| Basic Information | |
|---|---|
| Family ID | F039652 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 163 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS |
| Number of Associated Samples | 142 |
| Number of Associated Scaffolds | 163 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 4.35 % |
| % of genes near scaffold ends (potentially truncated) | 66.87 % |
| % of genes from short scaffolds (< 2000 bps) | 96.32 % |
| Associated GOLD sequencing projects | 131 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (98.773 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (22.086 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.491 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (55.215 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.86% β-sheet: 16.22% Coil/Unstructured: 68.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 163 Family Scaffolds |
|---|---|---|
| PF00026 | Asp | 46.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.77 % |
| Unclassified | root | N/A | 1.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001972|GOS2216_10030531 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1877 | Open in IMG/M |
| 3300002186|JGI24539J26755_10120110 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 760 | Open in IMG/M |
| 3300002835|B570J40625_100555096 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1063 | Open in IMG/M |
| 3300003802|Ga0007840_1008109 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 654 | Open in IMG/M |
| 3300003806|Ga0007864_1006792 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 940 | Open in IMG/M |
| 3300004112|Ga0065166_10073412 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1192 | Open in IMG/M |
| 3300004794|Ga0007751_10017762 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 532 | Open in IMG/M |
| 3300005043|Ga0071100_1076314 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 783 | Open in IMG/M |
| 3300005043|Ga0071100_1145530 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 528 | Open in IMG/M |
| 3300005516|Ga0066831_10016281 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 2032 | Open in IMG/M |
| 3300005580|Ga0049083_10163472 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 762 | Open in IMG/M |
| 3300005941|Ga0070743_10034445 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1744 | Open in IMG/M |
| 3300005942|Ga0070742_10088453 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 852 | Open in IMG/M |
| 3300006390|Ga0075509_1398889 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 568 | Open in IMG/M |
| 3300006415|Ga0099654_10246427 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 994 | Open in IMG/M |
| 3300006419|Ga0075496_1306241 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 564 | Open in IMG/M |
| 3300006424|Ga0075497_1299066 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 517 | Open in IMG/M |
| 3300007513|Ga0105019_1074669 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1923 | Open in IMG/M |
| 3300007516|Ga0105050_10467064 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 749 | Open in IMG/M |
| 3300007523|Ga0105052_10261605 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 1155 | Open in IMG/M |
| 3300007558|Ga0102822_1072918 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 809 | Open in IMG/M |
| 3300007558|Ga0102822_1174763 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 510 | Open in IMG/M |
| 3300007722|Ga0105051_10574567 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 830 | Open in IMG/M |
| 3300007864|Ga0105749_1166351 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 526 | Open in IMG/M |
| 3300007992|Ga0105748_10282416 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 702 | Open in IMG/M |
| 3300008117|Ga0114351_1399027 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 586 | Open in IMG/M |
| 3300008993|Ga0104258_1048838 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 792 | Open in IMG/M |
| 3300008996|Ga0102831_1123478 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 861 | Open in IMG/M |
| 3300009002|Ga0102810_1135269 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 762 | Open in IMG/M |
| 3300009003|Ga0102813_1046759 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1484 | Open in IMG/M |
| 3300009077|Ga0115552_1038678 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 2225 | Open in IMG/M |
| 3300009079|Ga0102814_10181812 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1148 | Open in IMG/M |
| 3300009182|Ga0114959_10150734 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1235 | Open in IMG/M |
| 3300009432|Ga0115005_10437857 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1039 | Open in IMG/M |
| 3300009432|Ga0115005_10485973 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 984 | Open in IMG/M |
| 3300009432|Ga0115005_11017242 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 671 | Open in IMG/M |
| 3300009434|Ga0115562_1061199 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1620 | Open in IMG/M |
| 3300009441|Ga0115007_10370729 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 934 | Open in IMG/M |
| 3300009442|Ga0115563_1162130 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 889 | Open in IMG/M |
| 3300009466|Ga0126448_1015117 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1888 | Open in IMG/M |
| 3300009497|Ga0115569_10153661 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1100 | Open in IMG/M |
