| Basic Information | |
|---|---|
| Family ID | F039611 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 163 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRRESSTVVVLVGEVGDGLLAGLGRSPNVSVARAPAAGAGQ |
| Number of Associated Samples | 128 |
| Number of Associated Scaffolds | 163 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 91.93 % |
| % of genes near scaffold ends (potentially truncated) | 97.55 % |
| % of genes from short scaffolds (< 2000 bps) | 90.18 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.166 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (43.558 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.626 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (42.945 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.59% β-sheet: 0.00% Coil/Unstructured: 88.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 163 Family Scaffolds |
|---|---|---|
| PF00144 | Beta-lactamase | 15.95 |
| PF00583 | Acetyltransf_1 | 6.75 |
| PF01068 | DNA_ligase_A_M | 6.13 |
| PF01981 | PTH2 | 4.29 |
| PF08281 | Sigma70_r4_2 | 3.68 |
| PF00932 | LTD | 3.68 |
| PF03358 | FMN_red | 3.07 |
| PF12680 | SnoaL_2 | 2.45 |
| PF04679 | DNA_ligase_A_C | 2.45 |
| PF14269 | Arylsulfotran_2 | 1.84 |
| PF00561 | Abhydrolase_1 | 1.84 |
| PF02627 | CMD | 1.84 |
| PF08592 | Anthrone_oxy | 1.23 |
| PF12852 | Cupin_6 | 0.61 |
| PF04237 | YjbR | 0.61 |
| PF01381 | HTH_3 | 0.61 |
| PF02535 | Zip | 0.61 |
| PF13560 | HTH_31 | 0.61 |
| PF13738 | Pyr_redox_3 | 0.61 |
| PF13380 | CoA_binding_2 | 0.61 |
| PF01872 | RibD_C | 0.61 |
| PF08241 | Methyltransf_11 | 0.61 |
| PF02861 | Clp_N | 0.61 |
| PF07690 | MFS_1 | 0.61 |
| PF13238 | AAA_18 | 0.61 |
| PF10009 | DUF2252 | 0.61 |
| PF00483 | NTP_transferase | 0.61 |
| PF01812 | 5-FTHF_cyc-lig | 0.61 |
| PF04266 | ASCH | 0.61 |
| PF03372 | Exo_endo_phos | 0.61 |
| PF04978 | DUF664 | 0.61 |
| PF04264 | YceI | 0.61 |
| PF01694 | Rhomboid | 0.61 |
| PF04655 | APH_6_hur | 0.61 |
| PF13565 | HTH_32 | 0.61 |
| PF02560 | Cyanate_lyase | 0.61 |
| PF00903 | Glyoxalase | 0.61 |
| PF13474 | SnoaL_3 | 0.61 |
| PF01734 | Patatin | 0.61 |
| PF08028 | Acyl-CoA_dh_2 | 0.61 |
| PF06441 | EHN | 0.61 |
| PF00072 | Response_reg | 0.61 |
| PF13408 | Zn_ribbon_recom | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 163 Family Scaffolds |
|---|---|---|---|
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 15.95 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 15.95 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 15.95 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 8.59 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 6.13 |
| COG1990 | Peptidyl-tRNA hydrolase | Translation, ribosomal structure and biogenesis [J] | 4.29 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.84 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.84 |
| COG2411 | Predicted RNA-binding protein, contains PUA-like ASCH domain | General function prediction only [R] | 0.61 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.61 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.61 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.61 |
| COG3097 | Uncharacterized conserved protein YqfB, UPF0267 family | Function unknown [S] | 0.61 |
| COG3570 | Streptomycin 6-kinase | Defense mechanisms [V] | 0.61 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.61 |
| COG4405 | Predicted RNA-binding protein YhfF, contains PUA-like ASCH domain | General function prediction only [R] | 0.61 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.61 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.61 |
| COG0212 | 5-formyltetrahydrofolate cyclo-ligase | Coenzyme transport and metabolism [H] | 0.61 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.61 |
| COG1513 | Cyanate lyase | Inorganic ion transport and metabolism [P] | 0.61 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.61 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
| COG0428 | Zinc transporter ZupT | Inorganic ion transport and metabolism [P] | 0.61 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.17 % |
| Unclassified | root | N/A | 28.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573002|GZIGXIF02FR22G | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Ornithinimicrobiaceae → Serinicoccus → Serinicoccus hydrothermalis | 506 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10141928 | Not Available | 580 | Open in IMG/M |
| 3300000956|JGI10216J12902_101883798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 784 | Open in IMG/M |
