NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F039732

Metagenome / Metatranscriptome Family F039732

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039732
Family Type Metagenome / Metatranscriptome
Number of Sequences 163
Average Sequence Length 49 residues
Representative Sequence IAAVREYMDEKKWREAEAQVPQVAQVIENVAAGIGKAADDLEKAVARSQ
Number of Associated Samples 145
Number of Associated Scaffolds 163

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.85 %
% of genes near scaffold ends (potentially truncated) 95.71 %
% of genes from short scaffolds (< 2000 bps) 88.34 %
Associated GOLD sequencing projects 138
AlphaFold2 3D model prediction Yes
3D model pTM-score0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (70.552 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(8.589 % of family members)
Environment Ontology (ENVO) Unclassified
(22.086 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.307 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 58.44%    β-sheet: 0.00%    Coil/Unstructured: 41.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 163 Family Scaffolds
PF00072Response_reg 3.68
PF13545HTH_Crp_2 2.45
PF13414TPR_11 1.84
PF00487FA_desaturase 1.84
PF07690MFS_1 1.23
PF08282Hydrolase_3 1.23
PF00370FGGY_N 1.23
PF01618MotA_ExbB 1.23
PF14534DUF4440 1.23
PF00990GGDEF 1.23
PF07969Amidohydro_3 1.23
PF14559TPR_19 1.23
PF02836Glyco_hydro_2_C 1.23
PF13432TPR_16 1.23
PF00756Esterase 1.23
PF02129Peptidase_S15 0.61
PF07519Tannase 0.61
PF00563EAL 0.61
PF01926MMR_HSR1 0.61
PF16499Melibiase_2 0.61
PF04266ASCH 0.61
PF02782FGGY_C 0.61
PF03951Gln-synt_N 0.61
PF00691OmpA 0.61
PF02897Peptidase_S9_N 0.61
PF07676PD40 0.61
PF12276DUF3617 0.61
PF08241Methyltransf_11 0.61
PF12434Malate_DH 0.61
PF07883Cupin_2 0.61
PF00384Molybdopterin 0.61
PF04253TFR_dimer 0.61
PF00171Aldedh 0.61
PF07366SnoaL 0.61
PF04397LytTR 0.61
PF00491Arginase 0.61
PF13911AhpC-TSA_2 0.61
PF00106adh_short 0.61
PF00912Transgly 0.61
PF01152Bac_globin 0.61
PF01037AsnC_trans_reg 0.61
PF01418HTH_6 0.61
PF05239PRC 0.61
PF08281Sigma70_r4_2 0.61
PF08751TrwC 0.61
PF02423OCD_Mu_crystall 0.61
PF00378ECH_1 0.61
PF02472ExbD 0.61
PF02033RBFA 0.61
PF00486Trans_reg_C 0.61
PF13620CarboxypepD_reg 0.61
PF04333MlaA 0.61
PF01165Ribosomal_S21 0.61
PF00848Ring_hydroxyl_A 0.61
PF04264YceI 0.61
PF08439Peptidase_M3_N 0.61

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 163 Family Scaffolds
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 1.84
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 1.84
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 1.23
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 1.23
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 1.23
COG4638Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunitInorganic ion transport and metabolism [P] 1.23
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 1.23
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 1.23
COG3250Beta-galactosidase/beta-glucuronidaseCarbohydrate transport and metabolism [G] 1.23
COG2423Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin familyAmino acid transport and metabolism [E] 0.61
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 0.61
COG2853Lipoprotein subunit MlaA of the ABC-type intermembrane phospholipid transporter MlaCell wall/membrane/envelope biogenesis [M] 0.61
COG3097Uncharacterized conserved protein YqfB, UPF0267 familyFunction unknown [S] 0.61
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 0.61
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.61
COG4405Predicted RNA-binding protein YhfF, contains PUA-like ASCH domainGeneral function prediction only [R] 0.61
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 0.61
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 0.61
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.61
COG0010Arginase/agmatinase family enzymeAmino acid transport and metabolism [E] 0.61
COG2411Predicted RNA-binding protein, contains PUA-like ASCH domainGeneral function prediction only [R] 0.61
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.61
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 0.61
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 0.61
COG1770Protease IIAmino acid transport and metabolism [E] 0.61
COG1737DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domainsTranscription [K] 0.61
COG1505Prolyl endopeptidase PreP, S9A serine peptidase familyAmino acid transport and metabolism [E] 0.61
COG1164Oligoendopeptidase FAmino acid transport and metabolism [E] 0.61
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.61
COG0858Ribosome-binding factor RbfATranslation, ribosomal structure and biogenesis [J] 0.61
COG0848Biopolymer transport protein ExbDIntracellular trafficking, secretion, and vesicular transport [U] 0.61
