| Basic Information | |
|---|---|
| Family ID | F039512 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 163 |
| Average Sequence Length | 42 residues |
| Representative Sequence | KKKALDLKVRKNLKVETVDLKTLALKNIVKRELVPKIF |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 163 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 3.68 % |
| % of genes from short scaffolds (< 2000 bps) | 3.68 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (96.319 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (37.423 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.012 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (92.025 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 163 Family Scaffolds |
|---|---|---|
| PF00118 | Cpn60_TCP1 | 11.66 |
| PF05050 | Methyltransf_21 | 11.04 |
| PF01757 | Acyl_transf_3 | 10.43 |
| PF04955 | HupE_UreJ | 6.75 |
| PF13578 | Methyltransf_24 | 3.07 |
| PF09118 | GO-like_E_set | 2.45 |
| PF14552 | Tautomerase_2 | 1.84 |
| PF00271 | Helicase_C | 1.84 |
| PF02475 | Met_10 | 1.84 |
| PF10067 | DUF2306 | 1.23 |
| PF04464 | Glyphos_transf | 1.23 |
| PF03547 | Mem_trans | 1.23 |
| PF13302 | Acetyltransf_3 | 1.23 |
| PF01041 | DegT_DnrJ_EryC1 | 1.23 |
| PF00106 | adh_short | 1.23 |
| PF13847 | Methyltransf_31 | 0.61 |
| PF02410 | RsfS | 0.61 |
| PF14099 | Polysacc_lyase | 0.61 |
| PF00144 | Beta-lactamase | 0.61 |
| PF01161 | PBP | 0.61 |
| PF07995 | GSDH | 0.61 |
| PF11159 | DUF2939 | 0.61 |
| PF04298 | Zn_peptidase_2 | 0.61 |
| PF05711 | TylF | 0.61 |
| PF00009 | GTP_EFTU | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 163 Family Scaffolds |
|---|---|---|---|
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 11.66 |
| COG2370 | Hydrogenase/urease accessory protein HupE | Posttranslational modification, protein turnover, chaperones [O] | 6.75 |
| COG2520 | tRNA G37 N-methylase Trm5 | Translation, ribosomal structure and biogenesis [J] | 1.84 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 1.84 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 1.84 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 1.84 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 1.23 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 1.23 |
| COG1887 | CDP-glycerol glycerophosphotransferase, TagB/SpsB family | Cell wall/membrane/envelope biogenesis [M] | 1.23 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 1.23 |
| COG0679 | Predicted permease, AEC (auxin efflux carrier) family | General function prediction only [R] | 1.23 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 1.23 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 1.23 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 1.23 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.61 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.61 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.61 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.61 |