| 3300009599|Ga0115103_1003113 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1732 | Open in IMG/M |
| 3300009677|Ga0115104_10769154 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 505 | Open in IMG/M |
| 3300009677|Ga0115104_10772287 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 905 | Open in IMG/M |
| 3300009677|Ga0115104_11262649 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 693 | Open in IMG/M |
| 3300009679|Ga0115105_10192394 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 773 | Open in IMG/M |
| 3300009785|Ga0115001_10196263 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1307 | Open in IMG/M |
| 3300010885|Ga0133913_11071537 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 2078 | Open in IMG/M |
| 3300010885|Ga0133913_11720803 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1575 | Open in IMG/M |
| 3300010970|Ga0137575_10086408 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 501 | Open in IMG/M |
| 3300010981|Ga0138316_10284799 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 627 | Open in IMG/M |
| 3300010985|Ga0138326_10835460 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 529 | Open in IMG/M |
| 3300010987|Ga0138324_10293433 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 776 | Open in IMG/M |
| 3300011268|Ga0151620_1030299 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1849 | Open in IMG/M |
| 3300012417|Ga0138262_1329410 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1138 | Open in IMG/M |
| 3300012528|Ga0129352_10920237 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 918 | Open in IMG/M |
| 3300012713|Ga0157544_1087618 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 648 | Open in IMG/M |
| 3300012716|Ga0157605_1082559 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 697 | Open in IMG/M |
| 3300012718|Ga0157557_1066156 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 727 | Open in IMG/M |
| 3300012722|Ga0157630_1155074 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 515 | Open in IMG/M |
| 3300012733|Ga0157606_1112768 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1406 | Open in IMG/M |
| 3300012771|Ga0138270_1324801 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1132 | Open in IMG/M |
| 3300012780|Ga0138271_1345108 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 794 | Open in IMG/M |
| 3300012953|Ga0163179_10622545 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 908 | Open in IMG/M |
| 3300012954|Ga0163111_12579123 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 518 | Open in IMG/M |
| 3300012965|Ga0129346_1080790 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 980 | Open in IMG/M |
| 3300013309|Ga0157546_164532 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 655 | Open in IMG/M |
| 3300017751|Ga0187219_1113226 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 811 | Open in IMG/M |
| 3300017763|Ga0181410_1129412 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 717 | Open in IMG/M |
| 3300018410|Ga0181561_10430123 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 597 | Open in IMG/M |
| 3300018725|Ga0193517_1036711 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 922 | Open in IMG/M |
| 3300018905|Ga0193028_1115523 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 516 | Open in IMG/M |
| 3300018913|Ga0192868_10092409 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 507 | Open in IMG/M |
| 3300018982|Ga0192947_10016174 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1902 | Open in IMG/M |
| 3300018982|Ga0192947_10017063 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1870 | Open in IMG/M |
| 3300019032|Ga0192869_10205249 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 840 | Open in IMG/M |
| 3300019036|Ga0192945_10027433 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1452 | Open in IMG/M |
| 3300019085|Ga0188830_1008762 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 792 | Open in IMG/M |
| 3300019117|Ga0193054_1014623 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1086 | Open in IMG/M |
| 3300019281|Ga0182077_1340182 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 799 | Open in IMG/M |
| 3300020014|Ga0182044_1160872 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 665 | Open in IMG/M |
| 3300020048|Ga0207193_1209741 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1526 | Open in IMG/M |
| 3300020074|Ga0194113_10204733 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1575 | Open in IMG/M |
| 3300020205|Ga0211731_10956457 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 2175 | Open in IMG/M |
| 3300021355|Ga0206690_10141110 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 758 | Open in IMG/M |
| 3300021355|Ga0206690_10360266 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 875 | Open in IMG/M |
| 3300021365|Ga0206123_10423450 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 544 | Open in IMG/M |
| 3300021389|Ga0213868_10318489 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 885 | Open in IMG/M |
| 3300021902|Ga0063086_1009618 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1910 | Open in IMG/M |
| 3300021913|Ga0063104_1064826 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 502 | Open in IMG/M |
| 3300021924|Ga0063085_1028293 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1859 | Open in IMG/M |
| 3300021942|Ga0063098_1076445 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 654 | Open in IMG/M |
