Basic Information | |
---|---|
Family ID | F039716 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 163 |
Average Sequence Length | 42 residues |
Representative Sequence | MESTLTGPILYLLIAWGIVTAVFLVLLIWRSLLESHEDDQIFLD |
Number of Associated Samples | 141 |
Number of Associated Scaffolds | 163 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 97.55 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 92.02 % |
Associated GOLD sequencing projects | 128 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (74.847 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.926 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.902 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.307 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.78% β-sheet: 0.00% Coil/Unstructured: 47.22% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 163 Family Scaffolds |
---|---|---|
PF00106 | adh_short | 7.98 |
PF13561 | adh_short_C2 | 3.07 |
PF00775 | Dioxygenase_C | 2.45 |
PF07238 | PilZ | 1.84 |
PF01139 | RtcB | 1.23 |
PF02687 | FtsX | 1.23 |
PF07589 | PEP-CTERM | 1.23 |
PF01904 | DUF72 | 1.23 |
PF00248 | Aldo_ket_red | 1.23 |
PF00486 | Trans_reg_C | 1.23 |
PF09411 | PagL | 0.61 |
PF13407 | Peripla_BP_4 | 0.61 |
PF02894 | GFO_IDH_MocA_C | 0.61 |
PF12704 | MacB_PCD | 0.61 |
PF00430 | ATP-synt_B | 0.61 |
PF01590 | GAF | 0.61 |
PF00589 | Phage_integrase | 0.61 |
PF13377 | Peripla_BP_3 | 0.61 |
PF02371 | Transposase_20 | 0.61 |
PF15780 | ASH | 0.61 |
PF01738 | DLH | 0.61 |
PF03781 | FGE-sulfatase | 0.61 |
PF13276 | HTH_21 | 0.61 |
PF00583 | Acetyltransf_1 | 0.61 |
PF03551 | PadR | 0.61 |
PF00092 | VWA | 0.61 |
PF01642 | MM_CoA_mutase | 0.61 |
COG ID | Name | Functional Category | % Frequency in 163 Family Scaffolds |
---|---|---|---|
COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.45 |
COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 1.23 |
COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 1.23 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.61 |
COG0711 | FoF1-type ATP synthase, membrane subunit b or b' | Energy production and conversion [C] | 0.61 |
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.61 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.61 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.61 |
COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.61 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.61 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.85 % |
Unclassified | root | N/A | 25.15 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459005|F1BAP7Q01A207L | Not Available | 505 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101768400 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_104446217 | Not Available | 501 | Open in IMG/M |
3300000559|F14TC_100383990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1849 | Open in IMG/M |
3300000789|JGI1027J11758_12584935 | Not Available | 575 | Open in IMG/M |
3300001174|JGI12679J13547_1014124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300002906|JGI25614J43888_10015969 | All Organisms → cellular organisms → Bacteria | 2410 | Open in IMG/M |
3300004082|Ga0062384_100799077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 659 | Open in IMG/M |
3300004092|Ga0062389_104447564 | Not Available | 527 | Open in IMG/M |
3300004152|Ga0062386_100793606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
3300004152|Ga0062386_101729132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 522 | Open in IMG/M |
3300004479|Ga0062595_102227852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300004635|Ga0062388_102953685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 502 | Open in IMG/M |
3300005162|Ga0066814_10107044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300005436|Ga0070713_101409971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
3300005437|Ga0070710_11294816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300005537|Ga0070730_10178294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1427 | Open in IMG/M |
3300005541|Ga0070733_10315076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1034 | Open in IMG/M |
3300005541|Ga0070733_10765937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 648 | Open in IMG/M |