| COG0799 | Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunits | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.61 |
| COG2738 | Zn-dependent membrane protease YugP | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 96.32 % |
| All Organisms | root | All Organisms | 3.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300017768|Ga0187220_1128005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HTCC7211 | 768 | Open in IMG/M |
| 3300020810|Ga0181598_1252210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 648 | Open in IMG/M |
| 3300021371|Ga0213863_10251351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 757 | Open in IMG/M |
| 3300021959|Ga0222716_10393368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HTCC7211 | 807 | Open in IMG/M |
| 3300023701|Ga0228685_1033037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 775 | Open in IMG/M |
| 3300028136|Ga0228608_1116185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 738 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 37.42% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 15.34% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 7.98% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 7.36% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 6.75% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.13% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.68% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.84% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.84% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.23% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.23% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.23% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.23% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.23% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.23% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.61% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.61% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.61% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.61% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.61% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.61% |
| Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573025 | Marine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-FOS-0p8-Hyp-75m | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300001940 | Marine microbial communities from Bay of Fundy, Nova Scotia, Canada - GS006 | Environmental | Open in IMG/M |
| 3300001947 | Marine microbial communities from the Gulf of Maine, Canada - GS002 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008956 | Marine microbial communities from eastern North Pacific Ocean - P8 free-living McLane | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020051 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020177 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020184 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101409BT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020238 | Marine microbial communities from Tara Oceans - TARA_B000000475 (ERX556004-ERR599068) | Environmental | Open in IMG/M |
