| Basic Information | |
|---|---|
| Family ID | F039610 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 163 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MSRTTTKWLVLASLTLAGLTSAACTRTDATGPSDQPAPSFETQGANN |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 163 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 68.10 % |
| % of genes near scaffold ends (potentially truncated) | 27.61 % |
| % of genes from short scaffolds (< 2000 bps) | 77.30 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.687 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.791 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.926 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (31.288 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 32.00% β-sheet: 0.00% Coil/Unstructured: 68.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 163 Family Scaffolds |
|---|---|---|
| PF12833 | HTH_18 | 8.59 |
| PF00072 | Response_reg | 5.52 |
| PF02954 | HTH_8 | 4.29 |
| PF13411 | MerR_1 | 3.07 |
| PF12019 | GspH | 2.45 |
| PF01435 | Peptidase_M48 | 1.84 |
| PF04264 | YceI | 1.23 |
| PF13458 | Peripla_BP_6 | 0.61 |
| PF13641 | Glyco_tranf_2_3 | 0.61 |
| PF07963 | N_methyl | 0.61 |
| PF03951 | Gln-synt_N | 0.61 |
| PF05324 | Sperm_Ag_HE2 | 0.61 |
| PF01713 | Smr | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 163 Family Scaffolds |
|---|---|---|---|
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 1.23 |
| COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.69 % |
| Unclassified | root | N/A | 23.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_186530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4016 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105561315 | Not Available | 1317 | Open in IMG/M |
| 3300000890|JGI11643J12802_11588918 | Not Available | 520 | Open in IMG/M |
| 3300000956|JGI10216J12902_101972030 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 627 | Open in IMG/M |
| 3300000956|JGI10216J12902_114227534 | Not Available | 737 | Open in IMG/M |
| 3300000956|JGI10216J12902_122305886 | Not Available | 635 | Open in IMG/M |
| 3300003267|soilL1_10015091 | All Organisms → cellular organisms → Bacteria | 6033 | Open in IMG/M |
| 3300003319|soilL2_10009087 | All Organisms → cellular organisms → Bacteria | 4470 | Open in IMG/M |
| 3300003321|soilH1_10297779 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1118 | Open in IMG/M |
| 3300003324|soilH2_10140089 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2521 | Open in IMG/M |
| 3300004157|Ga0062590_101165482 | Not Available | 748 | Open in IMG/M |
| 3300004643|Ga0062591_101107747 | Not Available | 763 | Open in IMG/M |
| 3300004785|Ga0058858_1128859 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 675 | Open in IMG/M |
| 3300004803|Ga0058862_12048479 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 748 | Open in IMG/M |
| 3300004808|Ga0062381_10097263 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 915 | Open in IMG/M |
| 3300005093|Ga0062594_100566005 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 984 | Open in IMG/M |
| 3300005172|Ga0066683_10670313 | Not Available | 619 | Open in IMG/M |
| 3300005206|Ga0068995_10026552 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 936 | Open in IMG/M |
| 3300005332|Ga0066388_100723557 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300005445|Ga0070708_100018321 | All Organisms → cellular organisms → Bacteria | 5861 | Open in IMG/M |
| 3300005518|Ga0070699_101488143 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300005526|Ga0073909_10485502 | Not Available | 595 | Open in IMG/M |
| 3300005562|Ga0058697_10122980 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1103 | Open in IMG/M |
| 3300005564|Ga0070664_100272433 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1525 | Open in IMG/M |
| 3300005577|Ga0068857_100347512 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1373 | Open in IMG/M |
| 3300005618|Ga0068864_100010977 | All Organisms → cellular organisms → Bacteria | 7489 | Open in IMG/M |
| 3300005618|Ga0068864_100805064 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 924 | Open in IMG/M |
| 3300005841|Ga0068863_102151011 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 568 | Open in IMG/M |
| 3300005844|Ga0068862_102043570 | Not Available | 584 | Open in IMG/M |
| 3300005874|Ga0075288_1000016 | All Organisms → cellular organisms → Bacteria | 17205 | Open in IMG/M |
| 3300005874|Ga0075288_1014483 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1076 | Open in IMG/M |
| 3300005877|Ga0075296_1000189 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2231 | Open in IMG/M |
| 3300005884|Ga0075291_1002693 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1910 | Open in IMG/M |
