| Basic Information | |
|---|---|
| Family ID | F039511 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 163 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MKREMKALEAKIKALREAMELFDIFQQDDEVGSALAEVEAELDKFKFK |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 162 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 49.36 % |
| % of genes near scaffold ends (potentially truncated) | 19.63 % |
| % of genes from short scaffolds (< 2000 bps) | 74.23 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.601 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (25.767 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.031 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (71.779 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.37% β-sheet: 0.00% Coil/Unstructured: 52.63% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 162 Family Scaffolds |
|---|---|---|
| PF04545 | Sigma70_r4 | 34.57 |
| PF00004 | AAA | 5.56 |
| PF00140 | Sigma70_r1_2 | 1.23 |
| PF01242 | PTPS | 0.62 |
| PF08299 | Bac_DnaA_C | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 162 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.23 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.62 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.60 % |
| All Organisms | root | All Organisms | 45.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001266|B570J13884_111544 | Not Available | 515 | Open in IMG/M |
| 3300002835|B570J40625_100097959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3643 | Open in IMG/M |
| 3300002835|B570J40625_100803310 | Not Available | 826 | Open in IMG/M |
| 3300003277|JGI25908J49247_10042189 | Not Available | 1226 | Open in IMG/M |
| 3300003754|Ga0005853_1072710 | Not Available | 563 | Open in IMG/M |
| 3300003986|Ga0063233_10101618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
| 3300004096|Ga0066177_10153423 | Not Available | 921 | Open in IMG/M |
| 3300004481|Ga0069718_10107988 | Not Available | 861 | Open in IMG/M |
| 3300004481|Ga0069718_10122345 | Not Available | 1260 | Open in IMG/M |
| 3300004481|Ga0069718_10123039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10758 | Open in IMG/M |
| 3300004481|Ga0069718_10125583 | Not Available | 1141 | Open in IMG/M |
| 3300005580|Ga0049083_10044921 | Not Available | 1566 | Open in IMG/M |
| 3300005580|Ga0049083_10052778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1433 | Open in IMG/M |
| 3300005581|Ga0049081_10328260 | Not Available | 522 | Open in IMG/M |
| 3300005582|Ga0049080_10028033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1965 | Open in IMG/M |
| 3300005584|Ga0049082_10126768 | Not Available | 890 | Open in IMG/M |
| 3300006875|Ga0075473_10007731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4202 | Open in IMG/M |
| 3300007363|Ga0075458_10004642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4473 | Open in IMG/M |
| 3300007538|Ga0099851_1070887 | Not Available | 1350 | Open in IMG/M |
| 3300007559|Ga0102828_1050661 | Not Available | 965 | Open in IMG/M |
| 3300007606|Ga0102923_1262198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300007708|Ga0102859_1022686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1647 | Open in IMG/M |
| 3300008113|Ga0114346_1285638 | Not Available | 581 | Open in IMG/M |
| 3300008266|Ga0114363_1126771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