| 3300000956|JGI10216J12902_114473901 | Not Available | 549 | Open in IMG/M |
| 3300005332|Ga0066388_106976681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 568 | Open in IMG/M |
| 3300005334|Ga0068869_101369831 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300005355|Ga0070671_101404731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 617 | Open in IMG/M |
| 3300005445|Ga0070708_100021737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5432 | Open in IMG/M |
| 3300005602|Ga0070762_10210615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. MUSC 14 | 1193 | Open in IMG/M |
| 3300005764|Ga0066903_100729281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1755 | Open in IMG/M |
| 3300005764|Ga0066903_100743306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1740 | Open in IMG/M |
| 3300005764|Ga0066903_106688026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
| 3300005842|Ga0068858_101754516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 613 | Open in IMG/M |
| 3300006580|Ga0074049_11962986 | Not Available | 611 | Open in IMG/M |
| 3300006914|Ga0075436_101017154 | Not Available | 622 | Open in IMG/M |
| 3300009011|Ga0105251_10536615 | Not Available | 550 | Open in IMG/M |
| 3300009088|Ga0099830_11159045 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300009089|Ga0099828_11519351 | Not Available | 590 | Open in IMG/M |
| 3300009162|Ga0075423_10532635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1236 | Open in IMG/M |
| 3300010358|Ga0126370_10626626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 933 | Open in IMG/M |
| 3300010358|Ga0126370_11304184 | Not Available | 681 | Open in IMG/M |
| 3300010359|Ga0126376_11098470 | Not Available | 803 | Open in IMG/M |
| 3300010359|Ga0126376_11819090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
| 3300010360|Ga0126372_11693803 | Not Available | 673 | Open in IMG/M |
| 3300010361|Ga0126378_11745332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 708 | Open in IMG/M |
| 3300010361|Ga0126378_13149726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300010362|Ga0126377_12623982 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300010362|Ga0126377_13530729 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300010366|Ga0126379_11260189 | Not Available | 845 | Open in IMG/M |
| 3300010366|Ga0126379_12454534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 620 | Open in IMG/M |
| 3300010376|Ga0126381_101554799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 956 | Open in IMG/M |
| 3300010376|Ga0126381_103028065 | Not Available | 667 | Open in IMG/M |
| 3300010401|Ga0134121_10107680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2343 | Open in IMG/M |
| 3300010867|Ga0126347_1562348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1200 | Open in IMG/M |
| 3300011119|Ga0105246_10582482 | Not Available | 964 | Open in IMG/M |
| 3300011269|Ga0137392_10932733 | Not Available | 714 | Open in IMG/M |
| 3300011270|Ga0137391_11222137 | Not Available | 599 | Open in IMG/M |
| 3300011444|Ga0137463_1273614 | Not Available | 625 | Open in IMG/M |
| 3300012203|Ga0137399_10486767 | Not Available | 1034 | Open in IMG/M |
| 3300012207|Ga0137381_10279861 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300012209|Ga0137379_10904269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus | 787 | Open in IMG/M |
| 3300012210|Ga0137378_11763213 | Not Available | 524 | Open in IMG/M |
| 3300012948|Ga0126375_11200152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
| 3300012961|Ga0164302_10444897 | Not Available | 898 | Open in IMG/M |
| 3300012971|Ga0126369_10774702 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300012971|Ga0126369_11798547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 701 | Open in IMG/M |
| 3300012971|Ga0126369_13097959 | Not Available | 544 | Open in IMG/M |
| 3300012989|Ga0164305_10844713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 764 | Open in IMG/M |
| 3300013104|Ga0157370_10193294 | Not Available | 1889 | Open in IMG/M |
| 3300014167|Ga0181528_10026169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3345 | Open in IMG/M |
| 3300014968|Ga0157379_10065561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3246 | Open in IMG/M |
| 3300014969|Ga0157376_10318437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1478 | Open in IMG/M |
| 3300016270|Ga0182036_11201425 | Not Available | 631 | Open in IMG/M |
| 3300016294|Ga0182041_10613137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 957 | Open in IMG/M |
