157378_1014955813300013297Miscanthus RhizosphereAYQQYACNKFGTACRIALAVQRAENPRGACEVYHYNSDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLFLENGFKPWTTFNSGAYRQFLKSP*
Ga0181539_109072833300014151BogRGACETYHYNSDGTLDWGYFQINTVHLKRAGVHFRDPLNCKANIDFAYKLYTERGFEPWTTFNSGAYRQFLRKP*
Ga0181533_102752033300014152BogLAVQRAENPRGACETYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLNCKANIDFAYKLYTERGFEPWTTFNSGAYRQFLRKP*
Ga0181518_1025873413300014156BogLAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIEFAYQLY
Ga0181517_1049739013300014160BogCNKFGPACRIALAVQRAENPRGDCEIYHYNTDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRNFQ*
Ga0181538_1012436013300014162BogLAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIEFAYQLYTERGFEPWTTFNSGAYRQFLRTF*
Ga0181538_1018357613300014162BogCRIALAVQRAENPRGACEIFHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYKLYTERGFEPWTTFNSGAYRQFLSKP*
Ga0181532_1011647713300014164BogVYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLNCKANIDFAYKLYTERGFEPWTTFNSGAYRQFLRKP*
Ga0181523_1042496613300014165BogQQYACNKFGPACRVALAVQRAENPKGACEVYHYNTDGTLDWGYFQINTVHLKRAGVNLRGLLDCRANIDFAYQLYTERGFEPWTTYNSGAYRQFLRTF*
Ga0181534_1033735313300014168BogVQRADNPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRKP*
Ga0181535_1015653413300014199BogGSACRVALAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRTF*
Ga0181535_1058665513300014199BogHVALAIQRAENPRGDCEIYIYHYDADGTLDWGYFQIHTVQLDRPGLNLRDLLYCKANIDFACQLYLERGFTSWSPYNNGAYPKFLRDQ*
Ga0181526_1056120613300014200BogQIRFGMPRCAGGSTVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLNCKANIDFAYKLYTERGFEPWTTFNSGAYRQFLRKP*
Ga0157380_1218830223300014326Switchgrass RhizosphereCRVALAIQRAENPRGACETYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKSNIDFAYQLYRERGFEPWTTFTSGRYREFLKNF*
Ga0182000_1029695123300014487SoilGAACRIALAVQRAENPRGDCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYLEKHGFTPWSTFKSGAYRRYLRD*
Ga0182014_1003217273300014491BogRVALAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRKF*
Ga0182014_1004934513300014491BogRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRTF*
Ga0182013_1023082623300014492BogGQACRIALAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYKLYTERGFEPWTTFNSGAYRQFLRKP*
Ga0182013_1043143123300014492BogQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCHANIDFAYRLYTERGFEPWSTFQSGAYRQFLRNFPPDGILPAQ*
Ga0182024_1074543013300014501PermafrostRAENPRGKCEIYHYNTDGTLDWGYFQINTVHLERPGLNLRDLLDCKANIDFAYQLFEEKHGFTAWSTYNSGKYRQFMESR*
Ga0181525_1056700413300014654BogYTCLKFGSACRVALAIQRAENPEGKCETYHYNSDGTLDWGYFQINTIHLQRPGLNLRDLLDCRANIDFAYQLYSESQSFSAWSSYRNGTYRKFLRR*
Ga0182030_1067110823300014838BogAYQQYACLKFGPACRVALAIQRAENPDGKCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCRTNIDFAYQLYSERNGFTAWSTFNNGAYRRFLGHKD*
Ga0182027_1063380023300014839FenLAVQRAENPRGACEVYHYNSDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRNF*
Ga0137412_1072757413300015242Vadose Zone SoilGNACRVALAIQRAENPKGRCEIYHYNPDGTLDWGYFQINTVHLKRPGLNLRDLLNCNANIDFAYQLYQEKGDFTAWSTYNSGAYRRFLRPEGSRP*