| 3300008267|Ga0114364_1121177 | Not Available | 777 | Open in IMG/M |
| 3300008267|Ga0114364_1143159 | Not Available | 672 | Open in IMG/M |
| 3300008448|Ga0114876_1102982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1132 | Open in IMG/M |
| 3300008448|Ga0114876_1138388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 907 | Open in IMG/M |
| 3300009037|Ga0105093_10337653 | Not Available | 810 | Open in IMG/M |
| 3300009051|Ga0102864_1054828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1079 | Open in IMG/M |
| 3300009059|Ga0102830_1134517 | Not Available | 727 | Open in IMG/M |
| 3300009068|Ga0114973_10275427 | Not Available | 902 | Open in IMG/M |
| 3300009151|Ga0114962_10010410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6882 | Open in IMG/M |
| 3300009152|Ga0114980_10014719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4948 | Open in IMG/M |
| 3300009155|Ga0114968_10017280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5021 | Open in IMG/M |
| 3300009155|Ga0114968_10080780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2021 | Open in IMG/M |
| 3300009159|Ga0114978_10079606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2194 | Open in IMG/M |
| 3300009180|Ga0114979_10246562 | Not Available | 1071 | Open in IMG/M |
| 3300009181|Ga0114969_10572238 | Not Available | 623 | Open in IMG/M |
| 3300009419|Ga0114982_1001410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11649 | Open in IMG/M |
| 3300009419|Ga0114982_1224038 | Not Available | 584 | Open in IMG/M |
| 3300010354|Ga0129333_10207770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1778 | Open in IMG/M |
| 3300010885|Ga0133913_12020451 | Not Available | 1431 | Open in IMG/M |
| 3300011995|Ga0153800_1003742 | Not Available | 1412 | Open in IMG/M |
| 3300012013|Ga0153805_1032957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
| 3300012013|Ga0153805_1047033 | Not Available | 732 | Open in IMG/M |
| 3300012013|Ga0153805_1097243 | Not Available | 501 | Open in IMG/M |
| 3300012017|Ga0153801_1014420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1419 | Open in IMG/M |
| 3300012345|Ga0157139_1006813 | Not Available | 659 | Open in IMG/M |
| 3300012346|Ga0157141_1000736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8851 | Open in IMG/M |
| 3300012352|Ga0157138_1001097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4942 | Open in IMG/M |
| 3300012663|Ga0157203_1000433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13076 | Open in IMG/M |
| 3300012667|Ga0157208_10003889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2570 | Open in IMG/M |
| 3300013004|Ga0164293_10174391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1576 | Open in IMG/M |
| 3300013004|Ga0164293_10255966 | Not Available | 1233 | Open in IMG/M |
| 3300013005|Ga0164292_10338262 | Not Available | 1019 | Open in IMG/M |
| 3300013005|Ga0164292_10452939 | Not Available | 848 | Open in IMG/M |
| 3300013005|Ga0164292_11033271 | Not Available | 511 | Open in IMG/M |
| 3300013372|Ga0177922_10126860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2087 | Open in IMG/M |
| 3300013372|Ga0177922_10201782 | Not Available | 923 | Open in IMG/M |
| 3300013372|Ga0177922_10794886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3299 | Open in IMG/M |
| 3300013372|Ga0177922_10887301 | Not Available | 562 | Open in IMG/M |