| 3300005887|Ga0075292_1057995 | Not Available | 570 | Open in IMG/M |
| 3300005887|Ga0075292_1061836 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 555 | Open in IMG/M |
| 3300005889|Ga0075290_1047211 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 587 | Open in IMG/M |
| 3300006605|Ga0074057_10226715 | Not Available | 530 | Open in IMG/M |
| 3300006755|Ga0079222_10009882 | All Organisms → cellular organisms → Bacteria | 3415 | Open in IMG/M |
| 3300006755|Ga0079222_11301446 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 662 | Open in IMG/M |
| 3300006755|Ga0079222_12584204 | Not Available | 510 | Open in IMG/M |
| 3300006796|Ga0066665_10621727 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 864 | Open in IMG/M |
| 3300006806|Ga0079220_10248921 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1062 | Open in IMG/M |
| 3300006806|Ga0079220_11536605 | Not Available | 573 | Open in IMG/M |
| 3300006844|Ga0075428_101523647 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 700 | Open in IMG/M |
| 3300006845|Ga0075421_100021888 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 8046 | Open in IMG/M |
| 3300006846|Ga0075430_100096206 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2475 | Open in IMG/M |
| 3300006852|Ga0075433_10040077 | All Organisms → cellular organisms → Bacteria | 4053 | Open in IMG/M |
| 3300006853|Ga0075420_100576565 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 971 | Open in IMG/M |
| 3300006854|Ga0075425_100330085 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1756 | Open in IMG/M |
| 3300006871|Ga0075434_101455630 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 695 | Open in IMG/M |
| 3300006904|Ga0075424_100662120 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300007076|Ga0075435_100230655 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1573 | Open in IMG/M |
| 3300009012|Ga0066710_100197077 | All Organisms → cellular organisms → Bacteria | 2862 | Open in IMG/M |
| 3300009090|Ga0099827_10100613 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2297 | Open in IMG/M |
| 3300009090|Ga0099827_11571498 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 573 | Open in IMG/M |
| 3300009137|Ga0066709_100028923 | All Organisms → cellular organisms → Bacteria | 5820 | Open in IMG/M |
| 3300009162|Ga0075423_12487920 | Not Available | 565 | Open in IMG/M |
| 3300009789|Ga0126307_10196130 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1620 | Open in IMG/M |
| 3300010038|Ga0126315_11220389 | Not Available | 511 | Open in IMG/M |
| 3300010039|Ga0126309_10340516 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 879 | Open in IMG/M |
| 3300010044|Ga0126310_11732447 | Not Available | 520 | Open in IMG/M |
| 3300010146|Ga0126320_1111874 | Not Available | 575 | Open in IMG/M |
| 3300010166|Ga0126306_11628911 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 538 | Open in IMG/M |
| 3300010371|Ga0134125_10989748 | Not Available | 922 | Open in IMG/M |
| 3300010373|Ga0134128_12346385 | Not Available | 588 | Open in IMG/M |
| 3300010396|Ga0134126_10090144 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 3782 | Open in IMG/M |
| 3300011332|Ga0126317_10394604 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 608 | Open in IMG/M |
| 3300011333|Ga0127502_10700282 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 786 | Open in IMG/M |
| 3300011431|Ga0137438_1068802 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1062 | Open in IMG/M |
| 3300012212|Ga0150985_100380352 | Not Available | 823 | Open in IMG/M |
| 3300012212|Ga0150985_102759962 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 3226 | Open in IMG/M |
| 3300012212|Ga0150985_105889714 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1253 | Open in IMG/M |
| 3300012212|Ga0150985_112077671 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 766 | Open in IMG/M |
| 3300012212|Ga0150985_121439527 | Not Available | 914 | Open in IMG/M |
| 3300012355|Ga0137369_10666259 | Not Available | 718 | Open in IMG/M |
| 3300012360|Ga0137375_10093527 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 3087 | Open in IMG/M |
| 3300012469|Ga0150984_101431907 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 895 | Open in IMG/M |
| 3300012469|Ga0150984_106458153 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 844 | Open in IMG/M |
| 3300012469|Ga0150984_107965159 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2560 | Open in IMG/M |
| 3300012469|Ga0150984_114239957 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 839 | Open in IMG/M |
| 3300012469|Ga0150984_114976880 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 877 | Open in IMG/M |