COG0828Ribosomal protein S21Translation, ribosomal structure and biogenesis [J] 0.61
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 0.61
COG0174Glutamine synthetaseAmino acid transport and metabolism [E] 0.61
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.61


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms70.55 %
UnclassifiedrootN/A29.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459010|GIO7OMY01DRZ5UNot Available536Open in IMG/M
2170459021|G14TP7Y01EJ3XNAll Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia584Open in IMG/M
3300002245|JGIcombinedJ26739_101701015All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300003350|JGI26347J50199_1041860All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia536Open in IMG/M
3300004080|Ga0062385_10840256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria604Open in IMG/M
3300004092|Ga0062389_101271207All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300004092|Ga0062389_101579554All Organisms → cellular organisms → Bacteria → Acidobacteria838Open in IMG/M
3300004479|Ga0062595_100868138Not Available755Open in IMG/M
3300005293|Ga0065715_11154575Not Available508Open in IMG/M
3300005332|Ga0066388_100778996Not Available1552Open in IMG/M
3300005332|Ga0066388_102498028All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300005356|Ga0070674_102228331All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300005364|Ga0070673_100606209All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter999Open in IMG/M
3300005406|Ga0070703_10282008All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae686Open in IMG/M
3300005434|Ga0070709_10755083All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300005435|Ga0070714_101440003All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium673Open in IMG/M
3300005439|Ga0070711_101407375All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300005451|Ga0066681_10017635All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3607Open in IMG/M
3300005454|Ga0066687_10595149All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300005530|Ga0070679_102061873All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300005547|Ga0070693_100628326All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter778Open in IMG/M
3300005564|Ga0070664_102065598All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter541Open in IMG/M
3300005568|Ga0066703_10525649All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300005578|Ga0068854_102043177Not Available528Open in IMG/M
3300005591|Ga0070761_11016045Not Available526Open in IMG/M
3300005602|Ga0070762_10949848Not Available588Open in IMG/M
3300005712|Ga0070764_10161749All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300005712|Ga0070764_10580612All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae682Open in IMG/M
3300005712|Ga0070764_10714001All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300005950|Ga0066787_10051034All Organisms → cellular organisms → Bacteria → Acidobacteria796Open in IMG/M
3300005994|Ga0066789_10030200All Organisms → cellular organisms → Bacteria2402Open in IMG/M
3300006028|Ga0070717_10492098All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300006028|Ga0070717_10513960All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300006052|Ga0075029_100936878All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300006176|Ga0070765_100012334All Organisms → cellular organisms → Bacteria6059Open in IMG/M
3300006176|Ga0070765_100888659All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes842Open in IMG/M
3300006176|Ga0070765_102168511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeobacteria → Gloeobacterales → Gloeobacteraceae → Gloeobacter → Gloeobacter kilaueensis518Open in IMG/M
3300006800|Ga0066660_10787064All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300006806|Ga0079220_11418435All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300006854|Ga0075425_101553131All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Spirosoma → Spirosoma spitsbergense747Open in IMG/M
3300006871|Ga0075434_102521403All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300007819|Ga0104322_130842All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1577Open in IMG/M
3300009011|Ga0105251_10463136All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300009101|Ga0105247_10959118All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium665Open in IMG/M
3300009522|Ga0116218_1524457All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 162528Open in IMG/M
3300009645|Ga0116106_1173369All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300009709|Ga0116227_10185686All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium1622Open in IMG/M
3300009709|Ga0116227_11346854All Organisms → cellular organisms → Bacteria → Proteobacteria536Open in IMG/M