| 3300014811|Ga0119960_1085489 | Not Available | 564 | Open in IMG/M |
| 3300017707|Ga0181363_1034484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
| 3300017722|Ga0181347_1071268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1024 | Open in IMG/M |
| 3300017723|Ga0181362_1048983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
| 3300017736|Ga0181365_1174195 | Not Available | 504 | Open in IMG/M |
| 3300017761|Ga0181356_1066467 | Not Available | 1217 | Open in IMG/M |
| 3300017761|Ga0181356_1234691 | Not Available | 528 | Open in IMG/M |
| 3300017766|Ga0181343_1044434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1316 | Open in IMG/M |
| 3300017766|Ga0181343_1101852 | Not Available | 815 | Open in IMG/M |
| 3300017774|Ga0181358_1145902 | Not Available | 811 | Open in IMG/M |
| 3300017777|Ga0181357_1005269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5186 | Open in IMG/M |
| 3300017777|Ga0181357_1245442 | Not Available | 624 | Open in IMG/M |
| 3300017778|Ga0181349_1134540 | Not Available | 901 | Open in IMG/M |
| 3300017784|Ga0181348_1041881 | Not Available | 1897 | Open in IMG/M |
| 3300017785|Ga0181355_1039957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2012 | Open in IMG/M |
| 3300017785|Ga0181355_1093756 | Not Available | 1246 | Open in IMG/M |
| 3300017785|Ga0181355_1093756 | Not Available | 1246 | Open in IMG/M |
| 3300017785|Ga0181355_1127772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1037 | Open in IMG/M |
| 3300017785|Ga0181355_1264870 | Not Available | 655 | Open in IMG/M |
| 3300018682|Ga0188851_1007425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1519 | Open in IMG/M |
| 3300019784|Ga0181359_1002669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5251 | Open in IMG/M |
| 3300019784|Ga0181359_1066967 | Not Available | 1365 | Open in IMG/M |
| 3300019784|Ga0181359_1072763 | Not Available | 1299 | Open in IMG/M |
| 3300019784|Ga0181359_1188150 | Not Available | 675 | Open in IMG/M |
| 3300019784|Ga0181359_1240859 | Not Available | 555 | Open in IMG/M |
| 3300019784|Ga0181359_1261066 | Not Available | 519 | Open in IMG/M |
| 3300019784|Ga0181359_1270415 | Not Available | 505 | Open in IMG/M |
| 3300020141|Ga0211732_1170945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2090 | Open in IMG/M |
| 3300020151|Ga0211736_10970042 | Not Available | 956 | Open in IMG/M |
| 3300020159|Ga0211734_10672763 | Not Available | 903 | Open in IMG/M |
| 3300020160|Ga0211733_10263470 | All Organisms → Viruses → Predicted Viral | 4513 | Open in IMG/M |
| 3300020162|Ga0211735_10036013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2518 | Open in IMG/M |
| 3300020172|Ga0211729_10141456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1163 | Open in IMG/M |
| 3300020205|Ga0211731_10045740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
| 3300020205|Ga0211731_10351255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2575 | Open in IMG/M |
| 3300020562|Ga0208597_1029115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1180 | Open in IMG/M |
| 3300020569|Ga0208229_1060275 | Not Available | 524 | Open in IMG/M |
| 3300020572|Ga0207909_1002126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4955 | Open in IMG/M |
| 3300021141|Ga0214163_1104807 | Not Available | 650 | Open in IMG/M |
| 3300021962|Ga0222713_10233348 | Not Available | 1209 | Open in IMG/M |