3300005554|Ga0066661_10327683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
3300005602|Ga0070762_10957051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300005610|Ga0070763_10549321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 665 | Open in IMG/M |
3300005614|Ga0068856_101067139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 825 | Open in IMG/M |
3300005712|Ga0070764_10278334 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300006102|Ga0075015_100709031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300006102|Ga0075015_101021584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300006162|Ga0075030_101273876 | Not Available | 577 | Open in IMG/M |
3300006176|Ga0070765_101634840 | Not Available | 605 | Open in IMG/M |
3300006797|Ga0066659_11048718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_61_5 | 681 | Open in IMG/M |
3300006800|Ga0066660_10958101 | Not Available | 692 | Open in IMG/M |
3300006903|Ga0075426_11547494 | Not Available | 504 | Open in IMG/M |
3300007788|Ga0099795_10395133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300009012|Ga0066710_101746397 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
3300009038|Ga0099829_11691471 | Not Available | 520 | Open in IMG/M |
3300009088|Ga0099830_10280272 | Not Available | 1326 | Open in IMG/M |
3300009088|Ga0099830_10667305 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300009088|Ga0099830_11238360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
3300009519|Ga0116108_1189018 | Not Available | 606 | Open in IMG/M |
3300009520|Ga0116214_1305974 | Not Available | 610 | Open in IMG/M |
3300010322|Ga0134084_10398504 | Not Available | 536 | Open in IMG/M |
3300010326|Ga0134065_10494367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300010359|Ga0126376_13062151 | Not Available | 517 | Open in IMG/M |
3300010396|Ga0134126_11491370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 746 | Open in IMG/M |
3300010880|Ga0126350_12013043 | Not Available | 574 | Open in IMG/M |
3300011269|Ga0137392_11202346 | Not Available | 616 | Open in IMG/M |
3300011270|Ga0137391_10497047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1033 | Open in IMG/M |
3300012189|Ga0137388_11397575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
3300012198|Ga0137364_10045792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2890 | Open in IMG/M |
3300012200|Ga0137382_10576619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
3300012203|Ga0137399_10258361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
3300012207|Ga0137381_10861691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
3300012208|Ga0137376_10241661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1565 | Open in IMG/M |
3300012210|Ga0137378_11318678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
3300012211|Ga0137377_11173169 | Not Available | 698 | Open in IMG/M |
3300012359|Ga0137385_11118752 | Not Available | 648 | Open in IMG/M |
3300012361|Ga0137360_10238042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1490 | Open in IMG/M |
3300012362|Ga0137361_11023741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
3300012582|Ga0137358_10073522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2297 | Open in IMG/M |
3300012683|Ga0137398_11169321 | Not Available | 527 | Open in IMG/M |
3300012685|Ga0137397_10832560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
3300012685|Ga0137397_11313410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300012918|Ga0137396_10170269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1593 | Open in IMG/M |
3300012923|Ga0137359_10134686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2198 | Open in IMG/M |
3300012923|Ga0137359_10471784 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300012923|Ga0137359_11313890 | Not Available | 611 | Open in IMG/M |
3300012924|Ga0137413_11211891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300012927|Ga0137416_10161713 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
3300012927|Ga0137416_11726191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300012929|Ga0137404_11108235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