3300009787|Ga0116226_10005664All Organisms → cellular organisms → Bacteria → Proteobacteria11160Open in IMG/M
3300009826|Ga0123355_10249466All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2501Open in IMG/M
3300009839|Ga0116223_10863429All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300010048|Ga0126373_10009814All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7679Open in IMG/M
3300010362|Ga0126377_13509807Not Available507Open in IMG/M
3300010379|Ga0136449_104438652Not Available517Open in IMG/M
3300010398|Ga0126383_11363278All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium799Open in IMG/M
3300012096|Ga0137389_10701427All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300012189|Ga0137388_11770294All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300012359|Ga0137385_11052637All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300012960|Ga0164301_11015045Not Available653Open in IMG/M
3300012986|Ga0164304_10829804All Organisms → cellular organisms → Bacteria → Acidobacteria716Open in IMG/M
3300013307|Ga0157372_10353233All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1713Open in IMG/M
3300013503|Ga0120127_10118812Not Available608Open in IMG/M
3300014164|Ga0181532_10092998All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1892Open in IMG/M
3300014165|Ga0181523_10233323All Organisms → cellular organisms → Bacteria → Proteobacteria1055Open in IMG/M
3300014165|Ga0181523_10642191All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300014169|Ga0181531_10533544All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 162726Open in IMG/M
3300014201|Ga0181537_10155190All Organisms → cellular organisms → Bacteria → Acidobacteria1570Open in IMG/M
3300014325|Ga0163163_11286112Not Available794Open in IMG/M
3300014491|Ga0182014_10003897All Organisms → cellular organisms → Bacteria → Proteobacteria17598Open in IMG/M
3300014493|Ga0182016_10795127All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria526Open in IMG/M
3300014498|Ga0182019_10812293All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M
3300014838|Ga0182030_11323163Not Available606Open in IMG/M
3300014883|Ga0180086_1196962Not Available522Open in IMG/M
3300014969|Ga0157376_10472146All Organisms → cellular organisms → Bacteria → Acidobacteria1228Open in IMG/M
3300015168|Ga0167631_1024635All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300015357|Ga0134072_10145633All Organisms → cellular organisms → Bacteria → Acidobacteria775Open in IMG/M
3300016387|Ga0182040_11791937All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300017946|Ga0187879_10532815Not Available652Open in IMG/M
3300017961|Ga0187778_10017410All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4412Open in IMG/M
3300018017|Ga0187872_10401098Not Available581Open in IMG/M
3300018035|Ga0187875_10735568Not Available517Open in IMG/M
3300018040|Ga0187862_10771751Not Available558Open in IMG/M
3300018042|Ga0187871_10127226All Organisms → cellular organisms → Bacteria → Acidobacteria1451Open in IMG/M
3300018042|Ga0187871_10761173Not Available540Open in IMG/M
3300018047|Ga0187859_10704665Not Available574Open in IMG/M
3300018058|Ga0187766_10472412Not Available840Open in IMG/M
3300018085|Ga0187772_10435572All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium917Open in IMG/M
3300018433|Ga0066667_12279738All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300018482|Ga0066669_10156411All Organisms → cellular organisms → Bacteria → Acidobacteria1685Open in IMG/M
3300018482|Ga0066669_10458103All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300020583|Ga0210401_10645267All Organisms → cellular organisms → Bacteria → Proteobacteria920Open in IMG/M
3300021181|Ga0210388_10019185All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5514Open in IMG/M
3300021181|Ga0210388_10308830Not Available1389Open in IMG/M
3300021181|Ga0210388_10455057All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1124Open in IMG/M
3300021384|Ga0213876_10107715Not Available1479Open in IMG/M
3300021401|Ga0210393_10445509Not Available1057Open in IMG/M
3300021403|Ga0210397_10018540All Organisms → cellular organisms → Bacteria → Proteobacteria4247Open in IMG/M
3300021404|Ga0210389_10989804Not Available652Open in IMG/M
3300021433|Ga0210391_11206773All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300021476|Ga0187846_10108062All Organisms → cellular organisms → Bacteria1193Open in IMG/M
3300021560|Ga0126371_13455745All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300021560|Ga0126371_13807913Not Available508Open in IMG/M
3300022523|Ga0242663_1086892Not Available606Open in IMG/M
3300022714|Ga0242671_1035865All Organisms → cellular organisms → Bacteria → Acidobacteria771Open in IMG/M