| 3300022752|Ga0214917_10191928 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1019 | Open in IMG/M |
| 3300023179|Ga0214923_10257120 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 980 | Open in IMG/M |
| 3300023179|Ga0214923_10520609 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 580 | Open in IMG/M |
| 3300023184|Ga0214919_10616962 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 636 | Open in IMG/M |
| 3300023701|Ga0228685_1078254 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 504 | Open in IMG/M |
| 3300024346|Ga0244775_10168370 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1845 | Open in IMG/M |
| 3300025138|Ga0209634_1247516 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 647 | Open in IMG/M |
| 3300025369|Ga0208382_1025746 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 761 | Open in IMG/M |
| 3300025387|Ga0207959_1070245 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 503 | Open in IMG/M |
| 3300025620|Ga0209405_1092289 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 889 | Open in IMG/M |
| 3300025640|Ga0209198_1095767 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 936 | Open in IMG/M |
| 3300025704|Ga0209602_1192934 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 612 | Open in IMG/M |
| 3300025810|Ga0208543_1096630 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 706 | Open in IMG/M |
| 3300025886|Ga0209632_10493442 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 560 | Open in IMG/M |
| 3300026449|Ga0247593_1093629 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 587 | Open in IMG/M |
| 3300026471|Ga0247602_1111234 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 686 | Open in IMG/M |
| 3300026500|Ga0247592_1085710 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 762 | Open in IMG/M |
| 3300026504|Ga0247587_1186651 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 506 | Open in IMG/M |
| 3300026513|Ga0247590_1196678 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 513 | Open in IMG/M |
| 3300027708|Ga0209188_1191809 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 741 | Open in IMG/M |
| 3300027833|Ga0209092_10183891 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 1185 | Open in IMG/M |
| 3300027849|Ga0209712_10691627 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 562 | Open in IMG/M |
| 3300027906|Ga0209404_11112020 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 543 | Open in IMG/M |
| 3300027976|Ga0209702_10285772 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 674 | Open in IMG/M |
| 3300028110|Ga0247584_1041186 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1157 | Open in IMG/M |
| 3300028110|Ga0247584_1176431 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 522 | Open in IMG/M |
| 3300028137|Ga0256412_1080443 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1168 | Open in IMG/M |
| 3300028282|Ga0256413_1089621 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1106 | Open in IMG/M |
| 3300028282|Ga0256413_1170537 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 786 | Open in IMG/M |
| 3300028282|Ga0256413_1340884 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 525 | Open in IMG/M |
| 3300028290|Ga0247572_1100246 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 714 | Open in IMG/M |
| 3300028334|Ga0247597_1025665 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 772 | Open in IMG/M |
| 3300028575|Ga0304731_11145516 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 627 | Open in IMG/M |
| 3300030702|Ga0307399_10091408 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1263 | Open in IMG/M |
| 3300030702|Ga0307399_10214008 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 893 | Open in IMG/M |
| 3300030709|Ga0307400_10134131 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1490 | Open in IMG/M |
| 3300030709|Ga0307400_10257976 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 1101 | Open in IMG/M |
| 3300030709|Ga0307400_10268191 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1080 | Open in IMG/M |
| 3300030709|Ga0307400_10883419 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 549 | Open in IMG/M |
| 3300030720|Ga0308139_1012928 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1168 | Open in IMG/M |
| 3300030856|Ga0073990_12052411 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 733 | Open in IMG/M |
| 3300030948|Ga0073977_1440146 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 500 | Open in IMG/M |
| 3300031036|Ga0073978_1018776 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 546 | Open in IMG/M |
| 3300031269|Ga0307983_1042784 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 882 | Open in IMG/M |
| 3300031569|Ga0307489_10240764 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1143 | Open in IMG/M |
| 3300031613|Ga0307978_1106151 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 862 | Open in IMG/M |
| 3300031710|Ga0307386_10038231 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1744 | Open in IMG/M |
| 3300031710|Ga0307386_10349510 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 753 | Open in IMG/M |
| 3300031738|Ga0307384_10027006 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1851 | Open in IMG/M |
| 3300031739|Ga0307383_10158381 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1047 | Open in IMG/M |
| 3300031739|Ga0307383_10313361 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 760 | Open in IMG/M |