| 3300016341|Ga0182035_11451918 | Not Available | 617 | Open in IMG/M |
| 3300016445|Ga0182038_11728963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300017792|Ga0163161_10568270 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300017961|Ga0187778_11333978 | Not Available | 506 | Open in IMG/M |
| 3300017966|Ga0187776_10240126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1155 | Open in IMG/M |
| 3300017970|Ga0187783_11033990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
| 3300017974|Ga0187777_10435300 | Not Available | 911 | Open in IMG/M |
| 3300018058|Ga0187766_10364723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 949 | Open in IMG/M |
| 3300020582|Ga0210395_10151171 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300021181|Ga0210388_10697933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 884 | Open in IMG/M |
| 3300021402|Ga0210385_10232379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1350 | Open in IMG/M |
| 3300021402|Ga0210385_10480168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 941 | Open in IMG/M |
| 3300021433|Ga0210391_10272746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1327 | Open in IMG/M |
| 3300021560|Ga0126371_12230024 | Not Available | 661 | Open in IMG/M |
| 3300021560|Ga0126371_13814434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 508 | Open in IMG/M |
| 3300024288|Ga0179589_10400588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineococcus → Kineococcus rubinsiae | 629 | Open in IMG/M |
| 3300025474|Ga0208479_1097972 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300025633|Ga0208480_1036404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1353 | Open in IMG/M |
| 3300025898|Ga0207692_10007952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4372 | Open in IMG/M |
| 3300025929|Ga0207664_10086263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2564 | Open in IMG/M |
| 3300025929|Ga0207664_10318333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1372 | Open in IMG/M |
| 3300025939|Ga0207665_10189366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1494 | Open in IMG/M |
| 3300025939|Ga0207665_11334159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 572 | Open in IMG/M |
| 3300025944|Ga0207661_10441151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1185 | Open in IMG/M |
| 3300026078|Ga0207702_11173507 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300027546|Ga0208984_1107242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 604 | Open in IMG/M |
| 3300028037|Ga0265349_1028022 | Not Available | 524 | Open in IMG/M |
| 3300028879|Ga0302229_10218826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 867 | Open in IMG/M |
| 3300028884|Ga0307308_10095949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1411 | Open in IMG/M |
| 3300030490|Ga0302184_10281804 | Not Available | 672 | Open in IMG/M |
| 3300030706|Ga0310039_10043767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 2010 | Open in IMG/M |
| 3300031543|Ga0318516_10023702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3171 | Open in IMG/M |
| 3300031543|Ga0318516_10529394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 675 | Open in IMG/M |
| 3300031544|Ga0318534_10113800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1553 | Open in IMG/M |
| 3300031544|Ga0318534_10362341 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300031564|Ga0318573_10213557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1024 | Open in IMG/M |
| 3300031564|Ga0318573_10421748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 717 | Open in IMG/M |
| 3300031564|Ga0318573_10469913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 677 | Open in IMG/M |
| 3300031572|Ga0318515_10005973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5124 | Open in IMG/M |
| 3300031670|Ga0307374_10213927 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300031679|Ga0318561_10685859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 563 | Open in IMG/M |
| 3300031681|Ga0318572_10765327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 574 | Open in IMG/M |
| 3300031682|Ga0318560_10303925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 860 | Open in IMG/M |
| 3300031708|Ga0310686_102663221 | Not Available | 636 | Open in IMG/M |
| 3300031713|Ga0318496_10148603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1278 | Open in IMG/M |
| 3300031723|Ga0318493_10500467 | Not Available | 672 | Open in IMG/M |