| 3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020601 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011506CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020810 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022900 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG | Environmental | Open in IMG/M |
| 3300022907 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022926 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
| 3300022939 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300023701 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 47R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024291 | Seawater microbial communities from Monterey Bay, California, United States - 74D | Environmental | Open in IMG/M |
| 3300024294 | Seawater microbial communities from Monterey Bay, California, United States - 78D | Environmental | Open in IMG/M |
| 3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300026479 | Seawater microbial communities from Monterey Bay, California, United States - 26D | Environmental | Open in IMG/M |
| 3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
| 3300028130 | Seawater microbial communities from Monterey Bay, California, United States - 22D | Environmental | Open in IMG/M |
| 3300028131 | Seawater microbial communities from Monterey Bay, California, United States - 53D | Environmental | Open in IMG/M |
| 3300028132 | Seawater microbial communities from Monterey Bay, California, United States - 61D | Environmental | Open in IMG/M |
| 3300028136 | Seawater microbial communities from Monterey Bay, California, United States - 9D | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GS310G0146KB_00099670 | 2189573025 | Marine Estuarine | MKKKALDLKVRKNLKVETVDLKTLHLKNIVKREPVPKIF |
| DelMOWin2010_102157492 | 3300000117 | Marine | MMXKKALDLKARKNLKXETVDLKTLHLKNIVKRELILKXF* |
| JGI20151J14362_100864212 | 3300001346 | Pelagic Marine | MMKKKALDLKARKNLKVETVDLKTLHLKNIVKRELILKIF* |
| JGI20156J14371_100851111 | 3300001347 | Pelagic Marine | QSILEKNLQKTHLQKMKKKALDLKVRKNLKAEIVDLKILALKNTVKKELNLKTF* |
| JGI20160J14292_100470781 | 3300001349 | Pelagic Marine | LQKMKKKALDLKVRKNLKAEIVDLKILALKNTVKKELNLKTF* |
| JGI20160J14292_100647173 | 3300001349 | Pelagic Marine | QKMKKKALDLKVRKNLKVETADLKTLHLKNTVKKELVPKIF* |
| JGI20157J14317_102154671 | 3300001352 | Pelagic Marine | ILEKNLQKTHLQKMKKKALDLKVRKNLKAEIVDLKILALKNTVKKELNLKTF* |
| JGI20159J14440_101348381 | 3300001353 | Pelagic Marine | LDSKARKNLKVETVDLKTLHLKNIVKRELIPKIF* |
| JGI20155J14468_100663881 | 3300001354 | Pelagic Marine | ILEKNLQKTHLQKMKKKTLDLKERKNLKVGTVDLKTLYLKNIVKRELVPKIF* |
| JGI20155J14468_100850371 | 3300001354 | Pelagic Marine | KNLQKTHLQKMKKKALDLKVRKNLKAEIVDLKILALKNTVKKELNLKTF* |