3300022721|Ga0242666_1017527All Organisms → cellular organisms → Bacteria1311Open in IMG/M
3300022726|Ga0242654_10368442Not Available544Open in IMG/M
3300023030|Ga0224561_1005524All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300024271|Ga0224564_1059135All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Sphaerotilus → Sphaerotilus natans → Sphaerotilus natans subsp. natans → Sphaerotilus natans subsp. natans DSM 6575754Open in IMG/M
3300025500|Ga0208686_1087565Not Available674Open in IMG/M
3300025812|Ga0208457_1002980All Organisms → cellular organisms → Bacteria8550Open in IMG/M
3300025929|Ga0207664_11096873All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium712Open in IMG/M
3300025931|Ga0207644_11708572All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300025939|Ga0207665_10886237Not Available707Open in IMG/M
3300025941|Ga0207711_11550944Not Available606Open in IMG/M
3300026142|Ga0207698_12480229Not Available529Open in IMG/M
3300026322|Ga0209687_1311103All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300027660|Ga0209736_1097508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella801Open in IMG/M
3300027737|Ga0209038_10012545All Organisms → cellular organisms → Bacteria2486Open in IMG/M
3300027767|Ga0209655_10100905All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Sphaerotilus → Sphaerotilus natans → Sphaerotilus natans subsp. natans → Sphaerotilus natans subsp. natans DSM 6575960Open in IMG/M
3300027783|Ga0209448_10148284All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium784Open in IMG/M
3300027829|Ga0209773_10001223All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis8833Open in IMG/M
3300027860|Ga0209611_10216131All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1163Open in IMG/M
3300027879|Ga0209169_10210027All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300027894|Ga0209068_10695951All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300027895|Ga0209624_11008965Not Available539Open in IMG/M
3300027915|Ga0209069_10964055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LTSP857521Open in IMG/M
3300028560|Ga0302144_10252219Not Available571Open in IMG/M
3300028784|Ga0307282_10321381Not Available747Open in IMG/M
3300028879|Ga0302229_10204581All Organisms → cellular organisms → Bacteria → Proteobacteria902Open in IMG/M
3300028879|Ga0302229_10467557Not Available558Open in IMG/M
3300028906|Ga0308309_11733596Not Available529Open in IMG/M
3300029910|Ga0311369_11167778Not Available597Open in IMG/M
3300029911|Ga0311361_10108202All Organisms → cellular organisms → Bacteria3896Open in IMG/M
3300029911|Ga0311361_10420993All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1388Open in IMG/M
3300029911|Ga0311361_10996082Not Available703Open in IMG/M
3300029911|Ga0311361_11425079Not Available530Open in IMG/M
3300029951|Ga0311371_12606614Not Available510Open in IMG/M
3300029955|Ga0311342_11032722All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium607Open in IMG/M
3300030041|Ga0302274_10009844All Organisms → cellular organisms → Bacteria7414Open in IMG/M
3300030524|Ga0311357_10451732All Organisms → cellular organisms → Bacteria → Proteobacteria1204Open in IMG/M
3300030549|Ga0210257_11061578All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300030580|Ga0311355_11240569All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria656Open in IMG/M
3300030743|Ga0265461_11861718All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300030760|Ga0265762_1148063Not Available557Open in IMG/M
3300031027|Ga0302308_10395213All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium832Open in IMG/M
3300031231|Ga0170824_106914559All Organisms → cellular organisms → Bacteria1718Open in IMG/M
3300031235|Ga0265330_10388656All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300031236|Ga0302324_100615733All Organisms → cellular organisms → Bacteria → Acidobacteria1553Open in IMG/M
3300031474|Ga0170818_100080908Not Available604Open in IMG/M
3300031521|Ga0311364_11659038Not Available630Open in IMG/M
3300031525|Ga0302326_12366468All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium671Open in IMG/M
3300031754|Ga0307475_11360619Not Available548Open in IMG/M
3300031823|Ga0307478_10019277All Organisms → cellular organisms → Bacteria → Acidobacteria4797Open in IMG/M
3300031938|Ga0308175_101906960Not Available666Open in IMG/M
3300031996|Ga0308176_10060717All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3151Open in IMG/M
3300032001|Ga0306922_12260280Not Available523Open in IMG/M
3300032515|Ga0348332_10165673All Organisms → cellular organisms → Bacteria1489Open in IMG/M
3300032782|Ga0335082_10465199All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300033158|Ga0335077_10012091All Organisms → cellular organisms → Bacteria10791Open in IMG/M