3300012930|Ga0137407_11754584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 592 | Open in IMG/M |
3300012972|Ga0134077_10437873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300013308|Ga0157375_11857790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
3300014166|Ga0134079_10085178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1180 | Open in IMG/M |
3300015357|Ga0134072_10408860 | Not Available | 537 | Open in IMG/M |
3300015371|Ga0132258_11261056 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
3300016341|Ga0182035_10379675 | Not Available | 1182 | Open in IMG/M |
3300016341|Ga0182035_12087423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 515 | Open in IMG/M |
3300016357|Ga0182032_10754856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
3300016357|Ga0182032_10934247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 738 | Open in IMG/M |
3300016371|Ga0182034_10032977 | All Organisms → cellular organisms → Bacteria | 3256 | Open in IMG/M |
3300016387|Ga0182040_11922129 | Not Available | 508 | Open in IMG/M |
3300016422|Ga0182039_10174400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1691 | Open in IMG/M |
3300017924|Ga0187820_1169009 | Not Available | 668 | Open in IMG/M |
3300017928|Ga0187806_1386041 | Not Available | 504 | Open in IMG/M |
3300017929|Ga0187849_1081070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 1416 | Open in IMG/M |
3300017930|Ga0187825_10179754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
3300017933|Ga0187801_10460513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300017974|Ga0187777_11137563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
3300017975|Ga0187782_11216865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
3300017999|Ga0187767_10266051 | Not Available | 571 | Open in IMG/M |
3300018006|Ga0187804_10570482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
3300018012|Ga0187810_10292083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
3300018088|Ga0187771_10919816 | Not Available | 742 | Open in IMG/M |
3300018088|Ga0187771_11234815 | Not Available | 634 | Open in IMG/M |
3300018090|Ga0187770_10285825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1282 | Open in IMG/M |
3300018090|Ga0187770_10772902 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 768 | Open in IMG/M |
3300018090|Ga0187770_10977277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
3300018433|Ga0066667_11318057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
3300020034|Ga0193753_10292113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 705 | Open in IMG/M |
3300020199|Ga0179592_10009326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4227 | Open in IMG/M |
3300020579|Ga0210407_10155851 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
3300020581|Ga0210399_10264174 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
3300020581|Ga0210399_11187523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
3300020583|Ga0210401_11076469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 662 | Open in IMG/M |
3300021088|Ga0210404_10166431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1165 | Open in IMG/M |
3300021088|Ga0210404_10333214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
3300021171|Ga0210405_10949482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
3300021401|Ga0210393_11539427 | Not Available | 528 | Open in IMG/M |
3300021405|Ga0210387_10949618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 755 | Open in IMG/M |
3300021406|Ga0210386_10659321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
3300021407|Ga0210383_10937327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
3300021420|Ga0210394_11291327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
3300021432|Ga0210384_11061710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
3300021474|Ga0210390_11570721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300021475|Ga0210392_10152279 | Not Available | 1581 | Open in IMG/M |
3300021559|Ga0210409_11392321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
3300021560|Ga0126371_12225648 | Not Available | 662 | Open in IMG/M |
3300024288|Ga0179589_10571259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300025898|Ga0207692_10588301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 714 | Open in IMG/M |