| JGI20155J14468_102275393 | 3300001354 | Pelagic Marine | NLQKTHLQKMKKKTLDLKVRKNLKVETVDLKTLALKNIVKKEINLKIF* |
| GOS2222_10066073 | 3300001940 | Marine | QRKKILTLRERKNLRAEIVDLKTLALKNIAKKELNPKIF* |
| GOS2218_10219682 | 3300001947 | Marine | LEKKLQSTHLLIQKKKALDLKVKKNLKVETVDLKTLPLKNIVKKELIPKIF* |
| Ga0073579_16607733 | 3300005239 | Marine | MKKKALGLKVRKNLKVETVDLKTLHLKNIVKRELVPKIF* |
| Ga0073579_16757752 | 3300005239 | Marine | MKKKALDLKVRKNLKVETVDLKTLHLKNIVKRELVPKIF* |
| Ga0073579_16777972 | 3300005239 | Marine | MKKKALDLRVRKNLKVEIADLKTLALKNTVKKELNLKIF* |
| Ga0078893_101627031 | 3300005837 | Marine Surface Water | EKEKVLALKVRKNSKVETVDLKTLHLKNIIKKEDNLKFF* |
| Ga0075479_101172213 | 3300006870 | Aqueous | THLQKMKKKALDLKVRKNLKVETVDLKTLHLKNIVKRELVPKIF* |
| Ga0105748_100476741 | 3300007992 | Estuary Water | KIHLQRMKKKALDLKARKNLKVETVDLKTLYLKNIVKRELIPKIF* |
| Ga0104261_10345202 | 3300008956 | Ocean Water | VCLIKQLIGKKKALDLKVRKNLKVETVDLKTLHLKNIVKRELVPKIF* |
| Ga0102960_12801691 | 3300009000 | Pond Water | MKKKAFDLKARKNLKAEIVDLKILSLKNIVKKKLDLKIF* |
| Ga0102813_11807401 | 3300009003 | Estuarine | TQRKKVLVLKERKNLKAEIVGLKTLALKNTVKKELNLKIF* |
| Ga0102957_11116391 | 3300009027 | Pond Water | KKVLVLKERKNLKAEITDLKTLALKNIVKKELDPKIF* |
| Ga0115566_102071241 | 3300009071 | Pelagic Marine | THLQRMKKKALDSKARKNLKVETVDLKILHLKNIVKRELIPKIF* |
| Ga0115566_108114732 | 3300009071 | Pelagic Marine | LVLKERKNLKAEITDLKTLALKNIVKKELDPKIF* |
| Ga0115552_12467851 | 3300009077 | Pelagic Marine | KALDLRVRKNLKVEIADLKTLALKNTVKKELNLKIF* |
| Ga0102812_106574701 | 3300009086 | Estuarine | IYLQIQIKKALVLKVRKNLRVEIADQKILALKNIVKKELDLKIF* |
| Ga0114996_112346761 | 3300009173 | Marine | YQKILQMIVKEKALVLKGRKNLKVETTDLKTSPSKNIAKKELKFKIF* |
| Ga0114993_112744302 | 3300009409 | Marine | VKEKALVLKGRKNLKVETTDLKTSPSKNIAKKELKFKIF* |
| Ga0115554_12021551 | 3300009472 | Pelagic Marine | KMKKKALDLKVKKNLKVETVDLKILHLKNIVKRELIPKIF* |
| Ga0115555_10880591 | 3300009476 | Pelagic Marine | KALILRERKNLRAEIVDLKVLVLKNIVKKEINLKIF* |
| Ga0115555_11607451 | 3300009476 | Pelagic Marine | LRKMKKKALDLKVRKNLKVETVDLKILALKNTVKKELNLKTF* |
| Ga0115569_104368073 | 3300009497 | Pelagic Marine | LQKTHLHKMKKKALDLKVRKNLKVETVDLKTLHLKNIVKKEPVPKIF* |
| Ga0115568_100227476 | 3300009498 | Pelagic Marine | LDLKVRKNLKAEIVDLKILALKNTVKKELNLKIF* |
| Ga0115564_103224061 | 3300009505 | Pelagic Marine | KKALDLKVRKNLKVETVDLKTLHLKNIVKKDLNLKIF* |
| Ga0115564_105154411 | 3300009505 | Pelagic Marine | IHLQRMKKKALDLKARKNLKVETVDLKTLYLKNIVKRELIPKIF* |
| Ga0115567_101835291 | 3300009508 | Pelagic Marine | MKKKALDLKVRKNLKVETVDLKNLHLKNIVKRELIPKIF* |
| Ga0129351_13868781 | 3300010300 | Freshwater To Marine Saline Gradient | KMKKKALDLKVRKNLKVETVDLKTLHLKNIVKRELVPKIF* |
| Ga0180120_101597373 | 3300017697 | Freshwater To Marine Saline Gradient | MKKKALDLRVRKNLKVEIADLKTLALKNTVKKELNLKIF |
| Ga0181388_11194191 | 3300017724 | Seawater | KALDLRERKNLKAEIVDLKTSALKNTVKKELNLKIF |