| 3300031723|Ga0318493_10766573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| 3300031724|Ga0318500_10451842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
| 3300031747|Ga0318502_10294553 | Not Available | 953 | Open in IMG/M |
| 3300031748|Ga0318492_10125068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1281 | Open in IMG/M |
| 3300031751|Ga0318494_10050189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2203 | Open in IMG/M |
| 3300031769|Ga0318526_10024791 | Not Available | 2136 | Open in IMG/M |
| 3300031771|Ga0318546_10572691 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300031778|Ga0318498_10116074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1217 | Open in IMG/M |
| 3300031778|Ga0318498_10350295 | Not Available | 659 | Open in IMG/M |
| 3300031779|Ga0318566_10333576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
| 3300031780|Ga0318508_1150216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 661 | Open in IMG/M |
| 3300031781|Ga0318547_10265974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1036 | Open in IMG/M |
| 3300031782|Ga0318552_10117602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis vancoresmycina → Amycolatopsis vancoresmycina DSM 44592 | 1322 | Open in IMG/M |
| 3300031782|Ga0318552_10485308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 631 | Open in IMG/M |
| 3300031794|Ga0318503_10037567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1443 | Open in IMG/M |
| 3300031796|Ga0318576_10494363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 577 | Open in IMG/M |
| 3300031797|Ga0318550_10078353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1531 | Open in IMG/M |
| 3300031798|Ga0318523_10009411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3912 | Open in IMG/M |
| 3300031799|Ga0318565_10477776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharothrix → unclassified Saccharothrix → Saccharothrix sp. CB00851 | 602 | Open in IMG/M |
| 3300031821|Ga0318567_10260304 | Not Available | 975 | Open in IMG/M |
| 3300031831|Ga0318564_10016837 | All Organisms → cellular organisms → Bacteria | 2992 | Open in IMG/M |
| 3300031833|Ga0310917_10721148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 675 | Open in IMG/M |
| 3300031835|Ga0318517_10517133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 537 | Open in IMG/M |
| 3300031845|Ga0318511_10119956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1132 | Open in IMG/M |
| 3300031846|Ga0318512_10304494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 792 | Open in IMG/M |
| 3300031846|Ga0318512_10496545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
| 3300031846|Ga0318512_10625362 | Not Available | 550 | Open in IMG/M |
| 3300031860|Ga0318495_10286656 | Not Available | 734 | Open in IMG/M |
| 3300031879|Ga0306919_10246711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1342 | Open in IMG/M |
| 3300031879|Ga0306919_10722980 | Not Available | 767 | Open in IMG/M |
| 3300031879|Ga0306919_10831120 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300031896|Ga0318551_10174853 | Not Available | 1180 | Open in IMG/M |
| 3300031912|Ga0306921_12187185 | Not Available | 583 | Open in IMG/M |
| 3300031941|Ga0310912_11145408 | Not Available | 593 | Open in IMG/M |
| 3300031946|Ga0310910_10333290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1197 | Open in IMG/M |
| 3300031946|Ga0310910_11065634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 630 | Open in IMG/M |
| 3300031954|Ga0306926_10920874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1045 | Open in IMG/M |
| 3300031959|Ga0318530_10261629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 713 | Open in IMG/M |
| 3300032009|Ga0318563_10776133 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300032010|Ga0318569_10091609 | Not Available | 1365 | Open in IMG/M |
| 3300032025|Ga0318507_10163819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 954 | Open in IMG/M |
| 3300032035|Ga0310911_10313825 | Not Available | 903 | Open in IMG/M |
| 3300032041|Ga0318549_10067512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1511 | Open in IMG/M |
| 3300032043|Ga0318556_10038811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2258 | Open in IMG/M |
| 3300032043|Ga0318556_10293180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 850 | Open in IMG/M |
| 3300032044|Ga0318558_10425771 | Not Available | 661 | Open in IMG/M |
| 3300032051|Ga0318532_10228801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 660 | Open in IMG/M |