| 3300012917|Ga0137395_10509869 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 866 | Open in IMG/M |
| 3300012922|Ga0137394_10344621 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1272 | Open in IMG/M |
| 3300012929|Ga0137404_10268166 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1471 | Open in IMG/M |
| 3300012931|Ga0153915_10455718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1456 | Open in IMG/M |
| 3300012957|Ga0164303_10282093 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 969 | Open in IMG/M |
| 3300012958|Ga0164299_10989254 | Not Available | 619 | Open in IMG/M |
| 3300015086|Ga0167655_1007274 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2276 | Open in IMG/M |
| 3300015373|Ga0132257_100056519 | All Organisms → cellular organisms → Bacteria | 4390 | Open in IMG/M |
| 3300015374|Ga0132255_100275559 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2412 | Open in IMG/M |
| 3300017695|Ga0180121_10434040 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 513 | Open in IMG/M |
| 3300017997|Ga0184610_1298488 | Not Available | 531 | Open in IMG/M |
| 3300018027|Ga0184605_10099572 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1282 | Open in IMG/M |
| 3300018027|Ga0184605_10421691 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 592 | Open in IMG/M |
| 3300018059|Ga0184615_10469273 | Not Available | 681 | Open in IMG/M |
| 3300018061|Ga0184619_10092412 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1353 | Open in IMG/M |
| 3300018071|Ga0184618_10051445 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1499 | Open in IMG/M |
| 3300018431|Ga0066655_10419019 | Not Available | 883 | Open in IMG/M |
| 3300018465|Ga0190269_10371470 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 871 | Open in IMG/M |
| 3300018466|Ga0190268_10659778 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 757 | Open in IMG/M |
| 3300019254|Ga0184641_1006378 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1010 | Open in IMG/M |
| 3300019255|Ga0184643_1229875 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 845 | Open in IMG/M |
| 3300019255|Ga0184643_1379347 | Not Available | 718 | Open in IMG/M |
| 3300019269|Ga0184644_1071688 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 727 | Open in IMG/M |
| 3300021078|Ga0210381_10104471 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 923 | Open in IMG/M |
| 3300025327|Ga0209751_10792552 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 740 | Open in IMG/M |
| 3300025910|Ga0207684_11208302 | Not Available | 626 | Open in IMG/M |
| 3300025939|Ga0207665_10485114 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300025993|Ga0208415_1001376 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2145 | Open in IMG/M |
| 3300025996|Ga0208777_1011307 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 756 | Open in IMG/M |
| 3300025998|Ga0208651_1009856 | Not Available | 753 | Open in IMG/M |
| 3300026000|Ga0208143_102548 | Not Available | 686 | Open in IMG/M |
| 3300026004|Ga0208416_1002880 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1289 | Open in IMG/M |
| 3300026020|Ga0208531_1000690 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2684 | Open in IMG/M |
| 3300026075|Ga0207708_11566098 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 579 | Open in IMG/M |
| 3300026088|Ga0207641_10132786 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2237 | Open in IMG/M |
| 3300026095|Ga0207676_10013848 | All Organisms → cellular organisms → Bacteria | 5790 | Open in IMG/M |
| 3300026095|Ga0207676_10023221 | All Organisms → cellular organisms → Bacteria | 4572 | Open in IMG/M |
| 3300027775|Ga0209177_10131690 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 829 | Open in IMG/M |
| 3300027778|Ga0209464_10067707 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1193 | Open in IMG/M |
| 3300027843|Ga0209798_10000773 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 19632 | Open in IMG/M |
| 3300027909|Ga0209382_10146637 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2737 | Open in IMG/M |
| 3300028720|Ga0307317_10187016 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 698 | Open in IMG/M |
| 3300028771|Ga0307320_10087437 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1176 | Open in IMG/M |
| 3300028784|Ga0307282_10014652 | All Organisms → cellular organisms → Bacteria | 3209 | Open in IMG/M |
| 3300028799|Ga0307284_10006013 | All Organisms → cellular organisms → Bacteria | 3428 | Open in IMG/M |
| 3300028799|Ga0307284_10453706 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 525 | Open in IMG/M |
| 3300028814|Ga0307302_10136459 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1184 | Open in IMG/M |