| 3300032050|Ga0315906_10712774 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 803 | Open in IMG/M |
| 3300032462|Ga0335396_10430533 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 847 | Open in IMG/M |
| 3300032462|Ga0335396_10517171 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 755 | Open in IMG/M |
| 3300032481|Ga0314668_10681495 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 511 | Open in IMG/M |
| 3300032707|Ga0314687_10776913 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 530 | Open in IMG/M |
| 3300032708|Ga0314669_10213017 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 998 | Open in IMG/M |
| 3300032713|Ga0314690_10267951 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 841 | Open in IMG/M |
| 3300032714|Ga0314686_10263594 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 855 | Open in IMG/M |
| 3300032727|Ga0314693_10185944 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1059 | Open in IMG/M |
| 3300032732|Ga0314711_10689920 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 510 | Open in IMG/M |
| 3300032742|Ga0314710_10207468 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 798 | Open in IMG/M |
| 3300032747|Ga0314712_10136820 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 1125 | Open in IMG/M |
| 3300032748|Ga0314713_10220578 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 801 | Open in IMG/M |
| 3300032748|Ga0314713_10431981 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 559 | Open in IMG/M |
| 3300032755|Ga0314709_10125830 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1440 | Open in IMG/M |
| 3300034051|Ga0335024_0320854 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 790 | Open in IMG/M |
| 3300034116|Ga0335068_0300090 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 800 | Open in IMG/M |
| 3300034167|Ga0335017_0359190 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 798 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 22.09% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 9.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.98% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.98% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 7.36% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.29% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 3.68% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.68% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.45% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.45% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.84% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.84% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.84% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.23% |
| Marine Subseafloor Aquifer | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer | 1.23% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.23% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.23% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.61% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.61% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.61% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.61% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.61% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.61% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.61% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.61% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.61% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.61% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.61% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.61% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.61% |
| Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 0.61% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001972 | Marine microbial communities from the Sargasso Sea - GS000d | Environmental | Open in IMG/M |
| 3300002186 | Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Metagenome | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003802 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07 | Environmental | Open in IMG/M |
| 3300003806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004794 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005043 | Mid-Atlantic Ridge North Pond Expedition - Sample 1382A | Environmental | Open in IMG/M |
| 3300005516 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300006390 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006415 | Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake community | Environmental | Open in IMG/M |
| 3300006419 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006424 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007513 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007523 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 | Environmental | Open in IMG/M |
| 3300007558 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007864 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008993 | Marine microbial communities from eastern North Pacific Ocean - P1 free-living | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009002 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 | Environmental | Open in IMG/M |
| 3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009679 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300010981 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4) | Environmental | Open in IMG/M |
| 3300010985 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8) | Environmental | Open in IMG/M |