| Ga0181431_10610051 | 3300017735 | Seawater | IKKKKALVLRVRKNLKAEIVDQKTLVLKNTVKKDQSLKIF |
| Ga0181418_10668483 | 3300017740 | Seawater | QIKKALILRERKNLRAEIVDLKVLVLKNIVKKEINPKIF |
| Ga0181400_11379361 | 3300017752 | Seawater | HPQAQRKKALVLKVRKNLKVEIADLKISALKNIVKKEVDLKIF |
| Ga0181410_10805361 | 3300017763 | Seawater | KKALDLRVRKNLKVEIADLNTLALKNTVEKKLNLKIF |
| Ga0181406_11796811 | 3300017767 | Seawater | KALDLRLRKNLKVEITDLKTFSLKITVKKELSLKIF |
| Ga0187220_11280053 | 3300017768 | Seawater | KIHLQTQRKKVLVLKERKNLKAEITDLKTLALKNIVKKELDPKIF |
| Ga0187217_11312391 | 3300017770 | Seawater | HLQTQRKKVQVLKGRKNLKAEIVGLKTLASKNTVKKELNLKIF |
| Ga0181425_11827781 | 3300017771 | Seawater | ITQSILEKNLQKIHLTKIKKKVLDSKVRKNLKAEKVDQKILVLRNTVKKELNPKTF |
| Ga0181424_103776581 | 3300017786 | Seawater | NQTLKKIALILKERKNLKIEVIDLKILALKNIAKKGESLRVF |
| Ga0181565_107423221 | 3300017818 | Salt Marsh | KVLVLKERKNLRVEIADLKTLALKNIVKKELDLKIF |
| Ga0181552_100432614 | 3300017824 | Salt Marsh | LQKTHLQKMKKKALDLKVRKNLKVETVDLKTLHLKNIVKKELVPKIF |
| Ga0181552_100521231 | 3300017824 | Salt Marsh | IIQSILEKNLQKAHQQKMKKKALDLKVRKNLKVETVDLKTLALKNIVKRELVPKIF |
| Ga0181552_101301853 | 3300017824 | Salt Marsh | KKKALDLKVRKNLKVETVDLKTLHLKNIVKRELVPKIF |
| Ga0181552_101395121 | 3300017824 | Salt Marsh | QRMKKKALDLKARKNLKAEIVGLKILALKNTVKKELNLKTF |
| Ga0181552_105849202 | 3300017824 | Salt Marsh | LQTQRKKVLVLKERKNLRVEIADLKTLALKNIVKKELDPKFF |
| Ga0181552_105878483 | 3300017824 | Salt Marsh | VLVLKERKNLRVEIADLKTLALKNIVKKELDLKIF |
| Ga0181607_100961111 | 3300017950 | Salt Marsh | VLVSKERKNLKAEIADLKTLALKNIVKKELDPKIF |
| Ga0181607_101957563 | 3300017950 | Salt Marsh | QRKKVLVLKERKNLKAEIADLKTLALKNIVKKELDSKIF |
| Ga0181607_105230703 | 3300017950 | Salt Marsh | HLQTQRKKVLVLKERKNLKAEIADLKTLALKNIVKKELDPKIF |
| Ga0181583_101936341 | 3300017952 | Salt Marsh | PLDLKVRKNLKVETVDLKTLYLKNIVQRELVPKIF |
| Ga0181590_108291111 | 3300017967 | Salt Marsh | KKVLVLKERKNLRVEIADLKTLALKNIVKKELDLKIF |
| Ga0181576_106902481 | 3300017985 | Salt Marsh | KVLVLKERKNLKAEITDLKTLALKNTVKKELDTKIF |
| Ga0181600_102138141 | 3300018036 | Salt Marsh | QRKKVLVLKERKNLRVEIADLKTLALKNIVKKELDLKIF |
| Ga0181606_102343123 | 3300018048 | Salt Marsh | RKKVLVLKERKNLRVEIADLKTLALKNIVKKELDLKIF |
| Ga0181572_107053051 | 3300018049 | Salt Marsh | NLQKTHLQKMKKKALDLKVRKNLKVETVDLKTLHLKNIVKKELVPKIF |
| Ga0181572_108389613 | 3300018049 | Salt Marsh | HKIHLQTQRKKVLVLKERKNLKVEIADLKTLHLKNIVKRELVPKIF |
| Ga0181553_101282923 | 3300018416 | Salt Marsh | ILEKNLQKAHQQKMKKKALDLKVRKNLKVETVDLKTLALKNIVKRELVPKIF |
| Ga0181553_101786021 | 3300018416 | Salt Marsh | THLQKMKKKPLDLKVRKNLKVETVDLKILHLKNIVKRELIPKIF |
| Ga0181558_100128741 | 3300018417 | Salt Marsh | VLVLKERKNLKVEIADLKALALKNIVKKELDPKIF |
| Ga0181558_100705511 | 3300018417 | Salt Marsh | RKKILVLKERKNLRVEIADLKTLALKNIVKKELDLKIF |
| Ga0181558_101266282 | 3300018417 | Salt Marsh | MKKKALDLKARKNLKAEIVGLKILALKNTVKKELNLKTF |