| 3300028824|Ga0307310_10065868 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1545 | Open in IMG/M |
| 3300028824|Ga0307310_10559322 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 580 | Open in IMG/M |
| 3300028881|Ga0307277_10455753 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 573 | Open in IMG/M |
| 3300028885|Ga0307304_10201506 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 852 | Open in IMG/M |
| 3300030904|Ga0308198_1053424 | Not Available | 631 | Open in IMG/M |
| 3300030904|Ga0308198_1062498 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 597 | Open in IMG/M |
| 3300030990|Ga0308178_1107012 | Not Available | 600 | Open in IMG/M |
| 3300030993|Ga0308190_1148347 | Not Available | 556 | Open in IMG/M |
| 3300031093|Ga0308197_10238864 | Not Available | 639 | Open in IMG/M |
| 3300031093|Ga0308197_10313041 | Not Available | 583 | Open in IMG/M |
| 3300031094|Ga0308199_1104102 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 629 | Open in IMG/M |
| 3300031098|Ga0308191_1044534 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 502 | Open in IMG/M |
| 3300031114|Ga0308187_10163553 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 752 | Open in IMG/M |
| 3300031114|Ga0308187_10217982 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 677 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10230066 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 523 | Open in IMG/M |
| 3300031421|Ga0308194_10197234 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 649 | Open in IMG/M |
| 3300031548|Ga0307408_100043063 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 3211 | Open in IMG/M |
| 3300031548|Ga0307408_100170794 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1736 | Open in IMG/M |
| 3300031720|Ga0307469_10878152 | Not Available | 829 | Open in IMG/M |
| 3300031731|Ga0307405_11841270 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 539 | Open in IMG/M |
| 3300031824|Ga0307413_10041495 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2695 | Open in IMG/M |
| 3300031824|Ga0307413_10257188 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1299 | Open in IMG/M |
| 3300031852|Ga0307410_10019221 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 4151 | Open in IMG/M |
| 3300031903|Ga0307407_11394799 | Not Available | 552 | Open in IMG/M |
| 3300031903|Ga0307407_11460643 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 540 | Open in IMG/M |
| 3300031938|Ga0308175_100009189 | All Organisms → cellular organisms → Bacteria | 7322 | Open in IMG/M |
| 3300031938|Ga0308175_100634531 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1153 | Open in IMG/M |
| 3300031939|Ga0308174_11975380 | Not Available | 502 | Open in IMG/M |
| 3300031965|Ga0326597_10004202 | All Organisms → cellular organisms → Bacteria | 20330 | Open in IMG/M |
| 3300031965|Ga0326597_10267363 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1963 | Open in IMG/M |
| 3300032002|Ga0307416_100394968 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1418 | Open in IMG/M |
| 3300033412|Ga0310810_10014411 | All Organisms → cellular organisms → Bacteria | 9366 | Open in IMG/M |
| 3300033551|Ga0247830_10251791 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1338 | Open in IMG/M |
| 3300034099|Ga0373902_025939 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1126 | Open in IMG/M |
| 3300034644|Ga0370548_125214 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 540 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.79% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 7.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 5.52% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.29% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.68% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.07% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.07% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.07% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.07% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 3.07% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 2.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.45% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.84% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.84% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.23% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.23% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.23% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.61% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.61% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.61% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.61% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.61% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.61% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.61% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.61% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005206 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300005877 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_404 | Environmental | Open in IMG/M |