3300025919|Ga0207657_11453882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
3300025928|Ga0207700_10909522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
3300025938|Ga0207704_10188568 | Not Available | 1498 | Open in IMG/M |
3300026319|Ga0209647_1207178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
3300026320|Ga0209131_1341233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
3300026532|Ga0209160_1078130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1756 | Open in IMG/M |
3300026551|Ga0209648_10344000 | Not Available | 1031 | Open in IMG/M |
3300027070|Ga0208365_1041274 | Not Available | 615 | Open in IMG/M |
3300027591|Ga0209733_1059469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
3300027591|Ga0209733_1122965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
3300027643|Ga0209076_1083928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 906 | Open in IMG/M |
3300027660|Ga0209736_1010301 | All Organisms → cellular organisms → Bacteria | 3000 | Open in IMG/M |
3300027846|Ga0209180_10210373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1121 | Open in IMG/M |
3300027857|Ga0209166_10001974 | All Organisms → cellular organisms → Bacteria | 16169 | Open in IMG/M |
3300027862|Ga0209701_10043492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2898 | Open in IMG/M |
3300027862|Ga0209701_10583763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
3300027875|Ga0209283_10333724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
3300027910|Ga0209583_10198267 | Not Available | 855 | Open in IMG/M |
3300028047|Ga0209526_10104896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1988 | Open in IMG/M |
3300028047|Ga0209526_10157886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1587 | Open in IMG/M |
3300028145|Ga0247663_1023738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
3300028536|Ga0137415_10797885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
3300028906|Ga0308309_11547103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
3300031057|Ga0170834_102578329 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10043736 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
3300031573|Ga0310915_10769357 | Not Available | 678 | Open in IMG/M |
3300031740|Ga0307468_101845799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300031748|Ga0318492_10609638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 583 | Open in IMG/M |
3300031748|Ga0318492_10735347 | Not Available | 529 | Open in IMG/M |
3300031765|Ga0318554_10568301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 640 | Open in IMG/M |
3300031947|Ga0310909_11297217 | Not Available | 586 | Open in IMG/M |
3300031954|Ga0306926_12893142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300031962|Ga0307479_10305507 | Not Available | 1572 | Open in IMG/M |
3300032035|Ga0310911_10027073 | All Organisms → cellular organisms → Bacteria | 2828 | Open in IMG/M |
3300032059|Ga0318533_11396279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 511 | Open in IMG/M |
3300032076|Ga0306924_10973871 | Not Available | 933 | Open in IMG/M |
3300032782|Ga0335082_10148775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2270 | Open in IMG/M |
3300032805|Ga0335078_10842686 | Not Available | 1111 | Open in IMG/M |
3300032892|Ga0335081_10219918 | All Organisms → cellular organisms → Bacteria | 2602 | Open in IMG/M |
3300033134|Ga0335073_10900297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
3300033290|Ga0318519_10999662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 519 | Open in IMG/M |
3300033405|Ga0326727_10232940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1938 | Open in IMG/M |
3300033405|Ga0326727_10496666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1064 | Open in IMG/M |