| Ga0181558_102621381 | 3300018417 | Salt Marsh | KKTLVLRVRKNLKAEIVDQKNLVLKNTVKKDQSLKIF |
| Ga0181558_103283743 | 3300018417 | Salt Marsh | ALDLKVRKNLKVETVDLKTLHLKNIVKKELVPKIF |
| Ga0181558_104932172 | 3300018417 | Salt Marsh | HLQKMKKKALDLKVRKNLKVETVDLKTLHLKNIVKRELLPKIF |
| Ga0181563_100647051 | 3300018420 | Salt Marsh | MKKKALDLKVRKNLKVETVDLKTLHLKNIVKRELVPKIF |
| Ga0181563_105792172 | 3300018420 | Salt Marsh | QKTHLQKMKKKALDLKVRKNLKVETVDLKTLHLKNIVKKELVPKIF |
| Ga0181566_105196291 | 3300018426 | Salt Marsh | KAHLQKMKKKALDLKVRKNLKVETVDLKTLHLKNIVKRELVPKIF |
| Ga0181568_101101131 | 3300018428 | Salt Marsh | KMKKKALDLKVRKNLKVETVDLKTLHLKNIVKRELVPKIF |
| Ga0181564_107521541 | 3300018876 | Salt Marsh | TILPIKKKKALVLRVRKNLKAEIVDQKTLVLKNTVKKDHCLKIF |
| Ga0181562_100266706 | 3300019459 | Salt Marsh | LKIHLQTQRKKVLVLKERKNLKAEITDLKTLALKNIVKKELDPKIF |
| Ga0181562_101475963 | 3300019459 | Salt Marsh | LLMMKKKALDLRVRKNLKVEIADLKNLALKNTVKKELNLKIF |
| Ga0194029_10803691 | 3300019751 | Freshwater | MKKKALDLKVRKNLKAEIVDLKTLVLKNIVKKELNLKTF |
| Ga0181555_10325691 | 3300020051 | Salt Marsh | THLQKVKKKALDLKVRKNLKVEIADLKALALKNIVKKELDPKIF |
| Ga0181555_11346054 | 3300020051 | Salt Marsh | RKKALVLRERKNLKVEIADLKALALKNIVKKELNLKIF |
| Ga0181555_11597944 | 3300020051 | Salt Marsh | IKKKKALVLRVRKNLKAEIVDQKTLVLKNTVKKDHCLKIF |
| Ga0181595_100878652 | 3300020053 | Salt Marsh | MKKKALDLKARKNLKAEIVGLKILALKNTAKKELNLKTF |
| Ga0181595_102623481 | 3300020053 | Salt Marsh | RKKVLVLKERKNLKAEIADLKTLALKNIVKKELDSKIF |
| Ga0206125_101146313 | 3300020165 | Seawater | RKKALVLKERKNLRAEIVDLKVLVLKNIVKKINLKIF |
| Ga0181603_100290771 | 3300020174 | Salt Marsh | ILKKNLQKTHLQKMKKKALDLKVRKNLKVETVDLKTLHLKNIVKRELVPKIF |
| Ga0206124_102117471 | 3300020175 | Seawater | QTQRKKALVLRERKNLKVEIADLKVLALKNIVKKEINLKIF |
| Ga0181596_100646591 | 3300020177 | Salt Marsh | IKKKPLELKVRKNLKVETVDLKTLYLKNIVQRELVPKIF |
| Ga0181599_10659681 | 3300020178 | Salt Marsh | LQTQRKKVLVLKERKNLNVEIADLKALALKNIVQKELDPKIF |
| Ga0181573_101212784 | 3300020184 | Salt Marsh | KVLVLKERKNLKAETTDLKTLALKNIVKKELDPKIF |
| Ga0181604_100389714 | 3300020191 | Salt Marsh | ILEKNLQKTHLQKMKKKALDLKVRKNLKVETVDLKTLHLKNIVKRELVPKIF |
| Ga0181597_100379705 | 3300020194 | Salt Marsh | QVLQIIQSILEKNLQKTHLQKMKKKALDLKVRKNLKVETVDLKTLHLKNIVKRELVPKIF |
| Ga0181597_100398521 | 3300020194 | Salt Marsh | KKVLVLKERKNLNVEIADLKALALKNIVQKELDPKIF |
| Ga0181597_100965782 | 3300020194 | Salt Marsh | KKKALDLKVRKNLKVETVDLKTLHLKNIVKRELVPEIF |
| Ga0181570_100744614 | 3300020207 | Salt Marsh | PQKSHLQKIKKKPLDLKVRKNLKVETVDLKTLYLKNIVQRELVPKIF |
| Ga0211492_11008563 | 3300020238 | Marine | ERKKVLVLKGRKNLKAEIVDLKILALKNTVKKEQNLKIF |
| Ga0211505_10501571 | 3300020352 | Marine | QNQKIKALVLKERKNLKVEIADLKTLALKNIAKKEVKLKIF |
| Ga0211677_103304911 | 3300020385 | Marine | KVLVLRERKNLKVETVDLKSLHLKNIVKRQLIPKIS |
| Ga0211475_100111013 | 3300020468 | Marine | MKRKKVSDLRERKNLKVEIEDLKILPLKNIVKKDEKPKIS |