| 3300032059|Ga0318533_11120157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharothrix → unclassified Saccharothrix → Saccharothrix sp. CB00851 | 576 | Open in IMG/M |
| 3300032066|Ga0318514_10228920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 976 | Open in IMG/M |
| 3300032066|Ga0318514_10279529 | Not Available | 881 | Open in IMG/M |
| 3300032066|Ga0318514_10424099 | Not Available | 706 | Open in IMG/M |
| 3300032067|Ga0318524_10083727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1565 | Open in IMG/M |
| 3300032067|Ga0318524_10170867 | Not Available | 1105 | Open in IMG/M |
| 3300032067|Ga0318524_10283535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 855 | Open in IMG/M |
| 3300032076|Ga0306924_11687651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 664 | Open in IMG/M |
| 3300032089|Ga0318525_10198496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1031 | Open in IMG/M |
| 3300032089|Ga0318525_10416410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 688 | Open in IMG/M |
| 3300032089|Ga0318525_10419647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
| 3300032091|Ga0318577_10453863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 612 | Open in IMG/M |
| 3300032828|Ga0335080_11078054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 814 | Open in IMG/M |
| 3300032895|Ga0335074_10972809 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 43.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.13% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.07% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.07% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.45% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.23% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.23% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.23% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.23% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.61% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.61% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.61% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.61% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FE1_05881140 | 2189573002 | Grass Soil | MRRESSTVVVLVGAVGEEVLAELGRSPNVSIARAPGTGAGQPGAEEPPAARQGWEAGA |
| AF_2010_repII_A1DRAFT_101419282 | 3300000597 | Forest Soil | VRRESSTVVVLVGAAGEELLSELGRSPNVSIARAP |
| JGI10216J12902_1018837981 | 3300000956 | Soil | MRRESSTVVVLVGEVGEGLLDGLGRSPNVSVARAP |
| JGI10216J12902_1144739011 | 3300000956 | Soil | MRRESSTVVVVTGDVGEDLLTGLARSANVSVARAPVAGPKAG |
| Ga0066388_1069766811 | 3300005332 | Tropical Forest Soil | VVVLAGEVGEGLLDGLGRSPNVSVARAPAAAAVQPDERAAARPGWEAGA |
| Ga0068869_1013698312 | 3300005334 | Miscanthus Rhizosphere | MRRETSTVVVLVGEVGEGLLADLGQSPNVSVARAPVAEGRESAE |
| Ga0070671_1014047312 | 3300005355 | Switchgrass Rhizosphere | MRRESSTVVVLVGEVGEGLLDGLGRSPNVSVARARAAGAGQPGEPTARP |
| Ga0070708_1000217378 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRESSTVVVLVGAVDEALLANLRRSPNVSIARAPEAGPGQRGAEE |
| Ga0070762_102106151 | 3300005602 | Soil | MMGLMRRESSTVIVLAGEPDDSLLSALSQSPNVSV |
| Ga0066903_1007292813 | 3300005764 | Tropical Forest Soil | MRRESSTVVVLVGEVGEGLLDGLGRSPNVSVARAPSAGGGQPGERT |
| Ga0066903_1007433063 | 3300005764 | Tropical Forest Soil | MRRESSTVVVLVGAVGEDMLASLGRSPNVSVARAPGAG |
| Ga0066903_1066880262 | 3300005764 | Tropical Forest Soil | MRRESSTVVVLVGEVDEGLLAGLGRSGNVSLARAPAATARPPAAEDTQAARPGWD |
| Ga0068858_1017545162 | 3300005842 | Switchgrass Rhizosphere | MRRESSTVVVLVGEVGEGLLDGLGRSPNVSVARARAAGAGQPGEPTAR |
| Ga0074049_119629862 | 3300006580 | Soil | MRRESSTVVVLVGEVGDGLLAGLGRSPNVSVARAPAAGAGQ |
| Ga0075436_1010171541 | 3300006914 | Populus Rhizosphere | MRRESSTVVVLIGAGDEGVLAGLARSPNVSVARAPAHDDGQSNKS |
| Ga0105251_105366152 | 3300009011 | Switchgrass Rhizosphere | MRRESSTVVVVTGEVGEDLLTGLARSANVSVARAPAAGA |
| Ga0099830_111590452 | 3300009088 | Vadose Zone Soil | MVRIKSMRRESSTVVVLVGEVGDGLLAGLGRSPNVSV |
| Ga0099828_115193511 | 3300009089 | Vadose Zone Soil | MRRESSTVVVLAGAVSEGLLAGLGRSPNVSIARAPGAGAGQPGTA |
| Ga0075423_105326353 | 3300009162 | Populus Rhizosphere | MRRETSTVVVLVGEVGEGLLAGLGQSPNVSVARAPVAEG |
| Ga0126373_103173051 | 3300010048 | Tropical Forest Soil | MRRETSTVVVLVGEVGDGVLAELARSSNISVARGPKTEAPPAW |
| Ga0126370_106266263 | 3300010358 | Tropical Forest Soil | MRRESSTVVVLVGEVDEGLLAGLGHSGNVSLARATAPAAGP |
| Ga0126370_113041841 | 3300010358 | Tropical Forest Soil | MRRESSTVVVLVGGADEVLLAGLGKLPNVSVARAPADDAADGGSV |
| Ga0126376_104645722 | 3300010359 | Tropical Forest Soil | MRRETSTVVVLVGEVGDGVLAELARSSNISVARGPKTEAPPAGHQATE* |