3300034091|Ga0326724_0017234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6617 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.34% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.29% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.29% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.91% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.68% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.68% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.07% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.07% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.07% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.45% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.45% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.45% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.45% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.84% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.23% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.23% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.61% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.61% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.61% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.61% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.61% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.61% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.61% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.61% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.61% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.61% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.61% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
E41_11186050 | 2170459005 | Grass Soil | METLTGPIFYMLVAWGIVTAIFLVLLIWRSLLESHETIRSSL |
INPhiseqgaiiFebDRAFT_1017684001 | 3300000364 | Soil | MSESTLTGPVLYXLIAWGIVTAVFLALLLWRNLLESHEDD |
INPhiseqgaiiFebDRAFT_1044462171 | 3300000364 | Soil | MESTLQGPVLYLLIASGVVTAAFLALLIWRNLLEGHEDDQLFLDAGEQR |
F14TC_1003839904 | 3300000559 | Soil | MESTLTGPIFYLLIAFGIVTAVFLVLLIWRSLLESHEDDQIF |
JGI1027J11758_125849352 | 3300000789 | Soil | MDAIEGLLNGPFLYLLITWGVVTAIFLILVIWRSVLA |
JGI12679J13547_10141241 | 3300001174 | Forest Soil | METLTGPILYLLIVWGIVTATFLALLLWRSILTTHEDD |
JGI25614J43888_100159694 | 3300002906 | Grasslands Soil | MEASTLTGPILYLLIVWGIVTATFLALLLWRSILTTHEDDQLCID |
Ga0062384_1007990772 | 3300004082 | Bog Forest Soil | MEAAESAFNGPMLYVLIAWGVATAIFLLLIAWRSVLSSHEDDQIFLD |
Ga0062389_1044475641 | 3300004092 | Bog Forest Soil | MESTTLTGPVLYLLIAWGIITGIFVILFIWRSVLSSHEDD |
Ga0062386_1007936062 | 3300004152 | Bog Forest Soil | METIESVLSGPILYLLIAWGIVTAVFLALIAWRSVLTSHEDDQIFL |
Ga0062386_1017291321 | 3300004152 | Bog Forest Soil | MESVESVLQGPILYLLIVWGIVTAIFLALIAWRSVLTSHEDDQIFL |
Ga0062595_1022278521 | 3300004479 | Soil | METLTGPILYVLIAWAIVTAIFMMLLIRRSLLASHEDDQIFLDASE |
Ga0062388_1029536851 | 3300004635 | Bog Forest Soil | METLTTGPIFYVLIAWSIVTAIFMLLLIRRSLLASHEDDQIFLDAA |
Ga0066814_101070442 | 3300005162 | Soil | MGPLEYLLSGPLLYLLIVWSIATVIFIGLLIWRSLLSSHEDDQIFLDPSE |
Ga0070713_1014099711 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAIEGLLNGPFLYLLITWGVVTAIFLILVIWRSVLASHEDDQIFLDA |
Ga0070710_112948162 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MESTLTGPILYLLIAWGIVTAVFLVLLIWRSLLESHEDDQIFLD |
Ga0070730_101782943 | 3300005537 | Surface Soil | MESIQGPVLYLLIACGVVTAAFLGLLIWKSLLESHEDDQIFLGTTE |
Ga0070733_103150762 | 3300005541 | Surface Soil | MPESLSQGPIFYLLVAWGIVTAIFLVLLIWRSLLESHEDDQLF |
Ga0070733_107659372 | 3300005541 | Surface Soil | MESPTLTGPILYLLFAWGGITTIFIGLLIWRSLLTSHEGDQIFLDAAQE |
Ga0066661_103276831 | 3300005554 | Soil | MDQFLSGPLLYLLIAWGVATAVFLGLLFRRSLLSSHEDDQIFLDAAEE |
Ga0070762_109570511 | 3300005602 | Soil | METLTTGPILYVLIAWGIVTSVFMLLLIRRSLLASHEDDQIFLDAA |
Ga0070763_105493211 | 3300005610 | Soil | MDAMESTLTGPVLYLLVAWGAVTVIFIGLLIWRSLLTS |
Ga0068856_1010671392 | 3300005614 | Corn Rhizosphere | MESLHLTGPLFYLTVAWGVVTAVFIGLLIWRSLLAS |
Ga0070764_102783341 | 3300005712 | Soil | MDAMESAFSGPLLYLLIVWGVVTAVFLLLIAWRSVLSSHEDD |
Ga0075015_1007090314 | 3300006102 | Watersheds | MDRLTGPILYVLIAWGAVTAVFMMLLIRRSLLASHEDDQIFL |
Ga0075015_1010215842 | 3300006102 | Watersheds | MEMMESAFTGPMEYLLIVWGVVTAIFLLLIAWRSVLASHE |
Ga0075030_1012738761 | 3300006162 | Watersheds | MELMESVFTGPMLYLLVVWGLVTAIFLALVAWRSVLSSHEDDQIF |
Ga0070765_1016348401 | 3300006176 | Soil | METLTTGPIFYVLIAWGIVTAVFMLLLIRRSLLASHEDDQIFL |
Ga0066659_110487183 | 3300006797 | Soil | MESLNPAPIMYLLIVWGLVTAVFIVLLIRKSLLESHEDDQ |
Ga0066660_109581012 | 3300006800 | Soil | METLTGPVLYLLIAWGMVTAIFLALLLWRSILTTHEDDQL |
Ga0075426_115474941 | 3300006903 | Populus Rhizosphere | MDAIEGLLNGPFLYLLITWGVVTAIFLILVIWRSVLASHED |