| Ga0211577_104092691 | 3300020469 | Marine | QKTHFQIQKKKVLVLRERKNLRVEIVDLKTLALKNIVKKELNLKIF |
| Ga0211579_103447871 | 3300020472 | Marine | ALLKMEKEKVLALKVRKNSKVETVDLKTLHLKNIVKKEDNLKIF |
| Ga0181557_10706181 | 3300020601 | Salt Marsh | KKAIDLKVRKNLKVETVDLKTLHLKNIVKRELVPKIF |
| Ga0181598_10276611 | 3300020810 | Salt Marsh | LQKTHLQKMKKKALDLKVRKNLKVETVDLKTLHLKNIVKRELVPKIF |
| Ga0181598_12522103 | 3300020810 | Salt Marsh | LVLQTTQSTLGKNHQKVFLLMMKKKALDLRVRKNLKVEIADLKTLALKNTVKKELNLKIF |
| Ga0206677_100577542 | 3300021085 | Seawater | TQRKKALVLRERKNLKVEIADLKALALKNIVKKELNLKIF |
| Ga0213863_102513513 | 3300021371 | Seawater | LQALQITQNILEKNLQKTYLQKMKKKALDLKVKRNLKAEIVDLKILALKNTVRKDLDLRI |
| Ga0213869_103547961 | 3300021375 | Seawater | KALDLKVKKNLKVETVDLKILHLKNIVKRKLIPKIF |
| Ga0213861_100663571 | 3300021378 | Seawater | LQKTHLQKMKKKALDLKVRKNLKVETVDLKTLHLKNIVKREPVPKIF |
| Ga0213868_106147011 | 3300021389 | Seawater | LQKKKKKILTLRERKNLRAEIVDLKTLALKNIAKKELNPKIF |
| Ga0222716_102324793 | 3300021959 | Estuarine Water | TVLVLKERKNLKVEIADLKILALKNIVKKELNLKIF |
| Ga0222716_103933683 | 3300021959 | Estuarine Water | LQKIYLQTQKKKALVLRERKNLKVEIADLKALALKNIVKKELNLKIF |
| Ga0222716_104205041 | 3300021959 | Estuarine Water | LQTQRKKALVLKERKNLRAEIVDLKVLVLKNIVKKINLKIF |
| Ga0255771_13086631 | 3300022900 | Salt Marsh | NLQKTHLQKMKKKAIDLKVRKNLKVETVDLKTLHLKNIVKRELVPKIF |
| Ga0255775_10375133 | 3300022907 | Salt Marsh | IQSILEKNLQKTHLQKMKKKALDLKVRKNLKVETVDLKTLHLKNIVKKELVPKIF |
| Ga0255773_102992311 | 3300022925 | Salt Marsh | KKKALDLKVRKNLKVETVDLKTLALKNIVKRELVPKIF |
| Ga0255753_10691714 | 3300022926 | Salt Marsh | QKAHLQKIKKKPLDLKVRKNLKVETVDLKTLYLKNIVQRELVPKIF |
| Ga0255753_10724674 | 3300022926 | Salt Marsh | TLDLKVRKNLKVETVDLKTLHLKNIVKREQVPKIF |
| Ga0255769_100533181 | 3300022927 | Salt Marsh | QIQRKKVLVLKVRKNLRVEIVDLKILALKNIVKKELDLKIF |
| Ga0255769_101327591 | 3300022927 | Salt Marsh | QIQRKKVLVLKERKNLKAEIADLKTLALKNIVKKELDSKIF |
| Ga0255758_100432331 | 3300022928 | Salt Marsh | KNLQKTHLQKMKKKALDLKVRKNLKVETVDLKTLHLKNIVKKELVPKIF |
| Ga0255754_104534883 | 3300022939 | Salt Marsh | KNLQKTPLKRMKKKALDLKARKNLKAEIVGLKILALKNTVKKELNLKTF |
| Ga0255768_101761461 | 3300023180 | Salt Marsh | QTKRKKVLVLKERKNLKVEIADLKALALKNIVKKEIDPKIF |
| Ga0228685_10330373 | 3300023701 | Seawater | QKIHLQTQRKKVLVLKERKNLKAEIADLKTLALKNIVKKELNPKIF |
| Ga0228660_10874993 | 3300024291 | Seawater | VLVLKKRKNLKAEIVGLKTLALKNTVKKELNLKIF |
| Ga0228664_11195931 | 3300024294 | Seawater | KTHLQTQRKKALVLRERKNLRVEIVDLKTLALKNIVKKELNLKIF |
| Ga0233451_101278251 | 3300024301 | Salt Marsh | SILKKNLQKAHQQMMKKKALDLKVRKNLKVETVDLKTLHLKNIVKRELVPKIF |
| Ga0209308_101646894 | 3300025869 | Pelagic Marine | QKIFLLMMKKKALDLRVRKNLKVEIADLKTLALKNTVKKELNLKIF |
| Ga0209223_100918344 | 3300025876 | Pelagic Marine | KALDLKVRKNLKVETVDLKTLHLKNIVKRELVPKIF |
| Ga0209223_101789981 | 3300025876 | Pelagic Marine | SILEKNLQKTHLQIMKKKALDLKARKNLKVETVDLKILHLKNIVKREPVPKIF |