| 3300010987 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6) | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012417 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012528 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012713 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES033 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012718 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES050 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012722 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012771 | Freshwater microbial communities from Lake Croche, Canada - C_130625_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012780 | Freshwater microbial communities from Lake Croche, Canada - C_130625_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300012965 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013309 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES035 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018725 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230) | Environmental | Open in IMG/M |
| 3300018905 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472) | Environmental | Open in IMG/M |
| 3300018913 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205) | Environmental | Open in IMG/M |
| 3300018982 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935) | Environmental | Open in IMG/M |
| 3300019032 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216) | Environmental | Open in IMG/M |
| 3300019036 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086) | Environmental | Open in IMG/M |
| 3300019085 | Metatranscriptome of marine microbial communities from Baltic Sea - GS670_3p0_dT | Environmental | Open in IMG/M |
| 3300019117 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912) | Environmental | Open in IMG/M |
| 3300019281 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020014 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021355 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021902 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021913 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021924 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021942 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300023701 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 47R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025387 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
| 3300025640 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026449 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026471 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026500 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026504 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026513 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027849 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028110 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028137 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028282 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028290 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028334 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028575 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030702 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030709 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030720 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030756 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030856 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030948 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_V_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031036 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031269 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #991 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031613 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1056 | Environmental | Open in IMG/M |
| 3300031710 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031738 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031739 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300032481 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032707 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032708 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032713 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032714 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032727 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032732 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032742 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032747 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032748 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032755 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034051 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GOS2216_100305314 | 3300001972 | Marine | LHYLWSMKDNEIIDHAMVSFSVTSKEMGETPYALFGGYNSS* |
| JGI24539J26755_101201101 | 3300002186 | Marine | MKKKKLHYLWSLKDNGIIDRALVSFSITSKEMGEGPYALFG |
| B570J40625_1005550961 | 3300002835 | Freshwater | MSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSS* |
| Ga0007840_10081091 | 3300003802 | Freshwater | MSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIVGGA* |
| Ga0007864_10067921 | 3300003806 | Freshwater | MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS* |
| Ga0065166_100734122 | 3300004112 | Freshwater Lake | MKKKKLHYLWSLKDNGIIDHAMVSFSITSKEMNEGPYALFGGYNSS* |