3300033475|Ga0310811_10938140All Organisms → cellular organisms → Bacteria → Acidobacteria772Open in IMG/M
3300033544|Ga0316215_1007662All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1054Open in IMG/M
3300033807|Ga0314866_094225All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 162534Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.59%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil6.13%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.52%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.29%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.29%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog4.29%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil4.91%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.07%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.07%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated2.45%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.84%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.84%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.84%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.84%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.84%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.84%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.84%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.84%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.23%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.23%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.23%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.23%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.23%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.23%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut1.23%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.23%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.23%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.23%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.61%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.61%
Permafrost SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil0.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.61%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.61%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.61%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.61%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.61%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.61%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.61%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.61%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.61%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.61%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.61%
RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Roots0.61%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.61%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.61%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
2170459021Litter degradation NP4EngineeredOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003350Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005950Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007819Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009709Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009787Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013503Permafrost microbial communities from Nunavut, Canada - A23_5cm_12MEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015168Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022523Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022714Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022721Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023030Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2EnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025812Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027860Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes)Host-AssociatedOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300030041Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030549Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033544Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5Host-AssociatedOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F62_099092002170459010Grass SoilMHPVLYGYGAKPVAAIREYMDANKWKEADGQVPQVAQVIETASAGIDRAAADFEAALAPL
4NP_019201702170459021Switchgrass, Maize And Mischanthus LitterGYGAKPIAAVREYMDEKKWKEAEAQIPQVAQVIENVAAGISKAADDLQNAH
JGIcombinedJ26739_10170101523300002245Forest SoilAVREYMDEKKWKEADAQIPQVSQVIENAAAGIDKAAADLESALPR*
JGI26347J50199_104186013300003350Bog Forest SoilYGAKTVAAVREYMDEKKWKDAEAQIPQVAQIIENVAAGIDKAASDFEAALPKK*
Ga0062385_1084025613300004080Bog Forest SoilEYMDEKKWTAAEGQVPQVAHVIENVAAGIDQAARDFEAAMQPSR*
Ga0062389_10127120723300004092Bog Forest SoilMDEKKWREAEGQVPQVAQVIENVAAGIDRAAQALESAMQAH*