Ga0099795_103951331 | 3300007788 | Vadose Zone Soil | MGETLTGPILYLLIVWGILTATFLALLLWRSILTTHEDD |
Ga0066710_1017463971 | 3300009012 | Grasslands Soil | METIQGPILYLLIAWGILTGIFILLLIWRSVLSSHEDDQIFLD |
Ga0099829_116914712 | 3300009038 | Vadose Zone Soil | MESTLQGPVLYLLIAWGIVTAVFVILFIWRSVLSSH |
Ga0099830_102802721 | 3300009088 | Vadose Zone Soil | MEATLTGPILYLLIAWGIVTAIFLALLLWRSILTTHEDDQLCIDAA |
Ga0099830_106673053 | 3300009088 | Vadose Zone Soil | MESTSLTGPLLYLLIAWGVATAAFLVLLLRRSLLASHEDDQIF |
Ga0099830_112383601 | 3300009088 | Vadose Zone Soil | MESTSLTGPLLYLLIAWGVVTAAFLVLLLRRSLLASHEDDQIFLDA |
Ga0116108_11890181 | 3300009519 | Peatland | MESVESVLQGPILYLLIVWGVVTAIFLALVAWRSVLTSHE |
Ga0116214_13059742 | 3300009520 | Peatlands Soil | METLTTGPIFYVLIAWSIVTAIFMLLLIRRSLLASHEDDQIFLDA |
Ga0134084_103985041 | 3300010322 | Grasslands Soil | MDQQLTGPLLYLLIVWGVVTAVFLVLLLRRSLLAS |
Ga0134065_104943671 | 3300010326 | Grasslands Soil | MDQQTLTGPLLYLLIVWGVVTAVFLVLLLRRSLLASHEDDQIF |
Ga0126376_130621511 | 3300010359 | Tropical Forest Soil | MESTLTGPVLYLLIAWGIVTAVFIILFIWRGVLSS |
Ga0134126_114913702 | 3300010396 | Terrestrial Soil | MDQIESTLTGPGLYLLIAWGAVTAIFIALLIWRSLLTSHEDDQ |
Ga0126350_120130431 | 3300010880 | Boreal Forest Soil | MERLTGPILYVLIAWAAVTAVFMLLLIRRSLLASHEDDQI |
Ga0137392_112023461 | 3300011269 | Vadose Zone Soil | MESLTLSGPLLYMIIAWGIVTAAFLVLWLRRSLLASHEDD |
Ga0137391_104970471 | 3300011270 | Vadose Zone Soil | METLTGPIFYMLVAWGIVTAIFLVLLIWRSLLESHEDDQIF |
Ga0137388_113975751 | 3300012189 | Vadose Zone Soil | MESQTLTGPLLYMIIAWGIVTAAFLVLWLRRSLLASHEDDQIFL |
Ga0137364_100457921 | 3300012198 | Vadose Zone Soil | MDPQTLTGPLLYLLVAWGVVTAVFLVLLLRRSLLASHEDDQ |
Ga0137382_105766191 | 3300012200 | Vadose Zone Soil | MEAQSFLSGPLLYLLIAWGVATAVFLGLLFRRSLLSSHEDDQIF |
Ga0137399_102583611 | 3300012203 | Vadose Zone Soil | MGETLTGPILYLLIVWGILTATFLALLLWRSILTTHEDDQLC |
Ga0137381_108616912 | 3300012207 | Vadose Zone Soil | MESSTLTGPIFYMLVAWGIVTAIFLVLLIWRSLLESH |
Ga0137376_102416611 | 3300012208 | Vadose Zone Soil | MDPQFLSGPLLYLLIAWGVATAVFLGLLFRRSLLSSHEDDQI |
Ga0137378_113186781 | 3300012210 | Vadose Zone Soil | MESTLHGPVLYLLIAWGIVTAVFVILFIWRSVLSSHEDDQIFI |
Ga0137377_111731691 | 3300012211 | Vadose Zone Soil | METLTGPIFYLLVAWGIVTAIFLVLLIWRSLLESHE |
Ga0137385_111187521 | 3300012359 | Vadose Zone Soil | MESTLHGPVLYLLVAWGIVTAVFVILFIWRSGLSSHE |
Ga0137360_102380423 | 3300012361 | Vadose Zone Soil | MPESLTQGPIFYLLITWAVFTAVFLALLIWRSLLESHEDDQI |
Ga0137361_110237412 | 3300012362 | Vadose Zone Soil | MEASTLTGPILYLLIVWGIVTATFLALLLWRSILTTHEDDQLC |
Ga0137358_100735221 | 3300012582 | Vadose Zone Soil | MEATLTGPILYLLIVWGIVTAIFLALLLWRSILTTHEDDQLCIDA |
Ga0137398_111693212 | 3300012683 | Vadose Zone Soil | MEVTRETLTGPILYLLIAWGVVTAIFLALLLWRSL |
Ga0137397_108325601 | 3300012685 | Vadose Zone Soil | MGETLTGPILYLLIVWGILTATFLALLLWRSILTTHEDDQLCIDAA |
Ga0137397_113134101 | 3300012685 | Vadose Zone Soil | METLTGPIFYMLVAWGIVTAIFLVLLIWRSLLESHEDDQ |
Ga0137396_101702691 | 3300012918 | Vadose Zone Soil | MEVTMETLTGPILYLLIVWGIVTAIFLGLLLWRSI |
Ga0137359_101346864 | 3300012923 | Vadose Zone Soil | MEATLTGPILYLLIVWGILVATFLALLLWRSILTTHEDDQLCIDAAGE |
Ga0137359_104717843 | 3300012923 | Vadose Zone Soil | METLTGPIFYMLVAWGIVTAIFLLLLIWRSLLESHEDDQIFIEAS |
Ga0137359_113138902 | 3300012923 | Vadose Zone Soil | MESTLQGPVLYLLIAWGIVTAVFVILFIWRSVLSS |
Ga0137413_112118911 | 3300012924 | Vadose Zone Soil | MEVTMETLTGPILYLLIVWGILTATFLALLLWRSILTTHEDDQLC |
Ga0137416_101617131 | 3300012927 | Vadose Zone Soil | MEVTMETLTGPILYLLIVWGIVTAIFLGLLLWRSILTTHEDDQ |
Ga0137416_117261911 | 3300012927 | Vadose Zone Soil | MESQTLTGPLLYLLIAWGVVTAVFLVLLLRRSLLASH |
Ga0137404_111082352 | 3300012929 | Vadose Zone Soil | METLTGPIFYMLVAWGIVTAIFLLLLIWRSLLESHEDDQIFIEASGDRMAKE |
Ga0137407_117545841 | 3300012930 | Vadose Zone Soil | MESIQGPVLYLLIACGVVTAAFLGLLIWKSLLESHEDDQIFLGTTEQHLA |
Ga0134077_104378732 | 3300012972 | Grasslands Soil | MESTLTPPVFYLLIVWGIVTSVFVILLIWRGLLSSHE |
Ga0157375_118577902 | 3300013308 | Miscanthus Rhizosphere | MSESTLTGPVLYTLIAWGIVTAVFLALLLWRNLLESHEDDQLFIDAAED |
Ga0134079_100851784 | 3300014166 | Grasslands Soil | MDPQTLTGPLLYLLIVWGVVTAVFLVLLLRRSLLASHE |
Ga0134072_104088601 | 3300015357 | Grasslands Soil | MDQQLTGPLLYLLIVWGVVTAVFLVLLLRRSLLASHED |