| Ga0007751_100177622 | 3300004794 | Freshwater Lake | DMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIVGGA* |
| Ga0071100_10763142 | 3300005043 | Marine Subseafloor Aquifer | MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGG |
| Ga0071100_11455301 | 3300005043 | Marine Subseafloor Aquifer | MSKKKLHYLYSLKENGIIDNAVVSFSVTSQDMGETPYALFGGYNSS* |
| Ga0066831_100162814 | 3300005516 | Marine | MSKKKLHYLWSMKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS* |
| Ga0049083_101634721 | 3300005580 | Freshwater Lentic | LGLSPHKDMKKKKLHYLWSLKDNGIIDHAMVSFSITSKEMNEGPYALFGGYNSS* |
| Ga0070743_100344453 | 3300005941 | Estuarine | MSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSSQIVDG* |
| Ga0070742_100884532 | 3300005942 | Estuarine | MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST* |
| Ga0075509_13988891 | 3300006390 | Aqueous | MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSTQIVGGAEG |
| Ga0099654_102464271 | 3300006415 | Lake | LGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIVGGA |
| Ga0075496_13062412 | 3300006419 | Aqueous | PHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNSS* |
| Ga0075497_12990662 | 3300006424 | Aqueous | LKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNSS* |
| Ga0105019_10746691 | 3300007513 | Marine | MGKKKLHYLWSMKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS* |
| Ga0105050_104670642 | 3300007516 | Freshwater | MSKKKLHYLWSLKDNGIIDHAIVSFSVTSKEMGETPYALFGGYNSSQIVGGA* |
| Ga0105052_102616051 | 3300007523 | Freshwater | MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYA |
| Ga0102822_10729182 | 3300007558 | Estuarine | MKKKKLHYLWSLKDNGIIDRAMVSFSIASKEMGETPYALFGGYNSS* |
| Ga0102822_11747631 | 3300007558 | Estuarine | PHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST* |
| Ga0105051_105745671 | 3300007722 | Freshwater | NKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST* |
| Ga0105749_11663511 | 3300007864 | Estuary Water | SPHKDVKKSKLHYLWSLKNNGIIDHAMVSFSVTSKDMDDAPYALFGGYNSS* |
| Ga0105748_102824161 | 3300007992 | Estuary Water | MKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNS |
| Ga0114351_13990271 | 3300008117 | Freshwater, Plankton | PHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSS* |
| Ga0104258_10488383 | 3300008993 | Ocean Water | LKDNGIIDHAMVSFSVTSQDMGENPYALFGGYNST* |
| Ga0102831_11234782 | 3300008996 | Estuarine | GLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSSQIVDG* |
| Ga0102810_11352691 | 3300009002 | Estuarine | KLHYLWALKDNGIIDKAMVSFSIASLDMDDQPYALFGGINPS* |
| Ga0102813_10467593 | 3300009003 | Estuarine | MSKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSS* |
| Ga0115552_10386782 | 3300009077 | Pelagic Marine | MKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNST* |
| Ga0102814_101818122 | 3300009079 | Estuarine | MSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSSQ |
| Ga0114959_101507342 | 3300009182 | Freshwater Lake | MSKKKLHYLWSLKDNGIIDHAMVSFSVTSKDMNETPYALFGGYNSS* |
| Ga0115005_104378571 | 3300009432 | Marine | MSKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSSQI |
| Ga0115005_104859731 | 3300009432 | Marine | PHKDMKKKKLHYLWSLKDNGIIDRALVSFSITSKEMGEGPYALFGGYNSS* |
| Ga0115005_110172421 | 3300009432 | Marine | LNYVWSLKDKGIIDRALISFSITSKEMVETPYALFRMTQVH |
| Ga0115562_10611992 | 3300009434 | Pelagic Marine | MKKKKLHYLWSLKDNGIIDRALVSFSITSKEMGEGPYALFGGYNSS* |
| Ga0115007_103707291 | 3300009441 | Marine | HYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST* |
| Ga0115563_11621301 | 3300009442 | Pelagic Marine | MKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNSTQI |
| Ga0126448_10151174 | 3300009466 | Meromictic Pond | MSKKKLHYLWSLKDNGIIDHAMVSFSVTSKDMGETPYALFGGYNSS* |
| Ga0115569_101536612 | 3300009497 | Pelagic Marine | MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFG |
| Ga0115103_10031133 | 3300009599 | Marine | MGKKKLHYLWSLKDNGIIDHAVVSFSVTSKEMGETPYALFGGYNSS* |
| Ga0115104_107691541 | 3300009677 | Marine | MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYAL |
| Ga0115104_107722871 | 3300009677 | Marine | SMKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS* |
| Ga0115104_112626493 | 3300009677 | Marine | HYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNST* |
| Ga0115105_101923941 | 3300009679 | Marine | MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPY |
| Ga0115001_101962631 | 3300009785 | Marine | MSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIVNGAD |
| Ga0133913_110715372 | 3300010885 | Freshwater Lake | MKKKKLHYLWSLKDNGIIDHAMVSFSITSKEMGETPYALFGGYNSSQIVGGA* |
| Ga0133913_117208032 | 3300010885 | Freshwater Lake | MSKKKLHYLWSLKDNGIIDHAMVSFSVTFKDMNETPYALFVGYNSSQIVGGS* |
| Ga0137575_100864081 | 3300010970 | Pond Fresh Water | MKKKKLHYLWSLKDNGIIDHAMVSITSKEMNEGPYALFGGYNSS* |
| Ga0138316_102847991 | 3300010981 | Marine | MSKKKLHYLWSLKDNGIIEHAMVSFSVTSKEMNETPYALFGGYNSS* |
| Ga0138326_108354601 | 3300010985 | Marine | MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSTQL* |
| Ga0138324_102934332 | 3300010987 | Marine | MSKKKLHYLWSMKDNGIIDHAIVSFSVTSKEMGEAPYALFGGYNSSQIVDGA* |
| Ga0151620_10302992 | 3300011268 | Freshwater | LKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS* |
| Ga0138262_13294101 | 3300012417 | Polar Marine | MSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSSQIVGGS* |
| Ga0129352_109202371 | 3300012528 | Aqueous | KDMKKKKLHYLWSLKDNQINDRAMVSFSITSREMGETPYALFGGYNST* |
| Ga0157544_10876182 | 3300012713 | Freshwater | LWSLKDNGIIDHAMVSFSITSKEMNEGPYALFGGYNSS* |