Ga0182033_1043105123300016319SoilLAVQRAENPRGACEIYHYNTDGTLDWGYFQINTVHLRRPGVNLRALLDCRANIDFAYQLFTERGFEPWTTYRNGAYRKFLRNF
Ga0182033_1161242323300016319SoilLAVQRAENPRGACEIYHYNTDGTLDWGYFQINTVHLKRPGVNLRALLDCRANIDFAYQLYTERGFEPWTTYRNGAYQKFLRNF
Ga0181505_1017775323300016750PeatlandAENPRGDCEIYHYNTDGTLDWGYFQINTIHLKRVGVNLRALLDCKANIDFAYQLYTERGFEPWTTFRDGAYRKFLRNF
Ga0187848_1032264413300017935PeatlandKFGQACRIALAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYKLYTERGFEPWTTFNSGAYRQFLRKP
Ga0187854_1004037033300017938PeatlandLAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRTF
Ga0187819_1069899413300017943Freshwater SedimentPNGACEIYHYNSDGTLDWGYFQINTVHLQRPGLNLRDLLDCKANIDFAYLLYQERGFVPWTTYNSGAYLRFLHDAR
Ga0187879_1010494443300017946PeatlandQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIEFAYQLYTERGFEPWTTFNSGAYRQFLRTF
Ga0187879_1026406513300017946PeatlandYACNKFGPACRVALAVQRAENPKGACEVYHYNTDGTLDWGYFQINTVHLKRAGVNLRGLLDCRANIDFAYQLYTERGFEPWTTYNSGAYRQFLRTF
Ga0187879_1037006423300017946PeatlandVQRAENPRGACEVYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAHKLYTERGFEPWTTFNSGAYRQFLRTF
Ga0187879_1075238213300017946PeatlandIALAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYKLYTERGFEPWTTFNSGAYRQFLRKP
Ga0187847_1033436213300017948PeatlandDCRVALAIQRAENPQGKCEIYHYNSDGTLDWGYFQINTVHLERPGLNLRDLLDCKANIDFAYQLYQEKHGFTPWSTYNSGKYRQFLQAQ
Ga0181520_1026823823300017988BogAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYKLYTERGFEPWTTFNSGAYRQFLRKP
Ga0181520_1107435413300017988BogAYQQYACNKFGPACRIALAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRTF
Ga0187823_1023622923300017993Freshwater SedimentYQQYACNKFGPECRIALAIQRAENPRGACEIYHYNTDGTLDWGYFQINTVHLKRPGVNLRGLLDCKANIDFAYQLYTERGFEPWTTYRDGAYRRYLRSF
Ga0187816_1011723723300017995Freshwater SedimentVALAIQRAENPKGACEIYHYNSDGTLDWGYFQINTVHLQRPGVNLRDLLDCKANIDFAYLLYLERGFAPWTTYNSGAYLNFLHDAR
Ga0187805_1048796123300018007Freshwater SedimentGTACRVALAIQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLQRPGLNLRDLLDCKANIDFAYLLYQERGFTPWTTYNSGAYLKFLHENR
Ga0187888_132692313300018008PeatlandACNKFGSACRIALAVQRAENPRGDCETYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYTEKGFEPWTTYRTGAYLEFLRTF
Ga0187889_1026807413300018023PeatlandRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWSTFNSGAYRQFLRTF
Ga0187883_1002171823300018037PeatlandLAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWSTFNSGAYRQFLRTF
Ga0187855_1013663733300018038PeatlandLAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIEFAYQLYTERGFEPWTTFNSGAYRQF
Ga0187855_1080001113300018038PeatlandMTAVRVQEIRFRLPVALAIQRAENPQGKCEIYHYNSDGTLDWGYFQINTVHLMRPGLNLRDLLDCKANIDFAYRLYQEEHGFTPWSTYKNGKYRQFLKS
Ga0187862_1008118023300018040PeatlandCRIALAVQRAENPRGACEVYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAHKLYTERGFEPWTTFNSGAYRQFLRTF
Ga0187871_1011871513300018042PeatlandLAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIEFAYQLYTERGFEPWTTFNSGAY
Ga0187871_1028165213300018042PeatlandCRIALAVQRAENPRGACEIYHYNTDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYRLYTERGFEPWTTFNSGAYRQFLR