Ga0132258_112610561 | 3300015371 | Arabidopsis Rhizosphere | MSESTLTGPVLYTLIAWGIVTAVFLALLLWRNLLESHEDDQIFLGAA |
Ga0182035_103796752 | 3300016341 | Soil | MSESTLTGPVLYLLIAWGVVTAIFLILLIWRNLLESHEDDQIF |
Ga0182035_120874232 | 3300016341 | Soil | MDQVEELFQGTTLYLTVVWGVVTAIFLVLVAWRSVLSSHEDD |
Ga0182032_107548562 | 3300016357 | Soil | MEQLESAFSGPLLYLLISWGVVTAVFLVLIAWRSLLAS |
Ga0182032_109342472 | 3300016357 | Soil | MEQVEELFQGTTLYLTVVWGVVTAIFLVLVAWRSVLSSHEDDQIFI |
Ga0182034_100329775 | 3300016371 | Soil | MESSLTGPVLYLLVAWGIVTAIFLALLIWRNLLES |
Ga0182040_119221292 | 3300016387 | Soil | MEQVEELFQGTTLYLTVVWGVVTAIFLVLVAWRSVLSSHEDDQIF |
Ga0182039_101744001 | 3300016422 | Soil | MEAEINGPMLYLLIAWGVVTAIFLALIAWRSVLSSHED |
Ga0187820_11690091 | 3300017924 | Freshwater Sediment | MSEMESAFTGSLLYLLIAWGLVTAIFLALVAWRSVLSSHEDDQIF |
Ga0187806_13860411 | 3300017928 | Freshwater Sediment | METMESVFTGPMLYLLVVWGPVTAIFLVLVAWRSVLSSHE |
Ga0187849_10810701 | 3300017929 | Peatland | METAESVLSGPMLYLLIAWGVVTAVFIVLVAWRGVL |
Ga0187825_101797542 | 3300017930 | Freshwater Sediment | MESSLTGPVLYLLIAFGVVAALFLLLLIWRNLLESHEDDQLFLDAGEANMA |
Ga0187801_104605131 | 3300017933 | Freshwater Sediment | MELMENVFTGPMLYLLVVWGLVTAIFLVLVAWRSVLSSHEDDQIFLDA |
Ga0187777_111375631 | 3300017974 | Tropical Peatland | METTFTGPLLYLSVAWAVITAVFIGLVIWRSLLASHEDDQIFLDAA |
Ga0187782_112168651 | 3300017975 | Tropical Peatland | MDTAENMLQGPMLYLLIAWGVVTAIFIILVAWRGVLASHEDDQI |
Ga0187767_102660512 | 3300017999 | Tropical Peatland | MESTLHGPVLYLLIAWGIATLIFVILFIWRSVLSSH |
Ga0187804_105704821 | 3300018006 | Freshwater Sediment | MELMESVFTGPMLYLLVVWGLVTAIFLALVAWRSVLS |
Ga0187810_102920833 | 3300018012 | Freshwater Sediment | MPETETLLAGPMLYLLIIWGVVTAVFLALIAWRSVL |
Ga0187771_109198162 | 3300018088 | Tropical Peatland | MDAEFLLSGPMLFLLIVWGVVTAVFLGLVAWRSVLSSHEDDQIFL |
Ga0187771_112348152 | 3300018088 | Tropical Peatland | MDAESLLSGPMLFLLIVWGVVTAVFLGLVAWRSVLSSHEDDQIFL |
Ga0187770_102858253 | 3300018090 | Tropical Peatland | MNDMETVLTGPMLYLLIIWGVVTAVFLALIAWRSVLS |
Ga0187770_107729022 | 3300018090 | Tropical Peatland | MDAEFLLSGPMLFLLIVWGVVTAVFLGLVAWRSVLSSHEDDQIF |
Ga0187770_109772771 | 3300018090 | Tropical Peatland | METAENMLQGPMLYLLIAWGVVTAIFVILVAWRGVLASHEDDQ |
Ga0066667_113180572 | 3300018433 | Grasslands Soil | MDSQFLSGPLLYLLIAWGVATAVFLGLLFRRSLLSS |
Ga0193753_102921132 | 3300020034 | Soil | MDVESTLTGPISYLLIAWGVITAVFVILLVRRTLLTNHEDDQIFLDPCQ |
Ga0179592_100093261 | 3300020199 | Vadose Zone Soil | MESIQGPVLYLLIACGVVTAAFLGLLIWKSLLESHEDDQIFLGTTEQH |
Ga0210407_101558511 | 3300020579 | Soil | METLTTGPIFYVLIAWGIVTAVFMLLLIRRSLLASHEDDQIF |
Ga0210399_102641743 | 3300020581 | Soil | MGESTPLPGPLLYLLIAWGVVTAVFLVLLLRRSLLASHEDDQIFLDGAQ |
Ga0210399_111875231 | 3300020581 | Soil | MDLGQTFTGPLLYIVIAWGIVTAVFLMLFLRRSLLASHEDDQIFLDSAQE |
Ga0210401_110764691 | 3300020583 | Soil | MEAPTLAGPILYLLFAWGAITAIFIGLLIWRSLLTS |
Ga0210404_101664311 | 3300021088 | Soil | MDSQMLTGPLLYLLIAWGVVTAVFLGLLFRRSLLSSHEDDQIFLDAAE |
Ga0210404_103332141 | 3300021088 | Soil | MDAMESAFSGPLMYLLIVWGVVTAVFLLLIAWRSVLSSHE |
Ga0210405_109494821 | 3300021171 | Soil | MGEALTGPILYLLIVWGIITATFLALLLWRSILTT |
Ga0210393_115394271 | 3300021401 | Soil | METLTTGPIFYVLIAWGIVTAVFMLLLIRRSLLASHEDD |
Ga0210387_109496182 | 3300021405 | Soil | MENLESLLTGPTMWLLITWGAVTAIFLVLIAWRSLLSSHEDDQIFLDAA |
Ga0210386_106593211 | 3300021406 | Soil | MEATLTGPILYLLIVWGIITATFLALLLWRSILTTHEDDQL |
Ga0210383_109373271 | 3300021407 | Soil | MEHLTTGPIFYVLIAWTIVTAVFMLLLIRRSLLASHEDDQIFLDAAQE |
Ga0210394_112913272 | 3300021420 | Soil | MEATLTGPILYLLIVLGIVTAIFLALLLWRSILTTHEDDQLCID |
Ga0210384_110617101 | 3300021432 | Soil | MGEALTGPILYLLIVWGIITATFLALLLWRSILTTHEDDQLCIDAAGEHLA |
Ga0210390_115707211 | 3300021474 | Soil | MDAIEGLLKGPFLYLLITWGVVTAIFLLLVIWRSVLASHEDDQIFL |
Ga0210392_101522794 | 3300021475 | Soil | MDAMESTLTGPVLYLMVAWGAVTAVFVGLLIWRSLL |
Ga0210409_113923212 | 3300021559 | Soil | METTLTGPILYLLIVWGIITVVFIGLLMWRSLLASHEDDQIFL |
Ga0126371_122256482 | 3300021560 | Tropical Forest Soil | MDAIEGLLKGPFLYLLITWGVVTAIFLILVIWRSVLASHEDD |
Ga0179589_105712592 | 3300024288 | Vadose Zone Soil | METLTGPILYLLIVWGILTATFLALLLWRSILTTHEDDQL |
Ga0207692_105883011 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAMESTLTGPILYLLFAWGAITAVFIGLLIWRSLLTSHEDDQI |