| 3300021963|Ga0222712_10180377 | Not Available | 1399 | Open in IMG/M |
| 3300021963|Ga0222712_10514797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
| 3300022179|Ga0181353_1076196 | Not Available | 852 | Open in IMG/M |
| 3300022179|Ga0181353_1083498 | Not Available | 804 | Open in IMG/M |
| 3300022190|Ga0181354_1124956 | Not Available | 824 | Open in IMG/M |
| 3300022198|Ga0196905_1022258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1974 | Open in IMG/M |
| 3300022407|Ga0181351_1132820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
| 3300022407|Ga0181351_1277396 | Not Available | 505 | Open in IMG/M |
| 3300024346|Ga0244775_10266547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1425 | Open in IMG/M |
| 3300024348|Ga0244776_10170757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1569 | Open in IMG/M |
| 3300025635|Ga0208147_1009583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2708 | Open in IMG/M |
| 3300025732|Ga0208784_1204926 | Not Available | 574 | Open in IMG/M |
| 3300027608|Ga0208974_1043266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1316 | Open in IMG/M |
| 3300027608|Ga0208974_1099244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
| 3300027608|Ga0208974_1108525 | Not Available | 734 | Open in IMG/M |
| 3300027621|Ga0208951_1089586 | Not Available | 849 | Open in IMG/M |
| 3300027707|Ga0209443_1293466 | Not Available | 542 | Open in IMG/M |
| 3300027710|Ga0209599_10102211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300027732|Ga0209442_1210358 | Not Available | 715 | Open in IMG/M |
| 3300027733|Ga0209297_1017551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3432 | Open in IMG/M |
| 3300027734|Ga0209087_1003853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8234 | Open in IMG/M |
| 3300027736|Ga0209190_1120396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1179 | Open in IMG/M |
| 3300027736|Ga0209190_1393820 | Not Available | 500 | Open in IMG/M |
| 3300027741|Ga0209085_1260308 | Not Available | 676 | Open in IMG/M |
| 3300027754|Ga0209596_1033668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2859 | Open in IMG/M |
| 3300027754|Ga0209596_1074228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1680 | Open in IMG/M |
| 3300027754|Ga0209596_1128971 | Not Available | 1152 | Open in IMG/M |
| 3300027756|Ga0209444_10061555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1652 | Open in IMG/M |
| 3300027772|Ga0209768_10283183 | Not Available | 704 | Open in IMG/M |
| 3300027797|Ga0209107_10125609 | Not Available | 1340 | Open in IMG/M |
| 3300027808|Ga0209354_10394041 | Not Available | 539 | Open in IMG/M |
| 3300027892|Ga0209550_10034244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4272 | Open in IMG/M |
| 3300027963|Ga0209400_1145000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1041 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1320214 | Not Available | 509 | Open in IMG/M |
| 3300031565|Ga0307379_10821590 | Not Available | 816 | Open in IMG/M |
| 3300031758|Ga0315907_10591125 | Not Available | 863 | Open in IMG/M |
| 3300031784|Ga0315899_10114063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2775 | Open in IMG/M |
| 3300031784|Ga0315899_10975815 | Not Available | 756 | Open in IMG/M |
| 3300031857|Ga0315909_10418093 | Not Available | 954 | Open in IMG/M |