| Ga0126376_110984702 | 3300010359 | Tropical Forest Soil | MRRESSTVVALVGEVDEGLLAGLGRSSNVSVARAPDAGAGQPDAEQSAAARPPE |
| Ga0126376_118190901 | 3300010359 | Tropical Forest Soil | MRRESSTVVVLVGAVGEELLAELGRSPNVSIARAPGGWAGQPGAEEPAGAR |
| Ga0126372_116938032 | 3300010360 | Tropical Forest Soil | MRRESSTVVALVGEVGEGLLAGLGRSSNVSVARVPDAGAGQPAAEQP |
| Ga0126378_117453322 | 3300010361 | Tropical Forest Soil | MRRESATVVALVGEVAEGLLAELGRSVNVSVARAPA |
| Ga0126378_131497262 | 3300010361 | Tropical Forest Soil | MRRESSTVVVLVGAVGEGLLAELGRSPNVSIARAPGTGAG |
| Ga0126377_126239821 | 3300010362 | Tropical Forest Soil | MRRESSTVVVLVGEVGKGLLDGLGRSSNVSVAGAPAAGAGPPGEPTARPG |
| Ga0126377_135307292 | 3300010362 | Tropical Forest Soil | MRRESSTVVVLVGEVGERLLAALGRSPNVSVARAPTAGGQPAAEEPA |
| Ga0126379_112601891 | 3300010366 | Tropical Forest Soil | VRRESSTVVVLVGAVSEELLSGLGRSPNVSIARAPGTGAGHPGAEEPAGARPGWEA |
| Ga0126379_124545342 | 3300010366 | Tropical Forest Soil | MRRESSTAVALVGEVDEGLLAGLGRSSNVSVARAP |
| Ga0126381_1015547991 | 3300010376 | Tropical Forest Soil | MRRESSTVVVLIGEVDEGLLAGLGHSGNVSLARAPAPAAGPPAAQ |
| Ga0126381_1030280652 | 3300010376 | Tropical Forest Soil | MRRESSTVVVLVGEADDELLAALGHSPNVSVARAPAAGK |
| Ga0134121_101076801 | 3300010401 | Terrestrial Soil | MRRESSTVVVLVGEVGEGLLDGLRRSPNVSVARARAAG |
| Ga0126347_15623482 | 3300010867 | Boreal Forest Soil | MIGPVRRESSTVVVLVGAVAEPLLAGLARSSNVSLVRPPEEEKD |
| Ga0105246_105824821 | 3300011119 | Miscanthus Rhizosphere | MRRESSTVVVVTGEVGEDLLTGLARSANVSVARAPAAGAGTGA |
| Ga0137392_109327331 | 3300011269 | Vadose Zone Soil | MRRESSTVVVLAGAVSEGLLAELGRSPNVSIARAPGAAAGQLGTAEP |
| Ga0137391_112221371 | 3300011270 | Vadose Zone Soil | MRRESSTVVVLAGAVSEGLLAELGRSPNVSIARAPGAGAGQPGTA |
| Ga0137463_12736141 | 3300011444 | Soil | MRRESSTVVVVTGEVGEDLLTALARPANVSVARAPV |
| Ga0137399_104867671 | 3300012203 | Vadose Zone Soil | MRRESSTVVVLVGEADDGLLAGLARSPNVSVARAPAAEKSGTGQPDA |
| Ga0137381_102798613 | 3300012207 | Vadose Zone Soil | MRRESSTVVVLVGEIGEIGDGLLAGLGRSPGISVARAPAAGT |
| Ga0137379_109042691 | 3300012209 | Vadose Zone Soil | MPMRRDSSTVVVLVGDADEGILAGLARSPNISVAR |
| Ga0137378_117632131 | 3300012210 | Vadose Zone Soil | MRRESSTMVVLVGDVGDGLLAELGRSGNVSIARAPAAGPQD |
| Ga0126375_112001522 | 3300012948 | Tropical Forest Soil | MRRESSTVVVLVGAVSEGLLAELARSPNISIARAPGTGAGQPGVAEPPGARPGWEAGA |
| Ga0164302_104448972 | 3300012961 | Soil | MRRESSTVVVVTGEVGEDLLTGLARSANVSVARAPAAGAGVAA |
| Ga0126369_107747021 | 3300012971 | Tropical Forest Soil | MRRESSTVVVLVGAVGEELLASLGRSNNVSVARAPGAEAGQPGAEAQASARPGWETGALA |
| Ga0126369_117985471 | 3300012971 | Tropical Forest Soil | VVALVGEVSDGLLAGLGRSGNVSVARAPAAGAGQPGA |
| Ga0126369_130979591 | 3300012971 | Tropical Forest Soil | MRRESSTVVALVGEVDEGLLAGLGRSSNVSVARAPDAETAP* |
| Ga0164305_108447132 | 3300012989 | Soil | MRRESSTVVVLAGDVGEGLLDGLGRSPNVSVARAPAAGPGQPGETTARSGWEAGALA |
| Ga0157370_101932941 | 3300013104 | Corn Rhizosphere | MRRESSTVVVVTGEVGEDLLTGLARSANVSVARAPAAGAGVAADAGSGS |
| Ga0181528_100261693 | 3300014167 | Bog | MGQQWGSSTVVVLVGEVSAGLLAGLGRSPNVSVVRNPGA |
| Ga0157379_100655611 | 3300014968 | Switchgrass Rhizosphere | MRRESSTVVVVTGEVGEDLLTGLARSANVSVARAPAAG |
| Ga0157376_103184372 | 3300014969 | Miscanthus Rhizosphere | MRRESSTVVVLVGEVGEGLLDGLGRSPNVSVARARAAGAGQPGEPTA |
| Ga0182036_112014252 | 3300016270 | Soil | MRRESSTVVVLVGEIGDGLLAALAKSPGISVVRAPAAGTGES |
| Ga0182041_106131371 | 3300016294 | Soil | MRRESSTVIVLVGEVGEGLLDGLGRSPNVSVARAPAAGGGQPGEHTAARAGWEAGALA |
| Ga0182035_114519181 | 3300016341 | Soil | VRRESSTVVVLVGAVGEELLSQLGRSPNVSIARAPGTGAGHPGPEEPAGARPGWETGALA |
| Ga0182038_117289632 | 3300016445 | Soil | MRRESSTVVALVGHVDDALLAGLGRSGNVSVARAPVADTGPPGKEPAAISAWRL |
| Ga0163161_105682701 | 3300017792 | Switchgrass Rhizosphere | MRRETSTVVVLVGEVGEGLLADLGQSPNVSVARAPVAEGRESAEERTRRRP |
| Ga0187778_113339782 | 3300017961 | Tropical Peatland | MRRESSTVVVLVGEVEEGLLAGLGHSGNLSLARAPAAEAPAAWPGWE |
| Ga0187776_102401262 | 3300017966 | Tropical Peatland | MRRESSTVVVLAGEVGEGLLDGLGRSPNVSVARAP |
| Ga0187783_110339901 | 3300017970 | Tropical Peatland | MRRESSTVVVVVGEFGDRLLGGLTQSSNVSVARAPDDAV |
| Ga0187777_104353002 | 3300017974 | Tropical Peatland | MRRESSTVVVLVGEIGDGLLGALAGSPGLSVVRAPAAGTGES |
| Ga0187766_103647233 | 3300018058 | Tropical Peatland | MRRESSTVVVLAGEVGEGLLAGLGRSGNVSLARAPAAGPPAAEEAPAA |
| Ga0210395_101511711 | 3300020582 | Soil | MRRESSTVVALVGEVTGDLLAGLGRTPNVAVARPPASAA |
| Ga0210388_106979332 | 3300021181 | Soil | MRRESSTVVAVVGEFGDGLLAGLTQSPNVSVARAPDDGAGQPPG |
| Ga0210385_102323791 | 3300021402 | Soil | MIGPVRRESSTVVVLVGAVAEPLLAGLARSSNVSVVRPPG |