| 3300005884 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 | Environmental | Open in IMG/M |
| 3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
| 3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300015086 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5c, rocky medial moraine) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025996 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 (SPAdes) | Environmental | Open in IMG/M |
| 3300025998 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 (SPAdes) | Environmental | Open in IMG/M |
| 3300026000 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026004 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 (SPAdes) | Environmental | Open in IMG/M |
| 3300026020 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031098 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_186 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034099 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.3 | Engineered | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_03518150 | 2199352024 | Soil | SGARQIRATPAPYHQMKGFPMSRITTKWLVLASLTLAGLTTSACTRNDATGPSDQPKPSFEGQGSNT |
| INPhiseqgaiiFebDRAFT_1055613152 | 3300000364 | Soil | MSRTTTKWLVLASLALAGLTTTACTRSDATGPSDQPQPSFEGQGANN* |
| JGI11643J12802_115889182 | 3300000890 | Soil | MKGFPMSRITTKWLLLASLTLAGLTTSACTRTDATGPSDQPKPSFEGQGSNT* |
| JGI10216J12902_1019720302 | 3300000956 | Soil | MSRSTTKWLAIASLTLATLTSAACTRSDATGPSESTTPAFETQGANN* |
| JGI10216J12902_1142275342 | 3300000956 | Soil | MSRPTTKWILLASLALAALTSTACTRNDTTGPSDQTAPSFEGQGANNGPHP* |
| JGI10216J12902_1223058862 | 3300000956 | Soil | AMSRTTTKWLVLASLALAGLTTAACTRSDATGPSDQPQPSFEGQGANN* |
| soilL1_100150916 | 3300003267 | Sugarcane Root And Bulk Soil | MSRSTKWILIASLTIAGITSSACTRMDATGPSDQTVPAFETQGANN* |
| soilL2_100090874 | 3300003319 | Sugarcane Root And Bulk Soil | MKGFPMSRLTTKWLVLASLTVAGLASTACTRSDATGPSDQPKPSLEGQGAHN* |
| soilH1_102977792 | 3300003321 | Sugarcane Root And Bulk Soil | MKGYPMSRISTKWLVIASLTLAGLTSSACTRSDATGPSDQPKPSLEGQGAHN* |
| soilH2_101400891 | 3300003324 | Sugarcane Root And Bulk Soil | MKGYPMSRISTKWLVIASLTLAGLTSSACTRSDATGPSDQPQPSFEGQGANN* |
| Ga0062590_1011654822 | 3300004157 | Soil | MSRTTTRWILLASLTIAGITSAACTRNDAMGPSDQTAPAFENQGSNN* |
| Ga0062591_1011077472 | 3300004643 | Soil | RITTKWLLLASLTLAGLTTSACTRTDATGPSDQPKPSFEGQGSNT* |
| Ga0058858_11288591 | 3300004785 | Host-Associated | LALPPKPTRPLKGKIMSRTATKWVVLVSLTLAAITSTACTRGDATGPSDQPAPSFEAQGANN* |
| Ga0058862_120484792 | 3300004803 | Host-Associated | MSRSTTKWLAIASLTLATLTSAACTRSDATGPSESTAPSFETQGANN* |
| Ga0062381_100972631 | 3300004808 | Wetland Sediment | MSRTTTKWLAIVTLTLAALTSAACTRTDATGPSESSAPAFETQGANN* |
| Ga0062594_1005660052 | 3300005093 | Soil | MSRRTAQWFAIASLVLASFTTACTRSDATGPSADQTAPSFEGQGANN* |
| Ga0066683_106703131 | 3300005172 | Soil | MSRPTTKWLVLASLTLAALSSSACTRSDATGPSDQPAPSFEGQ |
| Ga0068995_100265521 | 3300005206 | Natural And Restored Wetlands | MSLPTTKWIVLATLTVAALTSTACTRTDATGPSDQTAPSFEGQGANNGPRP* |
| Ga0066388_1007235572 | 3300005332 | Tropical Forest Soil | MSRPATKWIVLASLALATLTSTACTKADATGPSDQQAPSFETQGANN* |
| Ga0070708_1000183215 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRPTTKWLVLASLTLAALSSSACTRSDATGPSDQPAPSFEGQGSNN* |
| Ga0070699_1014881432 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRSTTKWLVLASLTLAGLTSTACTRADATGPSDQPAPSFEGQGANN* |
| Ga0073909_104855022 | 3300005526 | Surface Soil | LAMSRTTTKWLVLASLALAGLTTTACTRSDATGPSDQPQPSFEGQGANN* |
| Ga0058697_101229802 | 3300005562 | Agave | MKGYLMSRTATKWLVLASLAFAGLTSAACTRNDATGPSDQPAPSFETQGANN* |
| Ga0070664_1002724332 | 3300005564 | Corn Rhizosphere | MKGFPMSRITTKWLVLASLTLAGLTTSACTRNDATGPSDQPKPSFEGQGSNT* |
| Ga0068857_1003475122 | 3300005577 | Corn Rhizosphere | MSRTTTKWLVLASLTLAGLTTSACTRNDATGPSDQPKPSFEGQGAHN* |
| Ga0068864_1000109776 | 3300005618 | Switchgrass Rhizosphere | MSRTTTKWLVLASLTLAGLTTTACTRNDATGPSDQPKPSFEGQGAHN* |
| Ga0068864_1008050642 | 3300005618 | Switchgrass Rhizosphere | MPRSTTKWLAIASLTLATLTSAACTRSDATGPSESTTPAFETQGANN* |
| Ga0068863_1021510111 | 3300005841 | Switchgrass Rhizosphere | GARQIGATPAPYRQMKGFPMSRITTKWLVLASLTLAGLTTSACTRNDATGPSDQPKPSFEGQGSNT* |
| Ga0068862_1020435702 | 3300005844 | Switchgrass Rhizosphere | MSRTATKWLVLASLTLAALTSSACTRTDATGPSDQPAPSFEGQGSNN* |