| 3300031952|Ga0315294_10807041 | Not Available | 808 | Open in IMG/M |
| 3300032092|Ga0315905_10529638 | Not Available | 1079 | Open in IMG/M |
| 3300032092|Ga0315905_10897562 | Not Available | 758 | Open in IMG/M |
| 3300033816|Ga0334980_0108141 | Not Available | 1154 | Open in IMG/M |
| 3300033816|Ga0334980_0257033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300033981|Ga0334982_0060354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2072 | Open in IMG/M |
| 3300033995|Ga0335003_0498515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300034013|Ga0334991_0065822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1834 | Open in IMG/M |
| 3300034092|Ga0335010_0411832 | Not Available | 736 | Open in IMG/M |
| 3300034093|Ga0335012_0184108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1117 | Open in IMG/M |
| 3300034096|Ga0335025_0577539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300034102|Ga0335029_0015999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5736 | Open in IMG/M |
| 3300034104|Ga0335031_0087362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2210 | Open in IMG/M |
| 3300034116|Ga0335068_0000038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 118316 | Open in IMG/M |
| 3300034120|Ga0335056_0029337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3753 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 25.77% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.66% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.82% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.68% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.68% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 3.07% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.45% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.45% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 1.84% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.84% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.84% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.23% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.61% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.61% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.61% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.61% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.61% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.61% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001266 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003754 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012345 | Freshwater microbial communities from Burnt River, Ontario, Canada - S22 | Environmental | Open in IMG/M |
| 3300012346 | Freshwater microbial communities from Emily Creek, Ontario, Canada - S29 | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020569 | Freshwater microbial communities from Lake Mendota, WI - 22AUG2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J13884_1115441 | 3300001266 | Freshwater | MKPELKALEAKVKALRQAMELFDIFQQDDEVGSALAEVEAELDK |
| B570J29032_1091278293 | 3300002408 | Freshwater | MKPELKALEAKVKALRQAMELFDIFQQDDEVGSALAE |
| B570J40625_1000979597 | 3300002835 | Freshwater | MKPELKALEAKVKALRQAMELFDIFQQDDEVGSALAEVEAELDKFKFK* |
| B570J40625_1008033103 | 3300002835 | Freshwater | MKREMKPLEAKVKALRQAMELFDIFQQDDEVGSALAEVEAELEKFKFK* |
| JGI25908J49247_100421893 | 3300003277 | Freshwater Lake | MKQELKALEAKVKALRKAMELFDIFQQDDEVGSALAEVEAELEKFKFK* |