| Ga0157605_10825591 | 3300012716 | Freshwater | KDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS* |
| Ga0157557_10661561 | 3300012718 | Freshwater | KDNGIIDHAMVSFSITSKEMNEGPYALFGGYNSS* |
| Ga0157630_11550742 | 3300012722 | Freshwater | GILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS* |
| Ga0157606_11127681 | 3300012733 | Freshwater | MKKKKLHYLWSLKDNGIIDHAMVRFSITSKEMNEGPYALFGGYNSS* |
| Ga0138270_13248011 | 3300012771 | Freshwater Lake | MSKKKLHYLWSLKDNGIIDHAMVSFSVTSKDMNETPYALFGGYNSSQIVGGS* |
| Ga0138271_13451083 | 3300012780 | Freshwater Lake | KKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSS* |
| Ga0163179_106225453 | 3300012953 | Seawater | WSLKDNGIIDRAMVSFSITSKEVGETPYALFGGYNST* |
| Ga0163111_125791232 | 3300012954 | Surface Seawater | MKKKKLHYLWSLKDNGIIDRALVSFSITSKEMGEGPYALFGGY |
| Ga0129346_10807903 | 3300012965 | Aqueous | GLSPHKDMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNST* |
| Ga0157546_1645321 | 3300013309 | Freshwater | LKDNGIIDHAMVSFSITSKEMNEGPYALFGGYNSS* |
| Ga0187219_11132263 | 3300017751 | Seawater | MSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIVNGA |
| Ga0181410_11294121 | 3300017763 | Seawater | MKKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSSQIVGGAAG |
| Ga0181561_104301232 | 3300018410 | Salt Marsh | MSKKKLHYLWSLKDNGIIDRAMVSFSVTSKEMGETPYALFGGYNST |
| Ga0181566_104662091 | 3300018426 | Salt Marsh | MKDKGIIDRAMVSFSISSIDQEDPPYALFGGVNST |
| Ga0193517_10367112 | 3300018725 | Marine | YLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST |
| Ga0193028_11155231 | 3300018905 | Marine | KDMKKKKLHYLWSLKDNGIIDRALVSFSITSKEMGEGPYALFGGYNSS |
| Ga0192868_100924092 | 3300018913 | Marine | LKDNGIIDKAIVSFSITSREMGETPYALFGGYNST |
| Ga0192947_100161742 | 3300018982 | Marine | MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST |
| Ga0192947_100170633 | 3300018982 | Marine | MSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSS |
| Ga0192869_102052491 | 3300019032 | Marine | LGLSPHKDMSKKKLHYLWSMKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSS |
| Ga0192945_100274332 | 3300019036 | Marine | LGLSPHKEMGKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSS |
| Ga0188830_10087621 | 3300019085 | Freshwater Lake | LKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS |
| Ga0193054_10146232 | 3300019117 | Marine | MKKRKLHYLWSLRENGIIDHAMVSFSITSKEMNETPYALFGGYNSTQIVGGA |
| Ga0182077_13401822 | 3300019281 | Salt Marsh | MSKKKLHYLWSLKDNGIIDRAMVSFSITSNEMGETPYALFGGYNSSQIVNGAQ |
| Ga0182044_11608722 | 3300020014 | Salt Marsh | MGKKKLHYLWSLKDNGIIDHAMVSFSVTSKDMGETPYALFGGYNST |
| Ga0207193_12097412 | 3300020048 | Freshwater Lake Sediment | MSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIVGGA |
| Ga0194113_102047331 | 3300020074 | Freshwater Lake | MKKKKLHYLWSLKDNGIIDHAMVSFSITSKEMNEGPYALFGGYNSS |
| Ga0211731_109564573 | 3300020205 | Freshwater | LGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS |
| Ga0206690_101411101 | 3300021355 | Seawater | KKKLHYLWSLKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS |
| Ga0206690_103602661 | 3300021355 | Seawater | MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNS |
| Ga0206123_104234503 | 3300021365 | Seawater | LKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSS |
| Ga0213868_103184892 | 3300021389 | Seawater | DGILGLSPHKDLTKKKLHYLWSLKDNGIIDHALVSFSVTSKEMNETPYALFGGYNSS |
| Ga0063086_10096183 | 3300021902 | Marine | MSKKKLHYLWSMKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS |
| Ga0063104_10648261 | 3300021913 | Marine | GLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST |
| Ga0063085_10282932 | 3300021924 | Marine | MKKKKLHYLWSLKDNGIIDRALVSFSITSKEMGEGPYALFGGYNSS |
| Ga0063098_10764451 | 3300021942 | Marine | LKDNGIIDRALVSFSITSKEMGEGPYALFGGYNSS |
| Ga0214917_101919283 | 3300022752 | Freshwater | MSKKKLHYLWSLKDNGIIDHAMVSFSVTSKDMNETPYALFGGYNSS |
| Ga0214923_102571201 | 3300023179 | Freshwater | MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS |
| Ga0214923_105206091 | 3300023179 | Freshwater | MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSSQIVG |
| Ga0214919_106169621 | 3300023184 | Freshwater | LHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS |
| Ga0228685_10782542 | 3300023701 | Seawater | MSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYN |
| Ga0244775_101683702 | 3300024346 | Estuarine | MSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSSQIVDG |
| Ga0209634_12475161 | 3300025138 | Marine | HPSPMKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS |
| Ga0208382_10257462 | 3300025369 | Freshwater | KKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS |
| Ga0207959_10702452 | 3300025387 | Freshwater | KKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS |
| Ga0209405_10922893 | 3300025620 | Pelagic Marine | HYLWSLKDNGIIDRALVSFSITSKEMGEGPYALFGGYNSS |
| Ga0209198_10957672 | 3300025640 | Pelagic Marine | MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNSS |
| Ga0209602_11929341 | 3300025704 | Pelagic Marine | MTKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSSQIVGGAAGL |
| Ga0208543_10966303 | 3300025810 | Aqueous | KLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST |
| Ga0209632_104934422 | 3300025886 | Pelagic Marine | MKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNST |
| Ga0247593_10936291 | 3300026449 | Seawater | KKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNST |
| Ga0247602_11112341 | 3300026471 | Seawater | MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFG |
| Ga0247592_10857102 | 3300026500 | Seawater | KKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSS |
| Ga0247587_11866511 | 3300026504 | Seawater | MSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIVNGADG |
| Ga0247590_11966781 | 3300026513 | Seawater | MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALF |
| Ga0209188_11918091 | 3300027708 | Freshwater Lake | ILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKDMNETPYALFGGYNSS |
| Ga0209092_101838912 | 3300027833 | Marine | MGKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGY |
| Ga0209712_106916271 | 3300027849 | Marine | MGKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSSQIVGGAAGLK |
| Ga0209404_111120202 | 3300027906 | Marine | LSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST |
| Ga0209702_102857721 | 3300027976 | Freshwater | LSPHKDMSKKKLHYLWSLKDNGIIDHAIVSFSVTSKEMGETPYALFGGYNSSQIVGGA |
| Ga0247584_10411861 | 3300028110 | Seawater | MKKKQLHYLWSLNDNGIIDRAMVSFSITSKEMGETPYALFGGYNS |
| Ga0247584_11764311 | 3300028110 | Seawater | MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSTQIVGGAEGLK |
| Ga0256412_10804431 | 3300028137 | Seawater | GLSPHKDVSKKKLHYLWSLKENGIIAHAQVSFSVTSQDMGETPYALFGGYNST |
| Ga0256413_10896211 | 3300028282 | Seawater | MKKKKLHYLWSLKDNGIIDRALVSFSITSKEMGEGPYALF |
| Ga0256413_11705371 | 3300028282 | Seawater | LHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST |
| Ga0256413_13408842 | 3300028282 | Seawater | WSLKDNGIIDNAIVSFSITSQEMGESPYALFGGYNSSQIVGGS |
| Ga0247572_11002461 | 3300028290 | Seawater | LGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSS |
| Ga0247597_10256651 | 3300028334 | Seawater | HYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSS |
| Ga0304731_111455161 | 3300028575 | Marine | MSKKKLHYLWSLKDNGIIEHAMVSFSVTSKEMNETPYALFGGYNSS |
| Ga0307399_100914081 | 3300030702 | Marine | MKKKKLHYLWSLKDNGISDRAMVSFSITSKEMGETPYALFGGYNST |
| Ga0307399_102140082 | 3300030702 | Marine | KDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST |
| Ga0307400_101341312 | 3300030709 | Marine | MGKKKLHYLWSLKDNGIIDHAMVSFSVTSQDMGETPYALFGGYNST |
| Ga0307400_102579761 | 3300030709 | Marine | MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNSSQIVGG |
| Ga0307400_102681913 | 3300030709 | Marine | MSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIV |
| Ga0307400_108834192 | 3300030709 | Marine | MGKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSS |
| Ga0308139_10129284 | 3300030720 | Marine | WSLKDNGIIDHAMVSFSVTSQDMGENPYALFGGYNST |
| Ga0073968_114249022 | 3300030756 | Marine | LKDYGIIDKAMVSFNIASKDMEDEPYALFGGVNSTQIVGG |
| Ga0073990_120524111 | 3300030856 | Marine | MKKRKLHYLWSLRENGIIDRAMVSFSITSKEMNETPYALFGGYNS |
| Ga0073977_14401461 | 3300030948 | Marine | LGLSPHKDMSKKKLHYLWSLKDNGIIDRAMVSFSITSNEMGETPYALFGGYNSS |
| Ga0073978_10187762 | 3300031036 | Marine | MSKKKLHYLWSMKDNGIIDHAIVSFSVTSKEMGEAPYALFGGYNSSQIVDGSSG |
| Ga0307983_10427842 | 3300031269 | Saline Water | SPHKDIKKKKLHYLWSLKDNGIIDRAMVSFSITSKDMGETPYALFGGYNSS |
| Ga0307489_102407642 | 3300031569 | Sackhole Brine | MSKKKLHYLWSLKDNGIIDHAIVSFSITSKDMSEKPYALFGGYNST |
| Ga0307978_11061511 | 3300031613 | Saline Water | KLHYLWSLKDNGIIDRAMVSFSITSKDMGETPYALFGGYNSS |
| Ga0307386_100382312 | 3300031710 | Marine | MNKKKLHYLWSLKDNGIIDHAMVSFSVTSQEMGETPYALFGGYNSS |
| Ga0307386_103495101 | 3300031710 | Marine | WSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST |
| Ga0307384_100270062 | 3300031738 | Marine | MSKKKLHYLWSMKDNGLIDHAVVSFSVTSKEMGETPYALFGGYNSS |
| Ga0307383_101583811 | 3300031739 | Marine | MGKKKLHYLWSLKDNGIIDHAMVSFSVTSQEMGETPYALFGG |
| Ga0307383_103133611 | 3300031739 | Marine | GLSPHKDMSKKKLHYLWSMKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS |
| Ga0315906_107127742 | 3300032050 | Freshwater | KKLHYLWSLKDNGIIDHAMVSFSITSKEMNEGPYALFGGYNSS |
| Ga0335396_104305332 | 3300032462 | Freshwater | NKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST |
| Ga0335396_105171711 | 3300032462 | Freshwater | LSPHKDMSKKKLHYLWSLKDNGIIDHAIVSFSVTSKEMGETPYALFGGYNSSQIV |
| Ga0314668_106814951 | 3300032481 | Seawater | LWSLKDNGIIDHAMVSFSVTSQDMGENPYALFGGYNST |
| Ga0314687_107769131 | 3300032707 | Seawater | YLWSLKDNGIIDHAMVSFSVTSQDMGETPYALFGGYNST |
| Ga0314669_102130172 | 3300032708 | Seawater | QKLHYLWSLKDNGIIDHAMVSFSVTSQDMGENPYALFGGYNST |
| Ga0314690_102679513 | 3300032713 | Seawater | GILGLSPHKDMRKKKLHYLWSLKHNKIIDHAIVSFSINAKNMNDKPYALFGGYNSSQIIGGA |
| Ga0314686_102635941 | 3300032714 | Seawater | PHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNST |
| Ga0314693_101859441 | 3300032727 | Seawater | SPHKDQSKQKLHYRWSLKDNGIIDHALVSCSVTSQDMGENPYALFGGYNST |
| Ga0314711_106899201 | 3300032732 | Seawater | LGLSPHKDQSKQKLHYLWSLKDNGIIDHAMVSFSVTSQDMGENPYALFGGYNST |
| Ga0314710_102074683 | 3300032742 | Seawater | KKKLHYLWSLKYNKIIDHAIVSFSINAKNMNDKPYALFGGYNSSQIIGGA |
| Ga0314712_101368202 | 3300032747 | Seawater | MKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNSTQIVGGAEGL |
| Ga0314713_102205781 | 3300032748 | Seawater | LKDNGIIDHAMVSFSVTSQDMGENPYALFGGYNST |
| Ga0314713_104319812 | 3300032748 | Seawater | MSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIVNG |
| Ga0314709_101258302 | 3300032755 | Seawater | MKKKKLHYVWSLKDNGIIDRALVSFSITSKEMGEGPYALFGGYNSS |
| Ga0335024_0320854_1_120 | 3300034051 | Freshwater | YLWSLKDNGIIDHAMVSLSITSKEMNEGPYALFGGYNSS |
| Ga0335068_0300090_671_799 | 3300034116 | Freshwater | KLHYLWSLKDNGIIDHAMVSFSITSKEMNEGPYALFGGYNSS |
| Ga0335017_0359190_671_796 | 3300034167 | Freshwater | LHYLWSLKDNGIIDHAMVSFSITSKEMNEGPYALFGGYNSS |
| ⦗Top⦘ |