| Ga0210385_104801683 | 3300021402 | Soil | MRRESSTVVALVGDVTGGLLAGLGGSANVSVARAPAAGTGQ |
| Ga0210391_102727464 | 3300021433 | Soil | MRRESATVVALVGEVTSDLLASLRRTPNVAVARAPAYAADPADA |
| Ga0126371_122300242 | 3300021560 | Tropical Forest Soil | VRRESSTVVVLVGAVGEELLSELGRSPNVSIARAPGTGAGHPGAEEPAG |
| Ga0126371_138144341 | 3300021560 | Tropical Forest Soil | MAMRRESSTVVVLIGEPDDRLLIALARFPNVSVARAAD |
| Ga0179589_104005882 | 3300024288 | Vadose Zone Soil | MIGPVRRESSPVVVLVGAAAAPLLARLPRTSNVSLVR |
| Ga0208479_10979722 | 3300025474 | Arctic Peat Soil | MRRESSTVVVLAGQVERGLLAELARSPNVSVARAPDAGPGE |
| Ga0208480_10364043 | 3300025633 | Arctic Peat Soil | MIGPVRRESSTVVVLVGAVAEPLLAGLARSSNVSLV |
| Ga0207692_100079526 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRESSTVVVLVGEVGEGLLDGLGRSPNVSVARARAAG |
| Ga0207664_100862633 | 3300025929 | Agricultural Soil | MRRESSTVVVVTGDVGEDLLAGLAQSANVSVARAPAA |
| Ga0207664_103183332 | 3300025929 | Agricultural Soil | MRRESSTVVVLVGEVGEGLLDGLGRSPNVSVARARAAGAGQPGEPTARPRWEAG |
| Ga0207665_101893661 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRESSTVVVLVGEVGEGLLDGLRRSPNVSVARARAAGAGQPGEPTARPGWEAGAL |
| Ga0207665_113341591 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRESSTVVVLVGEVGEGLLDGLGRSPNVSVARARAAGAGQPGEPTARPGWEAGAL |
| Ga0207661_104411513 | 3300025944 | Corn Rhizosphere | MRRESSTVVALVGAVGDDLLAGLARSANISLARGPA |
| Ga0207702_111735072 | 3300026078 | Corn Rhizosphere | MRREISTVVVLVGEVGEGLLADLGQSPNVSVARAPVAEGRE |
| Ga0208984_11072423 | 3300027546 | Forest Soil | MRRESSTVVAVVGEVGDELLAGLGRSPNVSVARAPAAGAGQPAAGEA |
| Ga0265349_10280222 | 3300028037 | Soil | MRHESSTVVAVVGEFGDGLLAGLTQSPNVSVARAPDDADGQPL |
| Ga0302229_102188262 | 3300028879 | Palsa | MMRLMRRESSTVIVLAGEPDDALLGALSQSPNVSVAR |
| Ga0307308_100959491 | 3300028884 | Soil | MRRESSTVVVLVGEVGDGLLDGLGRSPNVSVARAPAAGAGQPGEPTARPG |
| Ga0302184_102818041 | 3300030490 | Palsa | VRRESSTVVALVGEVSSGLLAGLGRSPNVSVARPPEAESPRPAAAAGASTQAA |
| Ga0310039_100437675 | 3300030706 | Peatlands Soil | MRRESSTVVVLVGEVGDGLLAGLARYANVSVTRAPAADAEQASQAT |
| Ga0318516_100237025 | 3300031543 | Soil | VRRESSTVVVLVGAVGEELLSQLGRSPNVSIARAPGTGAGHPGPEE |
| Ga0318516_105293942 | 3300031543 | Soil | MRRESSTVVVLVGEVDEGLLAGLGRSGTVSLARAPTATAGPPAA |
| Ga0318534_101138002 | 3300031544 | Soil | MRRESSTVIVLVGEVGEGLLDGLGRSPYVSVARAP |
| Ga0318534_103623412 | 3300031544 | Soil | MRRESSTVVALVGEVGDGLLAGLGRSGNVSVARAPAAGGDQPGPEQPAARSSWEAGA |
| Ga0318573_102135572 | 3300031564 | Soil | MRRESSTVIVLVGEVGEGLLDGLGRSPNVSVARAPAAGGGQPGEHTA |
| Ga0318573_104217482 | 3300031564 | Soil | MRRESSTVVVLVGEVDEGLLAGLGRSGNVSLARAPAATAGPPAAEDTQAARPEWEAG |
| Ga0318573_104699131 | 3300031564 | Soil | MRRESSTVVALVGEVGEGLLAELGRSPNLSIARASGAGAGPPGAG |
| Ga0318515_100059731 | 3300031572 | Soil | MRRESSTVVVLVGEVDEALLAGLGRSGNVSLARAPAATAGPPAAEDTQAARPEWEAG |
| Ga0307374_102139274 | 3300031670 | Soil | MRRESATVVVLVGEVDGGLLAELARSPNVSVARAPDARPDEPAAGDAAAARP |
| Ga0318561_106858591 | 3300031679 | Soil | MRRESSTVVVLVGGVDEGLLASLGRSSNVSIARAPGAGAGQP |
| Ga0318572_107653272 | 3300031681 | Soil | MRRESSTVVVLAGEVSEELLDGLGRSPNVSVARAPAAAGGQPGDRTAAGA |
| Ga0318560_103039251 | 3300031682 | Soil | MRRESSTVIVLVGEVGERPRPSPNVSVARAPAAGGGQPGEHTAARA |
| Ga0310686_1026632211 | 3300031708 | Soil | MRRESSTLVVLVGEAGEGLLAELGRSGNVSVARAPAAGQP |
| Ga0318496_101486031 | 3300031713 | Soil | MRRESSTVVVLAGEVSEELLDGLGRSPNVSVARAPAAAGGQPGDRTAARAGWEA |
| Ga0318493_105004671 | 3300031723 | Soil | VRRESSTVVALVGAVGEELLSELGRSPNVSIARAPATGG |
| Ga0318493_107665732 | 3300031723 | Soil | MRRESSTVVVLVGEVDEGLLAGLGRSGNVSLARAPAATAG |
| Ga0318500_104518422 | 3300031724 | Soil | MRRESSTVVVLVGAVDEGLLASLGRSSNVSIARAPGAGAGQPGA |
| Ga0318502_102945531 | 3300031747 | Soil | MRRESSTVVVLVGEIGDGLLTALAKSPGISVARAPAAGAGAGESPSGEP |
| Ga0318492_101250681 | 3300031748 | Soil | MRRESSTVIVLVGEVGEGLLDGLGRSPNVSVARAPAAG |
| Ga0318494_100501894 | 3300031751 | Soil | VRRESSTVVALVGAVGEELLSELGRSPNVSIARAPATG |
| Ga0318526_100247913 | 3300031769 | Soil | VRRESSTVVVIVGAVGEELLSELGRSPNVSIAWAPGTGAGH |
| Ga0318546_105726911 | 3300031771 | Soil | MRRESSTVVALVGEVGDGLLAGLGRSGNVSVAHAPAAVGDEPGAEEPTARHGW |
| Ga0318498_101160742 | 3300031778 | Soil | MRRESSTVVVLAGEVSEELLDGLGRSPNVSVARAPAAAGGQPGDRTAAGAGWEAGALAM |
| Ga0318498_103502951 | 3300031778 | Soil | VRRESSTVVALVGAVGEELLSELGRSPNVSIARAPATGGGHPGG |
| Ga0318566_103335761 | 3300031779 | Soil | MRRESSTVVALVGEVGEGLLAELGRSPNLSIARAS |
| Ga0318508_11502162 | 3300031780 | Soil | MRRESSTVVVLVGEVDEGLLAGLGRSGNVSLARAPAATAGPPAAEDTQAARPEW |
| Ga0318547_102659743 | 3300031781 | Soil | MRRESSTVVVLVGEVDEGLLAGLGRSGNVSLARAPTATAGPPAAEDT |