| Ga0005853_10727102 | 3300003754 | Freshwater And Sediment | MKQELKALEAKVKALRQAMELFDIFQQDDEVGSALAEVEAELDKFKFK* |
| Ga0063233_101016182 | 3300003986 | Freshwater Lake | MKRELKVLEAKIKELRRVMELFDLFQQDDEVGLALQEVEQELDKFRFK* |
| Ga0066177_101534232 | 3300004096 | Freshwater Lake | MKQELKALEAKVKALRKAMELFDIFQQDDEVGSALAEVEAELDKFKFK* |
| Ga0069718_101079881 | 3300004481 | Sediment | MKREMKALEAKIKALREKMEYWDCFQQDDEVGQALAEVEAELDKFRWK* |
| Ga0069718_101223451 | 3300004481 | Sediment | MKREMKALEAKIKALREKMEYWDCFQQDDEVGIALAEVEEELDKFRWK* |
| Ga0069718_1012303923 | 3300004481 | Sediment | MKREMKALEAKIKELRLKMEYWDCFQQDDEVGQALAEVEEELDKFRWK* |
| Ga0069718_101255833 | 3300004481 | Sediment | MKREMKALEAKIKALREKMEYWDCFQQDDEVGQALAEVEEELDKFRWK* |
| Ga0049083_100449213 | 3300005580 | Freshwater Lentic | MKQELKALDLKIKALRDVMEWYQIFQQDDEVGSALAEVEAELDKFKFK* |
| Ga0049083_100527784 | 3300005580 | Freshwater Lentic | MKREMKVLEAKIKELRRVMELFDLLQQDDEVGLALQEVEQELDKFRFK* |
| Ga0049081_103282602 | 3300005581 | Freshwater Lentic | MKQELKALDLKIKALRDVMEWYQIFQQDDEVGSALAEVEAELEKFKFK* |
| Ga0049080_100280333 | 3300005582 | Freshwater Lentic | MKREMKALEAKIQALREKMEQWQCFFQDDEVGIALAEVEEELDKFRWK* |
| Ga0049082_101267683 | 3300005584 | Freshwater Lentic | MKREMKALEAKIKALREAMELFDIFQQDDEVGSALAEVEAELDKFKFK* |
| Ga0075473_100077317 | 3300006875 | Aqueous | MKKELRVLEAKLKALREKMEFWECFFQDDEVGQALAEVEAELEKFRFK* |
| Ga0075458_100046429 | 3300007363 | Aqueous | MKKELRVLEAKLKALREKMEFWECFFQDDEVGQALAEVEAELEQFRFK* |
| Ga0099851_10708872 | 3300007538 | Aqueous | MSALKDVKREHMKKEIRELEARIKELRRLMEFFEIFQQDDEVGQALAEVEAELEKFRFK* |
| Ga0102828_10506612 | 3300007559 | Estuarine | MKTEMKALEAKIKALRSIMEKWECFFQDDEVGLALAEVEAELDKFKFK* |
| Ga0102923_12621981 | 3300007606 | Estuarine | HIQLRDMKREMKPLEAKIKALREAMELFDIFQQDDEVGSALAEVEAELEKFKFK* |
| Ga0102859_10226865 | 3300007708 | Estuarine | MKNEMRVLEAKIKELRSIMEKWECFFQDDEVGIALAEVEAELAKFRFK* |
| Ga0114346_12856382 | 3300008113 | Freshwater, Plankton | MKKELRELEAKIKALRAKMEQWECFFQDDEVGIALAEVEEELDKFRFK* |
| Ga0114363_11267712 | 3300008266 | Freshwater, Plankton | MLALADVKESMKKELKELEAKLKALREAMERYDVFQQDDEIGLALAEVEAELANPDSDKKV* |
| Ga0114364_11211772 | 3300008267 | Freshwater, Plankton | MKREMKALEAKIKALREKMEYWDIFQQDDEVGTALAEVEAELELFKFK* |
| Ga0114364_11431592 | 3300008267 | Freshwater, Plankton | MKREMKALEAKIQALREKMEQWECFFQDDEVGIALAEVEEELDKFRWK* |
| Ga0114876_11029821 | 3300008448 | Freshwater Lake | PELKALEAKVKALRQAMELFDIFQQDDEVGSALAEVEAELEKFKFK* |
| Ga0114876_11383882 | 3300008448 | Freshwater Lake | MKREMKVLEAKVKELRRVMELFDLFQQDDEVGLALQEVEQEFDKFRFK* |
| Ga0105093_103376533 | 3300009037 | Freshwater Sediment | MRELEAKLKALRSKMEYWECFFQDDEVGIALAELEAEFEKFHVPVKQFK |
| Ga0102864_10548282 | 3300009051 | Estuarine | MKPELKALEAKVKALRNAMELFDIFQQDDEVGSALAEVEAELDKFKFK* |
| Ga0102830_11345171 | 3300009059 | Estuarine | MKKELRVLEAKIKRLRTIMEDWQCFFQDDEVGIALAEVEEELEKFRFK* |
| Ga0114973_102754272 | 3300009068 | Freshwater Lake | MKREMKALEAKIQALRAKMEQWECFFQDDEVGIALAEVEEELDKFRFK* |
| Ga0114962_100104106 | 3300009151 | Freshwater Lake | MKREMKTLEAKIKALRVAMELFDIFQQDDEVGSALAEVEAELDKFKFK* |
| Ga0114980_100147193 | 3300009152 | Freshwater Lake | MKREMKPLEAKIKALREAMELFDIFQQDDEVGSALAEVEAELDKFKFK* |
| Ga0114968_1001728012 | 3300009155 | Freshwater Lake | MKRELKALEAKIKALRQAMELFDIFQQDDEVGSALAEVEAELEKFKFK* |