| Ga0075288_10000162 | 3300005874 | Rice Paddy Soil | MSRPTTKWIVLASLTLAAITSTACTRNDATGPSEQTAPSFEVQGGNN* |
| Ga0075288_10144831 | 3300005874 | Rice Paddy Soil | MKGYPMSRISTKWLVIASLTLAGLTSAACTRGDATGPSDQPQPSFEGQGANN* |
| Ga0075296_10001892 | 3300005877 | Rice Paddy Soil | MSRPTTKWIVLASLTLAAITSTACTRNDATGPSEQTAPSFEAQGGNN* |
| Ga0075291_10026932 | 3300005884 | Rice Paddy Soil | MSRISTKWLVIASLTLAGLTSAACTRGDATGPSDQPQPSFEGQGANN* |
| Ga0075292_10579952 | 3300005887 | Rice Paddy Soil | MPRATTKWLVIASLTLAAATTACTRGDATGPSDQPAASFEAQGANN* |
| Ga0075292_10618362 | 3300005887 | Rice Paddy Soil | TPAPYRQMKGYPMSRISTKWLVIASLTLAGLTSAACTRGDATGPSDQPQPSFEGQGANN* |
| Ga0075290_10472112 | 3300005889 | Rice Paddy Soil | PDTANRKEIPMPRATTKWLVIASLTLAAATTACTRGDATGPSDQPAASFEAQGANN* |
| Ga0074057_102267151 | 3300006605 | Soil | MSRTTTKWLVLASLTLAGLSSAACTRNDATGPSEQPKPSFEGQGANN |
| Ga0079222_100098825 | 3300006755 | Agricultural Soil | MSRITTKWLVLASLTLAGLTTAACTRSDATGPSDQPKPSFDEGQGARN* |
| Ga0079222_113014462 | 3300006755 | Agricultural Soil | SRITTKWLVVAALTLAGLTSAACTSIDATGPSDQPKPSFEGRGSYN* |
| Ga0079222_125842042 | 3300006755 | Agricultural Soil | MKGYPMSRITTKWLVLASLTLAGLTSAACTRSDATGPSDQPQPSFETQGANN* |
| Ga0066665_106217272 | 3300006796 | Soil | MPSTTKWLVIASLAAATLTSAACTRTDATGPSEQSAPSFETQGSNN* |
| Ga0079220_102489211 | 3300006806 | Agricultural Soil | NPQTKGYPMSRIPTKWLVIASLSLAGLTSAACTRSDATGPSDQPQTSFEIQGANN* |
| Ga0079220_115366051 | 3300006806 | Agricultural Soil | MKGLPMSRITTKWLVLASLTLAGLASTACTRSDATGPSDQPKPSFDEGQGARN* |
| Ga0075428_1015236472 | 3300006844 | Populus Rhizosphere | MSRTATKWIVLASLTLAAFGSAACTRSDATGPSDQPARSFEAQGANN* |
| Ga0075421_1000218882 | 3300006845 | Populus Rhizosphere | MSRTATKWIVLASLTLAAFGSAACTRSDATGPSDQPAPSFEAQGANN* |
| Ga0075430_1000962062 | 3300006846 | Populus Rhizosphere | MSRTATKWIVLASLTLAAFGSAACTRSDATGPSDQPAPSFEAKGANN* |
| Ga0075433_100400775 | 3300006852 | Populus Rhizosphere | MSRTTTKWLVLASLTLAGLTSAACTRTDATGPSDQPAPSFETQGANN* |
| Ga0075420_1005765652 | 3300006853 | Populus Rhizosphere | LKGKTMSRTATKWIVLASLTLAAFGSAACTRSDATGPSDQPAPSFEAQGANN* |
| Ga0075425_1003300852 | 3300006854 | Populus Rhizosphere | MSRPATKWIVLASLTLAALTSTACTRNDTTGPSDQTTPSFEGQGANNGPHP* |
| Ga0075434_1014556301 | 3300006871 | Populus Rhizosphere | MSRLTTQWLVLASLALAGLTTSACTRNDATGPSDQPSFEGQGSNTSPPRP* |
| Ga0075424_1006621201 | 3300006904 | Populus Rhizosphere | MSRITTKWLVLASLTLAGLTTSACTRNDATGPSDQPK |
| Ga0075435_1002306554 | 3300007076 | Populus Rhizosphere | MSRPTTKWLVLASLTLAALSSSACTRSDATGPSDQPAP |
| Ga0066710_1001970774 | 3300009012 | Grasslands Soil | MPSTTKWLVIASLAAATLTSAACTRTDATGPSEQSAPSFETQGSNN |
| Ga0099827_101006132 | 3300009090 | Vadose Zone Soil | MPCATTKWLVIASLAAATLTSAACTRTDATGPSEQSAPSFEGQGANN* |
| Ga0099827_115714982 | 3300009090 | Vadose Zone Soil | MPRPTTKWLVIASLAAATLTSAACTRTDATGPSEQSAPSFENQGSNN* |
| Ga0066709_1000289235 | 3300009137 | Grasslands Soil | MSRPTTKWLVLASLTLAALSTSACTRSDATGPSDQPAPSFEGQGSNN* |
| Ga0075423_124879202 | 3300009162 | Populus Rhizosphere | MSRTATKWIVLASLTLAAFGSAACTRSDATGPSDQPAPSFE |
| Ga0126307_101961302 | 3300009789 | Serpentine Soil | MSRKTTKWVAIVSLTLATVTSTACTRTDATGPSEPVAPALENQGSNN* |
| Ga0126315_112203892 | 3300010038 | Serpentine Soil | MAHSTTKWLAIASLTVATLTSAACTRSDATGPSEPVAPAFETQGANN* |
| Ga0126309_103405162 | 3300010039 | Serpentine Soil | MSRTITKWLALASLTLAALTSTACTRNDATGPSDQVAPAFENQGSNN* |
| Ga0126310_117324472 | 3300010044 | Serpentine Soil | MSRTTTKWVAIASLTLATLTSAACTRSDATGPSEPVAPAFENQGS |
| Ga0126320_11118741 | 3300010146 | Soil | KGFPMPRPTMKWLVIASLTAATFTSAACTRTDATGPSEQQAPSFETQGSNN* |
| Ga0126306_116289112 | 3300010166 | Serpentine Soil | AIASLTLATLTSAACTRSDATGPSEPPTPVFENQGGNN* |
| Ga0134125_109897481 | 3300010371 | Terrestrial Soil | MSRTATKWLVFASLAFAAITSAACTRSDATGPSDQPAASFETQGANN* |
| Ga0134128_123463852 | 3300010373 | Terrestrial Soil | GLAMSRTTTKWLVLASLALAGLTTTACTRSDATGPSDQPQPSFEGQGANN* |
| Ga0134126_100901442 | 3300010396 | Terrestrial Soil | MSRRTAQWFAIASLVLAGFTTACTRSDATGPSADQTAPSFEGQGANN* |
| Ga0126317_103946042 | 3300011332 | Soil | MSRTTTKWLVLASLTMAALTSAACTRNDATGPSDQTTPSFENQGSNN* |
| Ga0127502_107002822 | 3300011333 | Soil | MSRATTKWIMIASLILASATTACTRSDATGPSDQPAASFDEAQGANN* |
| Ga0137438_10688022 | 3300011431 | Soil | MSRTATKWLAIASLTLATLTSAACTRSDATGPSESTTPAFETQGANN* |
| Ga0150985_1003803522 | 3300012212 | Avena Fatua Rhizosphere | MKWLVIASLTAATFTSAACTRTDATGPSEQQAPSFETQGSNN* |
| Ga0150985_1027599624 | 3300012212 | Avena Fatua Rhizosphere | MSRTTTKWLGLASLTMAALTSAACTRNDATGPSEQTTPSFENQGSNN* |
| Ga0150985_1058897142 | 3300012212 | Avena Fatua Rhizosphere | LALLPKPTRPLKGKIMSRTATKWVVLVSLTLAAITSTACTRGDATGPSDQPAPSFEAQGANN* |
| Ga0150985_1120776712 | 3300012212 | Avena Fatua Rhizosphere | LALLPKPTRPLKGKIMSRTATKWVVLVSLTLAAITSTACTRSDATGPSDQSAPSFEAQGANN* |