Ga0062389_10157955413300004092Bog Forest SoilYMDEKKWKEAEAQIPQVAQIIENVAAGIDKAAADFETALPPKR*
Ga0062595_10086813823300004479SoilYGAKPIAAVREYMDEKKWKEADAQIPQVAQAIENAAAGINKAAEDLENVQTR*
Ga0065715_1115457513300005293Miscanthus RhizosphereAAVREYMDEKKWKEAEVQIPGVAKIIETAAGGINQAAEELEKSVAQTH*
Ga0066388_10077899613300005332Tropical Forest SoilMDEKKWKEAEGQVPRVAQVIENVASGINQCADDLETLLPPQR*
Ga0066388_10249802823300005332Tropical Forest SoilMDEKKWKEAEGQVPQVAQVIENVAAGINRCGDELEALMAPQR*
Ga0070674_10222833123300005356Miscanthus RhizosphereGAKPIAAVREYMDEKKWTEADGQVPQVAEIITRVAAGINQAADDLEKAVGRN*
Ga0070673_10060620913300005364Switchgrass RhizosphereIAAVREYMDEKKWKEAEVQIPGVAKIIETAAGGINQAAEELEKSVAQTH*
Ga0070703_1028200813300005406Corn, Switchgrass And Miscanthus RhizosphereAVREYMDAKKWKEADAQIPQVAQVLENVAAGINKAAEDLQNAQTH*
Ga0070709_1075508323300005434Corn, Switchgrass And Miscanthus RhizospherePIAAVREYLDEKKWKEADEQIPMVADVIDHVAAGIDKAAADLESALGK*
Ga0070714_10144000323300005435Agricultural SoilREYMDEKKWKEADAQIPGVAHVIENVAAGINKAADDLESAVSRQH*
Ga0070711_10140737513300005439Corn, Switchgrass And Miscanthus RhizosphereAVREFMDEKKWKEADEQIPMVADVIDHVSAGIDKAAGDLENAVGK*
Ga0066681_1001763543300005451SoilGYGAKPIAAVREYMDEKKWKGADEQIPQVAKIIESVSAGIEKAAQDIDGVLPQTP*
Ga0066687_1059514923300005454SoilREFMDEKKWKEADEQIPMVADVIDHVSAGIDKAAADLENVVGK*
Ga0070679_10206187313300005530Corn RhizosphereAVREYMDEKKWKEAEAQIPQVAQVIENVAAGINKAADDLQSAQSH*
Ga0070693_10062832613300005547Corn, Switchgrass And Miscanthus RhizosphereGYGAKPIAAVREYMDEKKWKEAEEQVPGVAKVIETAAGGINQAADDLEKAITQVH*
Ga0070664_10206559813300005564Corn RhizosphereEFMDEKKWKEADEQIPMVADVIDHASAGIDKAAEDLENAVGK*
Ga0066703_1052564913300005568SoilGAKPVAAVREFMDEKKWKEADEQIPMVADVIEHVSAGIDKAAADLENAVGK*
Ga0068854_10204317723300005578Corn RhizosphereREYMDEKKWKEADAQIPQVAQVIENVAGGINKAAADLESLTREH*
Ga0070761_1101604523300005591SoilGAKPIAAVREYMDQERWKEAEAQVPIVGQVLENVAAAIGKAAEDMERAASRAQ*
Ga0070762_1094984813300005602SoilIAAVREYMDEKKWREAEAQVPQVAQVIENVAAGIGKAADDLEKAVARSQ*
Ga0070764_1016174923300005712SoilGYGAKPIAAVREYMDEKRWRDAEAQVPQVARAIEGAAAAVDKAAADFEGELAHLP*
Ga0070764_1058061213300005712SoilVREYMDEKKWKEADAQIPGVAQIIEKIAGGINKAADDLEAAMPKS*
Ga0070764_1071400113300005712SoilGAKPIAAVREYLDEKKWGEAEGQVPQVAHVIENVAAGIDKAAQDFEAALLPAR*
Ga0066787_1005103413300005950SoilVREYMDEKKWKEAEGQVPQVAQVIENVAAGMNKAADDLESAVSQH*
Ga0066789_1003020013300005994SoilIAAVREYMDEKKWTEADGQVPQVSQIIESAAAGIDKAAADFERELRRGHD*
Ga0070717_1049209813300006028Corn, Switchgrass And Miscanthus RhizosphereAKPVAAVREFMDEKKWNDADQQIPMVAEVIDHVSAGIDKAAGDLESAVGK*
Ga0070717_1051396023300006028Corn, Switchgrass And Miscanthus RhizosphereIAAVREYMDEKKWKEADAQIPGVAHVIENVAAGINKAADDLESAVSR*
Ga0075029_10093687813300006052WatershedsEYMDQKKWKEADAEVPGVAKVIDDAAAAIGKAADDLASGR*
Ga0070765_10001233453300006176SoilAKPVAAVREYMDEKKWSEADAQIPMVAHVIENIAAGITKAADDLDAAVQRKK*
Ga0070765_10088865923300006176SoilVHEYMDEKKWKEADAQIPQVALIIDNVAGGIDKAAADFETALAQKR*
Ga0070765_10216851113300006176SoilAKPIAAVREYMDAKKWTEAEAQVPSVAKVLEDVAAAIGRAADNLEAATSSAH*
Ga0066660_1078706413300006800SoilAKPIAAVREYMDEKKWKEADAQIPGVAQVIENVAAGISKAADDLDSAVSRQY*
Ga0079220_1141843523300006806Agricultural SoilAAVREFMDEKKWKEADEQIPMVADVIDHVSAGIDKAAGDLENAVGK*
Ga0075425_10155313113300006854Populus RhizosphereGYGAKPIAAVREYMDQKKWTEADGQVPQVAQVIERVAGGINKAAEDLEKAVGQAH*
Ga0075434_10252140313300006871Populus RhizosphereAKPIAAVREYMDQKKWTEADAQVPMVGTVLEQVGAAIGKAAENLDQQVNRKP*
Ga0104322_13084213300007819Permafrost SoilYGAKPIAAVREYMDEKKWKEADAQIPGVSQTIENVAAGVNKAADDLESAVSR*
Ga0105251_1046313623300009011Switchgrass RhizosphereREYMDEKKWKEAEAQIPQVAQVIENVAAGINKAADDLQNAH*
Ga0105247_1095911823300009101Switchgrass RhizosphereMDAKRWKEADGQIPQVAQVIETAAAGIGKAADDLESAIAQLK*
Ga0116218_152445723300009522Peatlands SoilAAVREYMDEKKWTEAESQVPQVAQVIENVATGINKAADDLEKAVAQAR*
Ga0116106_117336913300009645PeatlandPVAAVREYMDEKKWQEAEAQVPQVAKVIENAAAGINKAAEDFEAAMSQ*
Ga0116227_1018568623300009709Host-AssociatedAVREYMDEKKWREAEGQVPQVAQVIENAAAGIERAAQDFDAELMKP*
Ga0116227_1134685413300009709Host-AssociatedTGYGAKPIAAVREYMDQKKWREAEGQVPQVAQVIDAAAAGIEKAATDFERAMADTT*
Ga0116226_10005664123300009787Host-AssociatedGYGAKPIAAVREYMDQREWLKAEGQVPQVAEVVTNAATTIDKAAEDLEAALAP*
Ga0123355_1024946633300009826Termite GutAAVREYMDEKKWKEADAQIPQVAQVIENAAAGMDKAAQDLEGVLAKRHP*
Ga0116223_1086342913300009839Peatlands SoilPIAAVREYIDQEKWQEADAQVPIVGQVLENVAVAIGKAADDLEKAVGQE*
Ga0126373_1000981473300010048Tropical Forest SoilPVAAVREFMDAKKWKEADEQIPMVAGVIDQVSAGIDKAAGDLENAVGK*
Ga0123356_1410549813300010049Termite GutKEADEQIPQVAQVIENAAAGVDKAAQDLEGVLAQRH*
Ga0126377_1350980723300010362Tropical Forest SoilGAKPIAAVREYMDEKKWKEAEAQIPGVAKIIETAAGGMNQAAEDFEKALAQTH*
Ga0136449_10443865213300010379Peatlands SoilKPIAAVREYMDAKKWAEAEAQVPGVGKVLEDVAAAIGRAADNLEAATSSAH*
Ga0126383_1136327813300010398Tropical Forest SoilREFMDEKKWKDADAQIPTVAEVIAKISVGIEKAATDLESAAGK*