| Ga0318552_101176021 | 3300031782 | Soil | MRRESSTVIVLVGAVGEELLASLGRSNNVSVARAPGTGAGQPGAEE |
| Ga0318552_104853081 | 3300031782 | Soil | MRRESSTVVVLVGDLGEGLLDGLGRSPNVSVARAPAA |
| Ga0318503_100375671 | 3300031794 | Soil | MRRESSTVVVLVGEVDEGLLAGLGRSGNVSLARVPAA |
| Ga0318576_104943631 | 3300031796 | Soil | MRRESSTVIVLVGEVGEGLLDGLGRSPNVSVARAPAAGGGQPG |
| Ga0318550_100783531 | 3300031797 | Soil | MRRESSTVVALVGHVDDALLAGLGRSGNVSVARAPAADTGPPGEEPAA |
| Ga0318523_100094111 | 3300031798 | Soil | MRRESSTVVVLVGEVDEGLLAGLGRSGNVSLARRG |
| Ga0318565_104777761 | 3300031799 | Soil | MRRESSTVVVLVGAVDEALLASLGRSSNVSIARAPGAGAGQPGAEEPASARPGWEAGAL |
| Ga0318567_102603042 | 3300031821 | Soil | MRRESSTVVVLVGEIGDGLLTALAKSPGISVARAPAAGAGAGESPS |
| Ga0318564_100168374 | 3300031831 | Soil | MRRESSTVIVLVGEVGEGLLDGLGRSPNVSVARAPAAGGGQPGEHP |
| Ga0310917_107211482 | 3300031833 | Soil | MRRESSTVVVLVGEVDEALLAGLGRSGNVSLARAPAATAGPPAAEDTQAARPGWEAGALA |
| Ga0318517_105171332 | 3300031835 | Soil | MRRESSTVIVLVGEVGEGLLDGLGRSPNVSVARAPAAGGGQP |
| Ga0318511_101199562 | 3300031845 | Soil | MRRESSTVVVLVGAVDEALLASLGRSSNVSIARAPGAGAGQPAAEEPASARPGWEAG |
| Ga0318512_103044943 | 3300031846 | Soil | MRRESSTVVVLVGEIGEGLLAALAKSPGISVVRAPAAGTGESPA |
| Ga0318512_104965451 | 3300031846 | Soil | MRRESSTVVVLVGAVDEALLASLGRSSNVSIARAPGAGTGQPAAE |
| Ga0318512_106253622 | 3300031846 | Soil | MRRESSTVVVLVGEIGDGLLVALARSPGISVVRAPAAGTGEPAAGR |
| Ga0318495_102866561 | 3300031860 | Soil | VRRESSTVVVLVGAVGEELLSQLGRSPNVSIARAPGTGAGHPGPEEPTGARPGWETGA |
| Ga0306919_102467111 | 3300031879 | Soil | VRRESSTVVVIVGAVGEELLSELGRSPNVSIARAPG |
| Ga0306919_107229801 | 3300031879 | Soil | MRRESSTVVALVGEVGDGLLAGLGRSGNVSVARAPS |
| Ga0306919_108311201 | 3300031879 | Soil | MRRESSTVVALVGEVGDGLLAGLGRSGNVSVAHAPAAVG |
| Ga0318551_101748531 | 3300031896 | Soil | VRRESSTVVVIVGAVGEELLSELGRSPNVSIAWAPGTGPI |
| Ga0306921_121871851 | 3300031912 | Soil | VRRESSTVVALVGAVGEELLSELGRSPNVSIARAPA |
| Ga0310912_111454081 | 3300031941 | Soil | VRRESSTVVALVGAVGEELLSELGRSPNVSIARAPATGGGHPGGEE |
| Ga0310910_103332901 | 3300031946 | Soil | MVVLVGEVGEGLLDGLGRSPNVSVARTPTAGTGQPGEPTVRPGW |
| Ga0310910_110656342 | 3300031946 | Soil | MRRESSTVVVLVGEIGEGLLAALAKSPGISVVRAPA |
| Ga0306926_109208741 | 3300031954 | Soil | MRRESSTVVVLVGEVDEGLLAGLGRSGNVSLARAPTATA |
| Ga0318530_102616291 | 3300031959 | Soil | MRRESSTVVVLVGEIGEGLLAALAKSPGISVVRAPAAGTGESP |
| Ga0318563_107761332 | 3300032009 | Soil | MRRESSTVVALVGEVGDGLLAGLGRSGNVSVARAP |
| Ga0318569_100916091 | 3300032010 | Soil | VRRESSTVVVIVGAVGEELLSELGRSPNVSIARAPGT |
| Ga0318507_101638193 | 3300032025 | Soil | MRRESSTVVVLVGEVDEALLAGLGRSGNVSLARAPAATAGP |
| Ga0310911_103138252 | 3300032035 | Soil | VRRESSTVVVIVGAVGEELLSELGRSPNVSIARAPGTGAGHAGAEEPAGARPGWEAGALA |
| Ga0318549_100675121 | 3300032041 | Soil | MRRESSTVVVLVGEVDEGLLAGLGRSGNVSLARAPTATAGPPAAEDTQAT |
| Ga0318556_100388111 | 3300032043 | Soil | MRRESSTVVVLVGEIGEGLLAALAKSPGISVVRAPAAGTGESPAGQ |
| Ga0318556_102931801 | 3300032043 | Soil | MRRESSTVIVLVGEVGEGLLDGLGRSPNVSVARAPAAGGGQPGEH |
| Ga0318558_104257711 | 3300032044 | Soil | MRRESSTVVVLVGEVDEGLLGGLGRSPNVSVARAPAA |
| Ga0318532_102288012 | 3300032051 | Soil | MRRESSTVVVLVGAVDEALLASLGRSSNVSIARAPGAGAGQP |
| Ga0318533_111201571 | 3300032059 | Soil | MRRESSTVVVLVGAVDEALLASLGRSSNVSIARAPGAGTGQPAAEEPVIARPGWE |
| Ga0318514_102289201 | 3300032066 | Soil | MRRESSTVVVLVGEVDEGLLAGLGRSGNVSLARAPAATAGPPAAEDTQAARP |
| Ga0318514_102795292 | 3300032066 | Soil | MRRESSTVVVLVGEIGDGLLAALARSPGISVVRAPA |
| Ga0318514_104240992 | 3300032066 | Soil | MRGESSTVVVLVGDVAEGLLAGLSRSVNVAVARAPAAEAGQTGE |
| Ga0318524_100837272 | 3300032067 | Soil | MRRESSTVVVLAGEVSEELLDGLGRSPNVSVARAPAAAG |
| Ga0318524_101708672 | 3300032067 | Soil | VRRESSTVVALVGAVGEELLSELGRSPNVSIARAPATGGGHPGGEEPAGAR |
| Ga0318524_102835352 | 3300032067 | Soil | MRRESSTVIVLVGEVGEGLLDGLGRSPNVSVARAPAAGGGQPGEHTAARATETL |
| Ga0306924_116876511 | 3300032076 | Soil | MRRESSTVVVLAGEVSEELLDGLGRSPNVSVARAPAAAGGQPGDRTAA |
| Ga0318525_101984963 | 3300032089 | Soil | MRRESSTVVVLVGEVDEGLLAGLGRSGNVSLARVPAATAGPPAAEDTQ |
| Ga0318525_104164102 | 3300032089 | Soil | MRRESSTVVVLVGEVDEGLLAGLGRSGNVSLARAPTAT |
| Ga0318525_104196472 | 3300032089 | Soil | MRRESSTVVVLVGAVDEALLASLGRSSNVSIARVPGAGAG |
| Ga0318577_104538631 | 3300032091 | Soil | MRRESSTVVVLVGAVDEALLASLGRSSNVSIARAPGAGAGQPGAVEPASARPGWE |
| Ga0335080_110780542 | 3300032828 | Soil | MRRESSTVVVLVGEIDDGLLAALARSPGISVVRAP |
| Ga0335074_109728092 | 3300032895 | Soil | MRRESSTVVVLAGEAGSGLLAGLAGFPNVSVTRAPAAGEQAR |
| ⦗Top⦘ |