| Ga0150985_1214395272 | 3300012212 | Avena Fatua Rhizosphere | MPRSITKWLAIASLTLATLTSAACTRSDATGPSESTTPAFEQQGGNN* |
| Ga0137369_106662592 | 3300012355 | Vadose Zone Soil | MKGYPMSRTTTKWLALASLTLAALTSAACTRSDATGPSDQPTPAFENQGSNN* |
| Ga0137375_100935272 | 3300012360 | Vadose Zone Soil | MPRSTTKWLVLASLAAATFTSAACTRTDATGPSEQSAPSFENQGSNN* |
| Ga0150984_1014319072 | 3300012469 | Avena Fatua Rhizosphere | MKLLVIASLAAATLTSAACTRTDATGPSEQQAPSFETQGSNN* |
| Ga0150984_1064581532 | 3300012469 | Avena Fatua Rhizosphere | LALPPKPTRPLKGKIMSRTATKWVVLVSLTLAAITSTACTRSDATGPSDQSAPSFEAQGANN* |
| Ga0150984_1079651592 | 3300012469 | Avena Fatua Rhizosphere | MSRTTTKWLVLASLTMAALTSAACTRNDATGPSEQTTPSFENQGSNN* |
| Ga0150984_1142399572 | 3300012469 | Avena Fatua Rhizosphere | ATRSSERDTPMSHRTTKWLVIASLAAATIASAACTRTDATGPSEQSAPSFETQGSNN* |
| Ga0150984_1149768801 | 3300012469 | Avena Fatua Rhizosphere | VVLVSLTLAAITSTACTRGDATGPSDQPAPSFEAQGANN* |
| Ga0137395_105098692 | 3300012917 | Vadose Zone Soil | MSRPTTKWLVIASLAAATLTSAACTRTDATGPSEQSAPSFENQGSNN* |
| Ga0137394_103446212 | 3300012922 | Vadose Zone Soil | MSRTTTKWLAIASLSLATLTSAACTRSDATGPSEPITPAFETQGANN* |
| Ga0137404_102681662 | 3300012929 | Vadose Zone Soil | MSRTSTKWLVLASLTLAALTSSACTRSDATGPSDQPAPSFEGQGSNN* |
| Ga0153915_104557181 | 3300012931 | Freshwater Wetlands | MPRSTTKWLVIASLTLAAAATTACTRSDATGPSDQPAP |
| Ga0164303_102820932 | 3300012957 | Soil | MSRTTTKWLVLASLTLAGLSSAACARNDATGPSEQPKPSFEGQ |
| Ga0164299_109892541 | 3300012958 | Soil | ADWRYPRTPYRQMKGFPMSRTTTKWLVLASLTLSGLATSACTRNDATGPSDQPKPSFDEGQGAHN* |
| Ga0167655_10072743 | 3300015086 | Glacier Forefield Soil | MTRSTTKWLVIASLTLAGLTSSACTRADATGPSDQPTPSFEGQGSNN* |
| Ga0132257_1000565196 | 3300015373 | Arabidopsis Rhizosphere | MSRTTTKWIVLASLALAGLTTTACTRSDATGPSDQPQPSFEGQGANN* |
| Ga0132255_1002755594 | 3300015374 | Arabidopsis Rhizosphere | MSRITTKWLVLASLTLAGLTTSACTRNDATGPSDQPKPSFEGQGSNT* |
| Ga0180121_104340402 | 3300017695 | Polar Desert Sand | MSRTTTKWIALASLTLAALTSTACTRSDATGPSDPIAPAFENQGSNN |
| Ga0184610_12984882 | 3300017997 | Groundwater Sediment | MSRSTTKWLAIASLTLATLTSAACTRSDATGPSEVTTPAFENQGGNN |
| Ga0184605_100995722 | 3300018027 | Groundwater Sediment | MSRTTTKWLAIASLTLATLTSAACTRSDATGPSESVTPSFEGQGANN |
| Ga0184605_104216912 | 3300018027 | Groundwater Sediment | MPRSTTKWLVIASLAVATLTSAACTRTDATGPSEQAAPSFENQGSNN |
| Ga0184615_104692732 | 3300018059 | Groundwater Sediment | MSRTTTKWLAIASLTLATLTSAACTRSDATGPSEPTTPAFETQGANN |
| Ga0184619_100924122 | 3300018061 | Groundwater Sediment | MPHPTTKWLVIASLAAATLTSAACTRTDATGPSEQPAPSFENQGSNN |
| Ga0184618_100514452 | 3300018071 | Groundwater Sediment | MSRSTTKWLAIASLTLATLTSAACTRSDATGPSESTTPAFETQGANN |
| Ga0066655_104190192 | 3300018431 | Grasslands Soil | MSRPTTKWLVLASLTLAALSSSACTRSDATGPSDQPAPSFEGQGSNN |
| Ga0190269_103714701 | 3300018465 | Soil | MPRSSTKWLAIASLTLATLTSAACTRSDATGPSEPTTPAFETQGGNN |
| Ga0190268_106597781 | 3300018466 | Soil | TMSRSTTKWLAIASLTLATLTSAACTRSDATGPSESITPVFENQGGNN |
| Ga0184641_10063782 | 3300019254 | Groundwater Sediment | SSERNPPMPRSTTKWLVIASLAVATLTSAACTRTDATGPSEQAAPSFENQGSNN |
| Ga0184643_12298751 | 3300019255 | Groundwater Sediment | PYPRRQLKGNTMSRTTTKWLAIASLTLATLTSAACTRSDATGPSESVTPSFEGQGANN |
| Ga0184643_13793472 | 3300019255 | Groundwater Sediment | MPHPTTKWLVIASLAAATLTSAACTRTDATGPSEQPAPSFEMQGSNN |
| Ga0184644_10716882 | 3300019269 | Groundwater Sediment | LKGNIMSRSTTKWLAIVSLTLATLTSAACTRSDATGPSESTTPVFENQGSNN |
| Ga0210381_101044712 | 3300021078 | Groundwater Sediment | MSRSTTKWIAIASLTLATLTAAACTRSDATGPSEPTTPVFEGQGSNN |
| Ga0209751_107925521 | 3300025327 | Soil | RQLKGTAMPRSTTKWLVLASLALAGMTSTACTRSDATGPSDQVTPAFENQGSNN |
| Ga0207684_112083022 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRPTTKWLVLASLTLAALSSSACTRSDATGPSDQPA |
| Ga0207665_104851144 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | TKWLVLASLTVAALTSSACTRSDATGPSDQPAPSFEGQGSNN |
| Ga0208415_10013762 | 3300025993 | Rice Paddy Soil | MSRPTTKWIVLASLTLAAITSTACTRNDATGPSEQTAPSFEVQGGNN |
| Ga0208777_10113071 | 3300025996 | Rice Paddy Soil | RQMKGYPMSRISTKWLVIASLTLAGLTSAACTRGDATGPSDQPQPSFEGQGANN |
| Ga0208651_10098562 | 3300025998 | Rice Paddy Soil | MSRISTKWLVIASLTLAGLTSAACTRGDATGPSDQPQPSFEGQGANN |
| Ga0208143_1025482 | 3300026000 | Rice Paddy Soil | MSRPTTKWIVLASLTLAAITSTACTRNDATGPSEQTAPSFEAQGGNN |
| Ga0208416_10028803 | 3300026004 | Rice Paddy Soil | MKGYPMSRISTKWLVIASLTLAGLTSAACTRGDATGPSDQPQPSFEGQGANN |
| Ga0208531_10006903 | 3300026020 | Rice Paddy Soil | MSRPTTKWIVLASLTLAAITSTACTRNDATGPSDQTAPSFEAQGGNN |
| Ga0207708_115660982 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LALPPKPTRPLKGKIMSRTATKWVVLVSLTLAAITSTACTRGDATGPSDQPAPSFEAQGANN |
| Ga0207641_101327861 | 3300026088 | Switchgrass Rhizosphere | MSRTTTKWLVLASLTLAGLTTSACTRNDATGPSDQPKPSFEGQGAHN |