Ga0187769_1114181623300018086Tropical PeatlandLAVQRAENPRGACEVYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYRLYAEKGFEPWSTFTSGAYRQFLRKF
Ga0181508_110987813300019256PeatlandSDCRIALAVQRAENPRGDCEIYHYNTDGTLDWGYFQINTIHLKRVGVNLRGLLDCKANIDFAYQLYTERGFEPWTTFRDGAYRKFLRNF
Ga0182028_125112613300019788FenRIALAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRTF
Ga0213881_1030356723300021374Exposed RockRGALAIQRAENPQGKCEVYHYNSDGTLDWGYFQINTVHLKRPGVNLRDLLDCKMNIDFAYQLYLEKHGFTPWSTYNNGLYRRYLR
Ga0213875_1060311413300021388Plant RootsHPLNAYQQYACAKFGPACRVALAIQRAENPQGKCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCRANIDFAYQLYVEKQGFTPWSTYRTGLYRRFLRE
Ga0210386_1147203413300021406SoilIQRAENPQGKCEIYHYNTDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYQEQHGFTPWSTYNSGKYRQFIEP
Ga0210383_1006587633300021407SoilMKFGSDCRVALAIQRAENPLGKCEVYHYNTDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLFQEKRGFTAWSTYNSGKYRQFMESR
Ga0210383_1042776823300021407SoilMKFGSDCRVALAIQRAENAQGKCEIYHYNTDGTLDWGYFQINTVQLERPGLNLRDLLDCKANIDFAYQLFEQKHGFIAWSTYNSGKYP
Ga0210391_1098826823300021433SoilQRAENPLGKCEIYHYNSDGTLDWGYFQINTVHLRRPGLNLRDLLDCKANIDFAYQLYQEKRGFTPWSTYNSGKYREFLASAP
Ga0213879_1016943313300021439Bulk SoilRHALTPYQQYACRKFGSACRVALAIQRAENPQGKCEIYHYNTDGTLDWGYFQINTIHLKRPGLNLRDLLDCKANIDFAYRLFVQMAGFTPWSTYNNGAYRKYLHE
Ga0210402_1194434713300021478SoilKFGSACRIALAVQRAENPRGACEIYHYNADGTLDWGYFQINTVHLKRAGVNLRNLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRTF
Ga0212123_1023454313300022557Iron-Sulfur Acid SpringENPQGKCEIYHYNSDGTLDWGYFQINTVHLKRPGINLRDLLDCKANIDFAYQLYEEKGGFTPWSTFNNGAYRHFIGP
Ga0228598_113082123300024227RhizosphereKFGSDCRVALAIQRAENPQGKCEIYHYNTDGTLDWGYFQINTVHLERPGLNLRDLLDCKANIDFACQLFEGKHGFTPWSTYNTGKYRQFMESR
Ga0208190_106920613300025473PeatlandNKFGPACRIALAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAHKLYTERGFEPWTTFNSGAYRQFLRTF
Ga0207654_1131155023300025911Corn RhizosphereRKFGSDCRVALAIQRAENPQGKCETYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLGCKSNIDFAYQLFQEKGGFSPWSTYNSGRYRQFLTQ
Ga0207695_1175429723300025913Corn RhizosphereGLTAWQQYACRKFGTDCRVALAIQRAENPQGKCEIYHYNTNGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYREQGGFTPWSTYNSGLYRKFTGAR
Ga0207693_1083568513300025915Corn, Switchgrass And Miscanthus RhizosphereNPGGECEIYHHNPDGTLDWGYFQINTVHLKRPGVNLRDLLDCKKNIDFAYLLYRERGDFTAWAAYKSGAYRRALRN
Ga0207649_1138743923300025920Corn RhizosphereCRKFGSDCRVALAIQRAENPQGKCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLGCKSNIDFAYQLFQEKGGFTPWSTYNSGRYRQFLTQ
Ga0207651_1146868523300025960Switchgrass RhizosphereMRCRFALRNRPEMQFGLGGSDCRLALAIQRAENPQGKCEIYHYNSDGTLDWGYFQINTVHLKRPGINLRDLLDCKANIDFAYQLYKEKGGFSPWSTFNNGAYRHFIGP
Ga0207658_1087727113300025986Switchgrass RhizosphereVALAIQRAENAPGKCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKTNIDFAYQLYVERGGFTPWSTYNNGAYRKFMGH
Ga0209648_1074860413300026551Grasslands SoilAWQQYACRKFGTDCRLALAIQRAENPQGKCEIYHYNSDGTLDWGYFQINTVHLKRPGINLRDLLDCKANIDFAYQLYREKRGFTPWSTFNNGEYREFMGQ