Ga0137389_1070142723300012096Vadose Zone SoilVREYMDEKKWKQADEQIPQVAQAIENAAAGINKAAEDLENAQTR*
Ga0137388_1177029413300012189Vadose Zone SoilREYMDEKKWKEADAQIPQVAQAIENAAAGINKAAEDLENAQTR*
Ga0137385_1105263733300012359Vadose Zone SoilAAVREYMDEKKWKEADEQIPVVADVIDHVSAGIDKAAGDLESAVGK*
Ga0164301_1101504523300012960SoilDEKKWKEADAQIPQVAQVIENVAGGINKAAADLESLTREH*
Ga0164304_1082980413300012986SoilTGYGAKPVAAVREFMDEKKWKEADEQIPMVADVIDHVSAGIDKAARDLEKAVGK*
Ga0157372_1035323313300013307Corn RhizosphereAKPVAAVREFMDEKKWKEADEQIPMVADVIDHVSAGIDKAAADLESAAGK*
Ga0120127_1011881223300013503PermafrostEKKWKEAEGQVPQVAEVIENVARGVGKAASDLEQAAQKQ*
Ga0181532_1009299813300014164BogREYMDQKKWKEAEAQVPQVAQVLANVAAGIDKAAADLESGLPKAH*
Ga0181523_1023332323300014165BogEYMDEQKWREAEAQVPQVAEVIERAAAGIKKAAEDFENQMAHGR*
Ga0181523_1064219113300014165BogAVREYMDREKWKEADAQIPLVGQVLENVAAAIGKAADDLEQAVNQRP*
Ga0181531_1053354413300014169BogPIAAVREYMDEKKWREAEAQVPQVAQVIENVATGISKAADDLEKAVAEGR*
Ga0181537_1015519023300014201BogPIAAVREYMDEKKWIEAEAQVPQVAEVIENIATGIGKAADDLEKAVAQSPGSDSSCR*
Ga0163163_1128611213300014325Switchgrass RhizosphereYMDAKRWKEADGQIPQVAQVIETAAAGIGKAADDLESAIAQLK*
Ga0182014_10003897103300014491BogMDEKKWHEADAQIPQVSHVIESVAAGIDAAAADLERELAAERSTPG*
Ga0182016_1079512713300014493BogREYMDERRWRDAEAQVPQVAAAIDSAAAAIDKAAADVEGNLARLP*
Ga0182019_1081229313300014498FenGAKPIAAVREYMDEKKWAEADAQIPGVAEVITRVAAGINKAADDLQNVGK*
Ga0182030_1132316313300014838BogTGYGAKPIAAVREYMDERRWRDAEAQVPQVARAIENAAAAVDKAAGDLEGDLARLH*
Ga0180086_119696213300014883SoilAVREYMDEKKWKEAEEQVPQVAEVIDNVAAGIGKAADALEGAVGAANPHDAGRQP*
Ga0157376_1047214623300014969Miscanthus RhizosphereVREYMDEKKWKEAEVQIPGVAKIIETAAGGINQAAEELEKSVAQTH*
Ga0167631_102463523300015168Glacier Forefield SoilMDEKKWTEADEQIPGVAEVITRVAAGVNQAADDLEKAVGKPGN*
Ga0134072_1014563313300015357Grasslands SoilVREFMDEKKWKEADEQIPMVADVIDRVSAGIDKAAADLENAVGK*
Ga0182040_1179193723300016387SoilGAYSGYSARPIAAVREYMDQEKWNEAGDQVPMVGQVLDNVARAIAKTADDLEKGMTEGH
Ga0187879_1053281523300017946PeatlandVRAYMDEKKWAEAEAQAPQVSQVIESVAAGIDKAAADLENATADVR
Ga0187778_1001741073300017961Tropical PeatlandGYGAKPIAAVREYMDEKKWSEADAQIPGVGKIFEDVAAAIGKAADDLESPAGH
Ga0187872_1040109813300018017PeatlandIAAVREYMDQEKWKEAESQVPVVGQVLENVAVAIGKAADDLEKAVAHGQ
Ga0187875_1073556813300018035PeatlandYMDEKKWAEAEAQVPQVSRVIESVAAGIDTAAADIEHATADTH
Ga0187862_1077175113300018040PeatlandGAKPIAAVREYMDQEKWKEADAQVPMVGQVLENVAAAIGKAADDLEKAVGQGQ
Ga0187871_1012722633300018042PeatlandYGAKPIAAVREYMDQEKWKEADAQIPMVGQVLENVAAAIDKAADDLEKATTHAQ
Ga0187871_1076117313300018042PeatlandKPIAAVREYMDQEKWKEADAQVPMVGQVLESVASAIDKAASDLEKAATNAQ
Ga0187859_1070466523300018047PeatlandYGAKPIAAVREYMDEKKWAEAEAQAPQVSQVIESVAAGIDKAAADLENATADVR
Ga0187766_1047241213300018058Tropical PeatlandSARPIAAVREYMDQDKWHEAGDQVPMVGQVLENVARAIAKTADDLEKGIAEGH
Ga0187772_1043557213300018085Tropical PeatlandYGAKPIAAVREYMDQEKWKEADAQVPMVGQVLENVSAAIGKAADDLEKAEGQGR
Ga0066667_1227973813300018433Grasslands SoilKPVAAVREFMDEKKWKEADEQIPMVADVIDRVSAGIDKAAADLENAVGK
Ga0066669_1015641133300018482Grasslands SoilAAVREYMDEKKWKEAETQVPGVAKVIETAAGGINQAADNLEKAIAQVH
Ga0066669_1045810313300018482Grasslands SoilPIAAVREYMDEKKWKEADEQIPQVAKIIESVSAGIEKAAQDIEGVLPQTP
Ga0210401_1064526723300020583SoilANGNGNFRTEKPIAAVREYMDEQKWNEAGAQIPQVAQAIENAAAGINKAAQDFEQGLAQV
Ga0210388_1001918513300021181SoilAKPIAAVREYMDQKKWKEAEAQIPMVAQVIENIAGGINKAADDLEAVVAKH
Ga0210388_1030883033300021181SoilAKPIAAVREYMDAKKWTEAEAQVPSVAKVLEDVAAAIGRAADNLEAATSSAH
Ga0210388_1045505713300021181SoilGAKPVAAVREYMDEKKWQQADAQIPMVAQVIANIAGGINKAAADLDAGLEQKR
Ga0213876_1010771533300021384Plant RootsGYGAKPVAAVREYMDEKKWTEAEGQVPQVARVLENVAAGIDKAADDFEKALRR
Ga0210393_1044550913300021401SoilVHEYTDEKKWKEAEAQIPGVAQTIENVAAGIDKAAADFEMALAQKR
Ga0210397_1001854053300021403SoilTIAAVREYLDEKKWSEAEGQVPQVAHVIENVAAGIDKAAQDFEAAMVPAR
Ga0210389_1098980413300021404SoilTGYGAKPVAAVREYMDEKKWSEADAQIPMVAHVIENIAAGITKAADDLDAAVQRKK
Ga0210391_1120677333300021433SoilAVREYMDEKKWQQADAQIPMVAQVIANIAGGINKAAADLDAGLEQKR
Ga0187846_1010806213300021476BiofilmKPIAAVREYMDEKKWKEAEAQIPGVAAVIENVAGGIGKAADDLEAALAQKR
Ga0126371_1345574513300021560Tropical Forest SoilTIAAVHEYMDEKKWKEAEGQVPQVAQVIENVAAGINKCADDLETLVAPQR
Ga0126371_1380791313300021560Tropical Forest SoilKPVAAVREFMDEKKWNEADEQIPTVADVIGQVSAGIDKAAEDLETAVGK
Ga0242663_108689213300022523SoilAKPIAAVREYMDQEKWKEADAQVPMVGQVLEHVAAAIDRVADELEKATTHAQ
Ga0242671_103586513300022714SoilTGYGAKTVAAVHEYMDEKKWKQAEAQIPQVAQIIENVAAGIDKAAADFEAALPPKR
Ga0242666_101752713300022721SoilAKPVAAVREYMDEKKWQEADAQIPMVAQVVENIAGGISKAAKDLDAALATKK
Ga0242654_1036844213300022726SoilIAAVREYMDEKKWAEAEAQVPTVAKVLQDVAAAIDKAAADLGPADSSAH
Ga0224561_100552413300023030SoilYTGYGAKPVAAVREYMDEKKWQQADAQIPMVAHVIENIAGGISKAAADLDAAVKPKQ
Ga0224564_105913513300024271SoilIAAVREYMDEKRWREAEGQVPQVAQVIENVAAGIDKASSDLEGALSALQIGPASK
Ga0208686_108756513300025500PeatlandPVAAVREYMDEKKWQEAEAQVPQVAKVIENAAAGINKAAEDFEAAMSQ