| Ga0207676_100138482 | 3300026095 | Switchgrass Rhizosphere | MSRTTTKWLVLASLTLAGLTTTACTRNDATGPSDQPKPSFEGQGAHN |
| Ga0207676_100232216 | 3300026095 | Switchgrass Rhizosphere | MPRSTTKWLAIASLTLATLTSAACTRSDATGPSESTTPAFETQGANN |
| Ga0209177_101316902 | 3300027775 | Agricultural Soil | MSRITTKWLVLASLTLAGLTTAACTRSDATGPSDQPKPSFDEGQGARN |
| Ga0209464_100677072 | 3300027778 | Wetland Sediment | MSRTTTKWLAIVTLTLAALTSAACTRTDATGPSESSAPAFETQGANN |
| Ga0209798_1000077318 | 3300027843 | Wetland Sediment | MPRSTTKWLVLASLALAGLTSTACTRGDATGPSEQPAPSFEGQGSNN |
| Ga0209382_101466373 | 3300027909 | Populus Rhizosphere | MSRTATKWIVLASLTLAAFGSAACTRSDATGPSDQPAPSFEAQGANN |
| Ga0307317_101870162 | 3300028720 | Soil | MSSTTKWLAIASLTLATLTSAACTRSDATGPSESTTPAFENQGSNN |
| Ga0307320_100874371 | 3300028771 | Soil | PTPRRQLKGNIMSRSTTKWLAIVSLTLATLTSAACTRSDATGPSESTTPVFENQGSNN |
| Ga0307282_100146526 | 3300028784 | Soil | MSRTTTKWLAIASLTLATLTSAACTRSDATGPSESVTPSFEGQ |
| Ga0307284_100060136 | 3300028799 | Soil | MPRSTTKWLVIASLAAATVTSAACTRTDATGPSEQSAPSFENQGSNN |
| Ga0307284_104537062 | 3300028799 | Soil | MSRSTTKWLAIASLTLAALTSAACTHSDATGPSESTTPAFEQQGGNN |
| Ga0307302_101364592 | 3300028814 | Soil | MSRSTTKWLAIVSLTLATLTSAACTRSDATGPSESTTPVFENQGSNN |
| Ga0307310_100658681 | 3300028824 | Soil | PRSTTKWLVIASLAAATVTSAACTRTDATGPSEQSAPSFENQGSNN |
| Ga0307310_105593221 | 3300028824 | Soil | MPRSTTKWLAIASLTLATLTSAACTRSDATGPSESITPAFEGQGSNN |
| Ga0307277_104557532 | 3300028881 | Soil | MPRSTTKWLVIASLAAATVTSAACTRTDATGPSEQSAPSFENQGANN |
| Ga0307304_102015062 | 3300028885 | Soil | MPRRTTKWLVIVSLAAATLTSAACTRTDATGPSDQPAPSFETQGSNN |
| Ga0308198_10534241 | 3300030904 | Soil | THLKGPPMSHPTTKWLVIASLAAATLTSAACTRTDATGPSEQQAPSFETQGSNN |
| Ga0308198_10624981 | 3300030904 | Soil | PDSMSPERDYPMPRSTTKWLVIASLAAATLTSAACTRTDATGPSDQPAPSLEMQGSNN |
| Ga0308178_11070123 | 3300030990 | Soil | SSERNPPMPRTTTKWLVIASLAVATLSSAACTRTDATGPSEQQAPSFETQGSNN |
| Ga0308190_11483472 | 3300030993 | Soil | MHRSTTKWLVIVSLAAATLTSAACTRTDATGPSEQQAPSFETQGSNN |
| Ga0308197_102388642 | 3300031093 | Soil | MPRTTTKWLVIASLAAATLTSAACTRTDATGPSEQQAPSFETQGSNN |
| Ga0308197_103130412 | 3300031093 | Soil | MTRTSTKWFALASLTLATLTSAACTRSDATGPSDQPAPSFEAQGANN |
| Ga0308199_11041021 | 3300031094 | Soil | RLLKGKIMTRTSTKWFALASLTLATLTSAACTRSDATGPSDQPAPSFEAQGANN |
| Ga0308191_10445342 | 3300031098 | Soil | KWLVIASLAAATLTSAACTRTDATGPSDQPAPSFEMQGSNN |
| Ga0308187_101635532 | 3300031114 | Soil | SERDSPMPRSTTKWLVIASLAAATVTSAACTRTDATGPSEQSAPSFENQGANN |
| Ga0308187_102179821 | 3300031114 | Soil | RRQLKGNIMSRSTTKWLAIVSLTLATLTSAACTRSDATGPSESTTPVFENQGSNN |
| (restricted) Ga0255310_102300662 | 3300031197 | Sandy Soil | MSRTTSKWLAIVTLALATLTSAACTRTDATGPSESSAPAFETQGANN |
| Ga0308194_101972341 | 3300031421 | Soil | MSHPTTKWLVIASLAAATLTSAACTRTDATGPSEQQAPSFETQGSNN |
| Ga0307408_1000430635 | 3300031548 | Rhizosphere | MARSTTKWLAIASLTLATLTSAACTRSDATGPSEPITPAFENQGSNN |
| Ga0307408_1001707942 | 3300031548 | Rhizosphere | MSRTTTKWFVLASLALATLTSAACTRNDATGPSDQSAPSFDEGQGSNN |
| Ga0307469_108781522 | 3300031720 | Hardwood Forest Soil | MKGLAMSRTTTKWLVLASLALAGWTTTACTRSDATGPSDQPQPSFEGQGANN |
| Ga0307405_118412702 | 3300031731 | Rhizosphere | VATDLKGNPMSRTTTKWFVLASLALATLTSAACTRNDATGPSDQSAPSFDEGQGSNN |
| Ga0307413_100414952 | 3300031824 | Rhizosphere | MSRATTKWIMIASLILASATTACTRSDATGPSDQPAASFDEAQGSNN |
| Ga0307413_102571882 | 3300031824 | Rhizosphere | AIASLTLATLTSAACTRSDATGPSEPVAPAFENQGSNN |
| Ga0307410_100192214 | 3300031852 | Rhizosphere | MSRKTTKWVAIVSLTLATVTSTACTRTDATGPSEPVAPAFENQGSNN |
| Ga0307407_113947992 | 3300031903 | Rhizosphere | MSRATTKWIMIASLILASATTACTRSDATGPSDQPAASFDEAQGANN |
| Ga0307407_114606432 | 3300031903 | Rhizosphere | PGRQLKGNPMSRKTTKWVAIVSLTLATVTSTACTRTDATGPSEPVAPAFENQGSNN |
| Ga0308175_1000091898 | 3300031938 | Soil | MSRITTKWLVLASLTIAGLTSAACTRSDATGPSDQPKPSFEGQGSYN |
| Ga0308175_1006345312 | 3300031938 | Soil | MSRTTTKWILLASLTIAGITSAACTRNDAMGPSDQTAPAFENQGSNN |
| Ga0308174_119753802 | 3300031939 | Soil | MSRTTTRWILLASLTIAGITSAACTRNDAMGPSDQTAPAFENQGSNN |
| Ga0326597_1000420218 | 3300031965 | Soil | MSRTTTRWFAIALLALGAITSAACTRTDSTGPSDQPTASFESQGGNN |
| Ga0326597_102673632 | 3300031965 | Soil | MTRSTTKWLVLASLALAGMTSAACTRSDTTGPSEQPAPSFEGQGSGN |
| Ga0307416_1003949682 | 3300032002 | Rhizosphere | MARSTTKWLAIASLTLATLTSAACTRNDATGPSEPITPAFENQGSNN |
| Ga0310810_1001441110 | 3300033412 | Soil | MSRITTKWLVLASLTLAGLTTSACTRNDATGPSDQPKPSFEGQGSNT |
| Ga0247830_102517912 | 3300033551 | Soil | MSRMTTQWLAIASLTLATLTSAACTRSDTTGPSDPITPAFESQGSGN |
| Ga0373902_025939_192_335 | 3300034099 | Sediment Slurry | MPRLTTKWLAIASLTLAAAATTACTRSDATGPSDQPAPAFENQGSNN |
| Ga0370548_125214_1_138 | 3300034644 | Soil | RSTTKWLVIVSLAAATLTSAACTRTDATGPSEQQAPSFETQGSNN |
| ⦗Top⦘ |