Ga0209577_1068996813300026552SoilFGPDCRLALAIQHAENPQGKCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYREKGGFTPWSTFNSGVYRQFMTQ
Ga0208827_100735753300027641Peatlands SoilVALAIQRAENPRGSCEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCRANIDFAYQLYQERGFAPWSTFNDGSYRKFLRSR
Ga0209275_1068288913300027884SoilACRTALAIQRAENPRGACEIYHYNSDGTLDWGYFQVNTVHLKRAGVNLRDLLDCKANIDFAYRLYTERGFAAWSTFNSGAYLQFLKKF
Ga0209068_1044639813300027894WatershedsAYQQYTCSKFGAACRVALAIQRAENPEGKCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDMLDCKTNIDFAYQLYSEHDGFDSWSTYRNGAYRKFLRR
Ga0209624_1033466923300027895Forest SoilMKFGSDCRVALAIQRAENPQGKCEVYHYNTDGTLDWGYFQVNTVHLKRPGLNLRDLLDCKANIDFAYQLFQEKRGFAAWSTYNSGKYRQFMESR
Ga0209624_1105905823300027895Forest SoilHGRPLSAWQEYACRKFGSDCRVALAIQRAENPQGKCEIYHYNSDGTLDWGYFQINTVHLQRPDLNLRDLLDCKANIDFAYLLYREKRGFNPWSTYNTGKYRQFLQSQ
Ga0268265_1191053723300028380Switchgrass RhizosphereRKFGADCRIALAIQRAENPQGRCEIYHYNSNGTLDWGYFQINTVHLERPGLNLRDLLDCKANIDFAYQLYVEHGGFSPWSTFKSGRYLQFLSRP
Ga0302144_1020842323300028560BogQYACNKFGPACRIALAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRTF
Ga0302201_1015245413300028785BogIQRAENPQGKCEIYHYNTDGTLDWGYFQINTVHLKRPGLNLRDLLDCRANIDFAWQLYQESHGFTPWSTYNSGKYRQFLETR
Ga0265338_1060308123300028800RhizosphereACEVYHYNSDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRNF
Ga0302199_114285923300028860BogIALAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRTF
Ga0302155_1006767013300028874BogCRIALAIQRAENPEGKCETYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCRANIDFAYQLYAERQSFSAWSAYNSGTYRKYLRR
Ga0311362_1091567323300029913BogAWQQYACGKFGADCRVALAIQRAENPQGKCEIYHYNTDGTLDWGYFQINTVHLKRPGLNLRDLLDCRANIDFAYQLYRERHGFTPWSTFNSGKYRQFLESR
Ga0302141_102996613300029919BogCRIALAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRTF
Ga0311363_1135168023300029922FenADCRIALAIQRAENAPGKCETYHYNSDGTLDWGYFQINTVHLQRPGLNLRDLLDCKANIDFAYQLYQEKHGFTPWSTYNSGEYRKFLAPQ
Ga0311371_1188426613300029951PalsaQYACNKFGAACRVALAVQRAENPKGACEVYHYNSDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTYNSGAYRQFLRTF
Ga0311343_1000059713300029953BogGLSAWQQYACRKFGADCRVALAIQRAENAQGKCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYREKGGFTPWSTFNDGRYRRYMGR
Ga0311331_1020603513300029954BogWQEYACRKFGSDCRVALAIQRAENPQGKCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLHDLLDCKANIDFAFQLYQERGGFTPWSTYNSGLYRKFIGGE
Ga0311331_1119835723300029954BogLGPLTAYQQYACRKFGAACRVALAIQRAENPQGKCEIYHYNPDGTLDWGYFQINTVHLQRPGLVLRDLLDCRANIDFAYQLYSEHHGFTPWATYNSGVYRKFLRQ
Ga0302188_1017402023300029986BogSAWQEYACLKFGADCRIALAIQRAENPQGKCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYREKGGFTPWSTFNDGRYRRYMGR
Ga0302188_1020535413300029986BogLTPYQEYTCLKFGAACRVALAIQRAENPEGKCETYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCRANIDFAYQLYSERQSFAAWSVYNNGSYRKYLRH
Ga0302195_1008487323300030051BogCNKFGPACRIALAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRTF
Ga0302275_1013573933300030518BogCRIALAIQRAENAPGKCETYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRKF
Ga0311355_1064773823300030580PalsaENPRGACEIYHYNTDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYRLYTERGFEPWTTFNSGAYRQFLR
Ga0302307_1041393823300031233PalsaQRAENPRGACEIYHYNTDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYRLYTERGFEPWTTFNSGAYRQFLR
Ga0302325_1268499113300031234PalsaPDCRVALAIQRAENAPGKCEVYHYNADGTLDWGYFQINTVHLERPGLNLRDLLDCKANIDFAYQLFEEKHGFTAWSTYNSGKYHQFMESR
Ga0302324_10004132913300031236PalsaRAENPRGACEIYHYNTDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYRLYTERGFEPWTTFNSGAYRQFLR
Ga0302324_10139715123300031236PalsaNKFGPSCRVALAVQRAENPRGACEVYHYNSDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYKLYTERGFEPWTTFNSGAYRQFLKH
Ga0265332_1001114713300031238RhizosphereAPNGKRGDRESETVRSESRAGEGCRTALAIQRAENPQGKCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLFQEKHGFSAWSTYNSGKYRQFLNAH
Ga0302326_1121634323300031525PalsaDCRIALAIQRAENPQGKCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCGANIDFAYQLYRERGGFTPWATYNSGLYRKFIGPE
Ga0302326_1362414123300031525PalsaVQRAENPRGACEVYHYNSDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYKLYTERGFEPWTTFNSGAYRQFLKH
Ga0310686_11355682673300031708SoilMKFGSDCRVALAIQRAENPQGKCEIYHYNTDGTLDWGYFQINTVHLERPGLNLRDLLDCKANIDFACQLFEGKHGFTPWSTYNTGKYRQFMESR
Ga0310686_11976588923300031708SoilVKFGSDCRVALAIQRAENPQGKCEVYHYNADGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLFQEKRGFTAWSTYNSGKYRHFMESR
Ga0306923_1017913013300031910SoilRAENPRGACEIYHYNTDGTLDWGYFQINTVHLKRPGVNLRALLDCRANIDFAYQLYTERGFEPWTTYRNGAYQKFLRNF
Ga0306926_1032083313300031954SoilAENPRGACEIYHYNTDGTLDWGYFQINTVHLRRPGVNLRALLDCRANIDFAYQLFTERGFEPWTTYRNGAYRKFLRNF
Ga0311301_1174102323300032160Peatlands SoilQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRKL
Ga0307472_10245180913300032205Hardwood Forest SoilALAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYTERGFEPWTTFNNAAYRQFLRKL
Ga0335079_1008891813300032783SoilAENPKGACEIYHYNSDGTLDWGYFQINTVHLQRPGVNLRDLLDCKANIDFAYLLYLERGFAPWTTYNSGAYLNFLHDAR
Ga0335081_1045540313300032892SoilVQRAENPRGACETYHYNSDGTLDWGYFQINTVHLKRPGLNLRNLLDCKANIDFAYQLYRERGFEPWTTYTTGAYRQFLQPLH
Ga0335081_1065267023300032892SoilSACRVALAIQRAENPKGACEIYHYNSDGTLDWGYFQINTVHLQRPGVNLRDLLDCKANIDFAYLLYLERGFAPWTTYNSGAYLNFLHDAR
Ga0335081_1270473723300032892SoilYQQYACNKFGPACRVALAVERAENPKGACEIYHYNTDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYRERGFEPWTTYTSGLYRNYLRDP
Ga0335074_1058450713300032895SoilGKPLTAYQQYACAKFGPNCRIALAIQRAENPQGKCEIYHYNTDGTLDWGYFQINTVHLKRPGLNLRDLLDCKTNIDFAYELFQENKGFSPWSTYKNGAYRKFLLER
Ga0326727_1120581513300033405Peat SoilPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRSLLDCKANIDFAYQLYTERGFEPWTTFNNGAYQQFLRTF
Ga0334804_024187_386_6943300033818SoilLTAYQQYACNKFGPACRIALAVQRAENPRGACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRTF
Ga0370492_0132352_2_2953300034282Untreated Peat SoilTCLKFGNACRIALAIQRAENPQGKCEIYHYNSSDGTLDWGYFQINTVHLKRPGLNMRDLLSCRANIDFAYQLYVERRGFTPWSTFNNGAYLRFLRTK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.