Ga0208457_1002980123300025812PeatlandKPIAAVREYMDQEKWNEADAQVPLVGQVLENVAAAIGKAADDLEKALRTSGVIAVTK
Ga0207664_1109687323300025929Agricultural SoilKPVAAVREYMDEKKWKEADAQIPLVAEVIDHISAGINKAADDLESSVSAKQ
Ga0207644_1170857213300025931Switchgrass RhizosphereAVREYMDQKRWREAETQVPMVAEVLANVAAGIDRAAVTLEQALAPSAKAGN
Ga0207665_1088623713300025939Corn, Switchgrass And Miscanthus RhizosphereVREYMDQKKWKEADAQIPMVAGVLEKVAAAIDEASGELEKVSGQ
Ga0207711_1155094413300025941Switchgrass RhizosphereGYGAKPIAAVREYMDQKKWTEADGQVPQVAQVIERVAGGINKAAEDLEKAVGQAH
Ga0207698_1248022913300026142Corn RhizosphereKKWTEADGQVPQVAQVIERVAGGINKAAEDLEKAVGQAH
Ga0209687_131110313300026322SoilPVAAVREFMDEKKWKEADEQIPMVADVIDHVSAGIDKAAADLENVVGK
Ga0209736_109750813300027660Forest SoilKPIAAVREYMDEKKWAEAEAQVPTVAKVLQDVAAAIDKAAADLGPADSSAH
Ga0209038_1001254543300027737Bog Forest SoilEYMDEKKWKEAEAQIPQVAQIIENVSAGIDKAAGDFEAALAERH
Ga0209655_1010090523300027767Bog Forest SoilKPIAAVREYMDEKRWREAEGQVPQVAQVIENVAAGIDKASSDLEGALALQIGPASK
Ga0209448_1014828413300027783Bog Forest SoilGYGAKPIAAVREYLDEKKWGEAEGQVPQVAHVIENVAAGIDKAAQDFEAAMVPAH
Ga0209773_1000122383300027829Bog Forest SoilGYGAKTVAAVHEYMDEKKWKEAEAQIPQVAQIIENVSAGIDKAAGDFEAALAERH
Ga0209611_1021613113300027860Host-AssociatedYGAKPIAAVREYMDEKKWHEAEGQVPQVSHVIEAVAAGVDKAAQDFEVAIAATGGRH
Ga0209169_1021002713300027879SoilAAVREYMDEKKWKEADAQIPGVAQIIEKIAGGINKAADDLEAAMPKS
Ga0209068_1069595123300027894WatershedsYMDEKKWKEADAQIPQVAQVIENAAAGISKAADDLENVVAQVH
Ga0209624_1100896523300027895Forest SoilTGYGAKPIAAVREYMDQERWKEAEAQVPIVGQVLENVAAAIGKAAEDMERAASRAQ
Ga0209069_1096405523300027915WatershedsMDEKKWKEADAQVPGVAKVIETAAGGINQAADDLEKAVAQVH
Ga0302144_1025221923300028560BogAAVREFMDEKRWTEAEAQVPQVSQVIESAAAGIDKAAGDLERAIDAH
Ga0307282_1032138113300028784SoilAKPIAAVREYMDEKKWKEAEAQIPQVAEVIEKVAAGINKAADDLQSAQSH
Ga0302229_1020458113300028879PalsaAVREYMDEKRWREAEGQVPQVAQVIENVAAGIDKAAADFEGALRALRDGAASR
Ga0302229_1046755713300028879PalsaAVREYMDEKRWREAEGQVPQVAQVIENVAAGIDKAASDLQGALFALQIGAASK
Ga0308309_1173359613300028906SoilYMDEKKWKEAEAQVPQVAVAIENAAAGIGKAADELDSAVMQTH
Ga0311369_1116777813300029910PalsaVREYMDEKKWREAEGQVPEVAQVLENVAAGIDKAAADFETEITNKH
Ga0311361_1010820223300029911BogREYMDEKKLKEAEAQVPSVAQVIENAAAGIDKAASDLESAVGQK
Ga0311361_1042099313300029911BogYGAKPIAAVREYMDEKKWREAEAQVPRVARAIDGAAAGIDKAAADFESALPPAATTHAAP
Ga0311361_1099608223300029911BogGYGAKPIAAVREYMDEKKWTEADAQIPQVSQVINNVAAGIDKAALDIETALKRGR
Ga0311361_1142507923300029911BogAAVREYMDEKKWHEAEGQVPQVAEVISHVAAGIDKAAQALEAAVPQS
Ga0311371_1260661413300029951PalsaKPIAAVREYMDQEKWKEADAQVPVVGQVLENVAAAIGKAADDLEKAEHAQ
Ga0311342_1103272213300029955BogIAAVREYMDERRWRDAEAQVPQVARAIEDAAAAVDKASGDLEGDLARLH
Ga0302274_1000984413300030041BogTGYGAKPIAAVREYMDQEKWQEAEAQVPIVGQVLENAATAIGEAADDLEKAVAAGK
Ga0311357_1045173213300030524PalsaPIAAVREYMDEKRWREAEGQVPQVAQVIENVAAGIDKAAADFEGALRALRDGAASR
Ga0210257_1106157823300030549SoilLILREYMDEKKWQQAAAQIPMVAHVIENIAGGISKAAADLDAAVKPKQ
Ga0311355_1124056923300030580PalsaAVREYMDEKKWTQADGQIPQVSKVLENVSAGIEKAAADFEHELKSIN
Ga0265461_1186171823300030743SoilGYGAKPLAAVREYMDEKKWAEADAQVPGVAKVLEDVAAEIGKAADELDSATAGR
Ga0265762_114806313300030760SoilKTVAAVHEYMDEKKWKEAEAQIPGVAQTIENVAAGIDKAAADFEMALAQKR
Ga0302308_1039521313300031027PalsaYGAKPIAAVREYMDEKRWREAEAQVPQVAQVIENVAAGIDKAAADFEGALRALRDGAASR
Ga0170824_10691455913300031231Forest SoilAVREYMDEKKWTEAEGQVPQVSRVIETVAAGIDKAADDFESALAQVH
Ga0265330_1038865623300031235RhizosphereIAAVREYMDEKKWKEAEAQVPHVAQVLENVAAGIGRAAEALESAVREGH
Ga0302324_10061573313300031236PalsaKPIAAVREYMDEKKWIEAEAQVPQVAEVIENIATGIGKAADDLEKAVAQSPGSDSSCR
Ga0170818_10008090813300031474Forest SoilAAVREYMDQKKWAEAEAQIPTVAQVIEKIAAGINHAADDLESAVAKH
Ga0311364_1165903813300031521FenKPIAAVREYMDEKKWKEAEGQVPQVSQIIEQVAAGIDKAAEALEKAAAEAP
Ga0302326_1236646813300031525PalsaAYTGYDARPIAAVREYMDEKKWKEADAQVPQVSEVVANVAAGIGKAADELGAAVARGR
Ga0307475_1136061913300031754Hardwood Forest SoilEYMDEKKWKEADAQIPGVAQVIENAAAGINKAADELESAVSQTH
Ga0307478_1001927733300031823Hardwood Forest SoilAKTVAAVHEYMDEKKWKEAEAQIPGVAQTIENVAAGIDKAAADFEMALAQKR
Ga0308175_10190696013300031938SoilTGYGAKPIAAVREYMDQRKWKEADAEIPGIGKVLQQEAASIDKAADDLGKAK
Ga0308176_1006071713300031996SoilKKWKEADEQIPMIADVIDHVSAGIDKAAGDLENVVGK
Ga0306922_1226028013300032001SoilAPVREFMDEKKWKEADAQIPTVADVIDHVSAGIDKAAEDLETAIGK
Ga0348332_1016567323300032515Plant LitterAAVREYMDEKKWQEADAQIPMVATVIENIAGGISKAASDLDAALKAKQ
Ga0335082_1046519923300032782SoilKPIAAVREYMDAKKWKDAEAQVPGVAQVLENVAAGIGKAADDLEKAVAKGR
Ga0335077_10012091113300033158SoilYGAKPIAAVREYMDAKKWKEADAQIPQVAQVIENVAAGINKAADDLEASVTREH
Ga0310811_1093814013300033475SoilGAKPVAAVREFMDEKKWKEADEQIPMVADVIDHVSAGIDKAAGDLENAVGK
Ga0316215_100766223300033544RootsGAKTVAAVHEYLDEKKWKEAEAQIPQVAQIIENVAAGIDKAAADFETALAEKR
Ga0314866_094225_400_5283300033807PeatlandMDEKKWKEADAQIPQVAEIVENVATGISKAADDLEKAVTRAR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.