| Ga0209309_101261631 | 3300025881 | Pelagic Marine | KNLQKTHLQKMKKKALDLKVRKNLKVETVDLKILALKNTVKKELNLKTF |
| Ga0209632_101494113 | 3300025886 | Pelagic Marine | KMKKKALDLKVRKNLKVETVDLKILALKNTVKKELNLKTF |
| Ga0209632_105633231 | 3300025886 | Pelagic Marine | IIQSILEKNLQKTHLQIMKKKALDLKARKNLKVETVDLKILHLKNIVKREPVPKIF |
| Ga0209631_100275966 | 3300025890 | Pelagic Marine | KKKALDLKVRKNLKVETVDLKTLYLKNIVKKELIPKIF |
| Ga0209631_102557091 | 3300025890 | Pelagic Marine | LQKMKKKALDLKVRKNLKAEIVDLKILALKNTVKKELNLKTF |
| Ga0209630_101301721 | 3300025892 | Pelagic Marine | KKALDLKVRKNLKVETVDLKTLHLKNIVKRELFPKIF |
| Ga0209630_103430251 | 3300025892 | Pelagic Marine | KKKALDLKARKNLKVETVDLKILHLKNIVKREPVPKIF |
| Ga0209335_100533363 | 3300025894 | Pelagic Marine | LQKMKKKALDLKVRKNLKVETVDLKTLHLKNIVKKELVPKIF |
| Ga0209335_100716251 | 3300025894 | Pelagic Marine | LQKMKKKAMDLKVRKNLKVEIVDLKTLHLKNIVKRELVLKIF |
| Ga0209335_100730376 | 3300025894 | Pelagic Marine | SILEKNLQKAHLQKMKKKALDLKVRKNLKVETADLKTLHLKNTVKKELVPKIF |
| Ga0209335_100978971 | 3300025894 | Pelagic Marine | KKKALDLKVRKNLKVETVDLKTLHLKSIVKREPVLKIF |
| Ga0209425_100655363 | 3300025897 | Pelagic Marine | LQKMKKKALDLKVRKNLKVETVDLKTLHLKNIVKKDLNLKIF |
| Ga0209425_100856291 | 3300025897 | Pelagic Marine | KALDLKARKNLKVETVDLKTLHLKNIVKRELILKIF |
| Ga0209425_101268631 | 3300025897 | Pelagic Marine | KALDLKARKNLKVETVDLKTLHLKNIVKRELIPKIF |
| Ga0209425_103159513 | 3300025897 | Pelagic Marine | HLQKMKKKALDLKVRKNLKVETVDLKILHLKNTVKRELVPKIF |
| Ga0228622_10559651 | 3300026479 | Seawater | KVLVLKERKNLKAEIADLKTLALKNIVKKELDPKIF |
| Ga0233450_101223483 | 3300028115 | Salt Marsh | HLQKMKKKPLDLKVRKNLKVETVGLKTLHLKNIVKRELVPKIF |
| Ga0228619_10423753 | 3300028130 | Seawater | LQTQRKKFLVLKERKNLKAEITDLKTLALKNIVKKELDPKIF |
| Ga0228642_11459491 | 3300028131 | Seawater | VMKKKALDLRVRKNLKVEIADLKTLALKNTVKKELNLKIF |
| Ga0228649_11716541 | 3300028132 | Seawater | KKVLVLKVRKNLKAEIADLKTLALKNIVKKELDPKIF |
| Ga0228608_11161853 | 3300028136 | Seawater | EKKRQKIFLLMMKKKALDLRVRKNLKVEIADLKTLALKNTVKKELNLKIF |
| Ga0315322_102243354 | 3300031766 | Seawater | ALVLKERKNLKAEIVDLKTLPLKNTVKKEPNLLIF |
| Ga0315322_105526311 | 3300031766 | Seawater | PIKKKKALVLRVRKNLKAEIVDQKTLVLKNTVKKDQSLKTF |
| Ga0315320_105768351 | 3300031851 | Seawater | TQRKKVLVLKERKNLKAEIADLKILALKNIVKKELNLKIF |
| Ga0315320_106669161 | 3300031851 | Seawater | QAKKVLILRERKNLRVEITGLKTLALKNIIKKDLDFKIF |
| Ga0315320_109377441 | 3300031851 | Seawater | QMGKEKVLVLRGRKNLKVEIVDLKILPLKNIVKKEYNLKIF |
| Ga0315320_109822593 | 3300031851 | Seawater | KKKVLDLRVRKNLKVEIVDLKTLPLKNTVKKEQNFKIF |
| Ga0315316_107862603 | 3300032011 | Seawater | MTILPIKKKKALVLRVRKNLKAEIVDPKTLVLKNTVKKDQSLKIF |
| Ga0315330_102096933 | 3300032047 | Seawater | LQTQRKKALVLRERKNLKVEIADLKALALKNIVKKELNLKIF |
| Ga0315315_108268841 | 3300032073 | Seawater | QRKKVQVLKERKNLKAEIVDLKTLALKNTVKKELNLKIF |
| Ga0315315_113419951 | 3300032073 | Seawater | KKVLVLKERKNLKAEIADLKTLALKNIVKKELDPKIF |
| ⦗Top⦘ |