Ga0207657_114538821 | 3300025919 | Corn Rhizosphere | MESLHLTGPLFYLTVAWGVVTAVFIGLLIWRSLLASHEDDQIFLD |
Ga0207700_109095222 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | METLTGPIFYMLVAWGIVTAIFLVLLIWRSLLESHED |
Ga0207704_101885683 | 3300025938 | Miscanthus Rhizosphere | MSESTLTGPVLYMLIAWGIVTAVFLALLLWRNLLE |
Ga0209647_12071782 | 3300026319 | Grasslands Soil | MDAMGAAFSGPLMYLLVVWGVVTAVFLLLIAWRSVLSS |
Ga0209131_13412331 | 3300026320 | Grasslands Soil | MGETLTGPILYLLIVWGILTATFLALLLWRSILTTHEDDQLCIDAAG |
Ga0209160_10781301 | 3300026532 | Soil | MEATLTGPILYLLIVWGILVATFLALLLWRSILTTHEDDQLCIDAAGEHMA |
Ga0209648_103440001 | 3300026551 | Grasslands Soil | MEATLTGPILYLLIAWGIVTAIFLALLLWRSILTTHEDD |
Ga0208365_10412742 | 3300027070 | Forest Soil | MDPAPLTGPLLYLLIAWGVVTAIFLVLLLRRSLLASHE |
Ga0209733_10594691 | 3300027591 | Forest Soil | MEATLTGPILYLLIVWGILVATFLALLLWRSILTTHEDD |
Ga0209733_11229652 | 3300027591 | Forest Soil | METLTGPILYLLIVWGIVTATFLALLLWRSILTTHE |
Ga0209076_10839281 | 3300027643 | Vadose Zone Soil | MESQSLTGPLLYLLIVWGVVTAVFLVLLLRRSLLESHEDDQIFFD |
Ga0209736_10103011 | 3300027660 | Forest Soil | MESLDSVFSGPLLYLLIVWGVVTAIFLVLIAWRSLLAGHED |
Ga0209180_102103733 | 3300027846 | Vadose Zone Soil | MDAMEAVFKGPLLYLLIAWGVITLVFLLLVIWRSVLSSHEDDHIILDAA |
Ga0209166_1000197416 | 3300027857 | Surface Soil | MEATLTGPIYFLLIVWAIITGTFLALLLWRSILTTHEDDQLCIDASGEHVARE |
Ga0209701_100434921 | 3300027862 | Vadose Zone Soil | MESTLQGPVLYLLIAWGIVTAVFVILFIWRSVLSSHEDDQI |
Ga0209701_105837631 | 3300027862 | Vadose Zone Soil | MESTLQGPVLYLLIAWGIVTAVFVILFIWRSVLSSHEDDQIF |
Ga0209283_103337242 | 3300027875 | Vadose Zone Soil | MEATLTGPIMYLLIVWGIATATFLALLLWRSILTTHEDDQLCIDAAGE |
Ga0209583_101982673 | 3300027910 | Watersheds | MEATLTGPILYLLIVFGIVTATFLALLLWRSILTTHEDDQLCIDAASEHMA |
Ga0209526_101048963 | 3300028047 | Forest Soil | MEASTLTGPILYLLIVWGIVTATFLALLLWRSILTTHED |
Ga0209526_101578862 | 3300028047 | Forest Soil | MEATLTGPIMYLLIVWGIVTATFLALLLWRSILTTHEDDQLCIDAAGE |
Ga0247663_10237381 | 3300028145 | Soil | METLTGPILYVLIAWGIVTAIFMMLLIRRSLLASHEDDQIFLDAS |
Ga0137415_107978852 | 3300028536 | Vadose Zone Soil | MGESQSLTGPLLYLLIAWGVVTAVFLVLLLRRSLLESHEDDQIFLDA |
Ga0308309_115471032 | 3300028906 | Soil | METITGPILYLLIVWGVITVVFIGLLMWRSLLASHEDDQIFLGS |
Ga0170834_1025783292 | 3300031057 | Forest Soil | MESMGAAFSGPLLYLLIVWGVVTAIFLLLIAWRSVLSSH |
(restricted) Ga0255310_100437361 | 3300031197 | Sandy Soil | MEAMESLLSGPMMYLLIAWGLVTAIFLVLVIWRSVLSSHEDD |
Ga0310915_107693573 | 3300031573 | Soil | MEQLEGVFTGPTLYLTVVWGVVTAIFLILVAWRSVLS |
Ga0307468_1018457991 | 3300031740 | Hardwood Forest Soil | MDPMGQAFSGPLLYLLIVWGVVTAIFLLLIAWRSVLSS |
Ga0318492_106096382 | 3300031748 | Soil | MEQVEELFQGTTLYLTVIWGVVTAIFLILVAWRSVLSSHED |
Ga0318492_107353471 | 3300031748 | Soil | MEQLEGVFTGPTLYLTVVWGVVTAIFLILVAWRSVLSSH |
Ga0318554_105683011 | 3300031765 | Soil | MEQVEELFQGTTLYLTVVWGVVTAIFLVLVAWRSVLSSHEDDQIFIDAAQEH |
Ga0310909_112972172 | 3300031947 | Soil | MEQLESAFSGPLLYLLIGWGVVTAVFLVLVAWRSVLA |
Ga0306926_128931421 | 3300031954 | Soil | MESALQGPILYLLIACGVVTAAFLALVIWRSLLESHEDDQIFLDAAEQHMAR |
Ga0307479_103055074 | 3300031962 | Hardwood Forest Soil | MDPQTLTGPLLYLLIAWGVVTAVFLVLLLRRSLLASHEDDQIFLDAAQ |
Ga0310911_100270734 | 3300032035 | Soil | MSESTLTGPVLYTLIAWGIVTAVFLALVIWRNLLESHEDDQLFLDA |
Ga0318533_113962792 | 3300032059 | Soil | MEQQVQEVFQGTTLYLTVIWGVVTAIFLVLVAWRSVLSS |
Ga0306924_109738713 | 3300032076 | Soil | MDAIEALLKGPFLYLLITWGVVTAIFLILVIWRSVLSS |
Ga0335082_101487751 | 3300032782 | Soil | MNPDMGAAFNGPLLYLLVAWGLVTAIFLVLIAWRSVLSSHEDDQIFL |
Ga0335078_108426862 | 3300032805 | Soil | MGEMEAVFQGPMLYLLIIWGVVTAVFLALVAWRSVLSSHEDDQIC |
Ga0335081_102199181 | 3300032892 | Soil | MEAMESAFTGPLLYLLIGWGVVTVLFLVLVAWRSVLTSHEDDQIFL |
Ga0335073_109002972 | 3300033134 | Soil | MDAMESAFSGPLLYLLIVWGVVTAIFLILIAWRSVLYSQEDDQIFIDYAQEHI |
Ga0318519_109996621 | 3300033290 | Soil | MEQQVQEVFQGTTLYLTVIWGVVTAIFLVLVAWRSVL |
Ga0326727_102329401 | 3300033405 | Peat Soil | MPIESMFTGSMLYLLIAWGLVTAIFLILIAWRSVLSSHEDDQIFLD |
Ga0326727_104966663 | 3300033405 | Peat Soil | MEAMESAFSGPLLYLLITWGVVTAIFLLLIAWRSVLSSHEDDQIF |
Ga0326724_0017234_1_126 | 3300034091 | Peat Soil | MESVESVLSGPMLYLLIVWGIVTAIFIILVAWRGVLASHEDD |
⦗Top⦘ |