| Ga0114968_100807801 | 3300009155 | Freshwater Lake | MLNLIVESMKQEMKALEAKIKALRDVMEWYQIFQQDDEVGSALAEVEAELDKFKFK* |
| Ga0114978_100796063 | 3300009159 | Freshwater Lake | MKPELKALEAKVKALRQAMELFDIFQQDDEVGSALAEVEAELEKFKFK* |
| Ga0114979_102465623 | 3300009180 | Freshwater Lake | MKKELRELEAKLKALREAMERYDVFQQDDEVGQALAEVEAELGLKKV* |
| Ga0114969_101889901 | 3300009181 | Freshwater Lake | MLNLIVESMKQEMKALEAKIKALRDVMEWYQIFQQDDEVGSALAEV |
| Ga0114969_105722381 | 3300009181 | Freshwater Lake | MKPELKALEAKIKALRSIMEKWECFFQDDEVGLALAEVEAELDKFKFK* |
| Ga0114982_10014107 | 3300009419 | Deep Subsurface | MKREMKPLEAKIKALREAMELFDIFQQDDEVGSALAEVEAELEKFKFK* |
| Ga0114982_12240382 | 3300009419 | Deep Subsurface | MKREMKPLEAKIKALREAMELFDIFQQDDEVGSALAEVEVELDKFKFK* |
| Ga0129333_102077702 | 3300010354 | Freshwater To Marine Saline Gradient | MLALADVKESMKKELKELEAKLKALREAMERYDVFQQDDEIGLALAEVEAELDQFRFR* |
| Ga0133913_120204512 | 3300010885 | Freshwater Lake | MKREMKALEAKIQALRAKMEQWECFFQDDEVGIALAEVEEELDKFRYK* |
| Ga0153800_10037424 | 3300011995 | Freshwater | MKREMKPLEAKIKALREAMELFDIFQQDDEVGLALAEVEAELEKFKFK* |
| Ga0153805_10329571 | 3300012013 | Surface Ice | LREAMERYDLFQQDDEVGLALAEVEAELDKFRFR* |
| Ga0153805_10470331 | 3300012013 | Surface Ice | MKREMNPLEAKIKELRAIMEKWECFFQDDEVGIALAEVEAELEKFKFK* |
| Ga0153805_10972431 | 3300012013 | Surface Ice | MKREMKALEAKIQALRAKMEQWECFFQDDEVGIALAEVEEELDKFRWK* |
| Ga0153801_10144202 | 3300012017 | Freshwater | MKPELKALEAKVKALRKAMELFDIFQQDDEVGSALAEVEAELDKFKFK* |
| Ga0153801_10369253 | 3300012017 | Freshwater | MKREMKALEAKIQALREKMEQWQCFFQDDEVGIAL |
| Ga0157139_10068132 | 3300012345 | Freshwater | IKMLIFNKIKRDMKREMKALEAKIQALREKMEQWECFFQDDEVGIALAEVEEELDKFRWK |
| Ga0157141_100073610 | 3300012346 | Freshwater | MRELEAKLKALRSKMEYWECFFQDDEVGIALAELEAEFEKFHVPVQQFKKSLKKLQKD* |
| Ga0157138_10010971 | 3300012352 | Freshwater | MKREMKPLEEKIKALRSIMEYWECFFQDDEVGLALAEVEAELD |
| Ga0157203_100043315 | 3300012663 | Freshwater | MKREMKELEAKIRALREKMEYWDIFQQDDEVGTALAEVEAELDEFRFK* |
| Ga0157208_100038892 | 3300012667 | Freshwater | MKRELKALELILKALREAMELFDIFQQDDEVGSALAEVEAELEKFRFK* |
| Ga0164293_101743912 | 3300013004 | Freshwater | MKRELKALEAKVRELRNIMESYDLFQQDDEVGQALKDVEAELDEFRFK* |
| Ga0164293_102559662 | 3300013004 | Freshwater | MLIFNKIKRDMKREMKELEAKIKALRSIMEYWECFFQDDEVGIALAEVEEELDKFRFK* |
| Ga0164292_103382622 | 3300013005 | Freshwater | LNTNKDISLSPGSAEMSALKDVKREHMKKEIRELEARIKELRRLMEFFEIFQQDDEVGQALAEVEAELEKFRFK* |
| Ga0164292_104529392 | 3300013005 | Freshwater | MKREMKELEAKIKALRSIMEYWECFFQDDEVGIALAEVEEELDKFRFK* |
| Ga0164292_110332712 | 3300013005 | Freshwater | MKREMKELEAKIKALRAIMEYWECFFQDDEVGIALAEVEAELDKFRFK* |
| Ga0177922_101268601 | 3300013372 | Freshwater | MKREMKALEAKIKALREKIEFIDYLLAPDNEVGIALAEVEEELDKFKFK* |
| Ga0177922_102017821 | 3300013372 | Freshwater | MKREMKPLEAKIKELRAIMEKWECFFQDDEVGIALAEVEAELEKFKFK* |
| Ga0177922_102636653 | 3300013372 | Freshwater | MKREMKALEAKIKALREAMELFDIFQQDDEVGSALAEV |
| Ga0177922_107948863 | 3300013372 | Freshwater | MLALADVKERHMKKELKELEAKLKTLREAMERYDLFQQDDEVGLALAEVEAELDKFRFR* |
| Ga0177922_108873011 | 3300013372 | Freshwater | LEAKIKALREAMELFDIFQQDDEVGSALAEVEAELDKFKFK* |
| Ga0119960_10854891 | 3300014811 | Aquatic | KERDMKKELRVLEAKLKALREKMEFWECFFQDDEVGQALAEVEAELEQFRFK* |
| Ga0181363_10344842 | 3300017707 | Freshwater Lake | MKRELKALEAKIRELRNIMESYDLFQQDDEVGQALKDVEAELDKFRFK |
| Ga0181347_10712683 | 3300017722 | Freshwater Lake | MKPELKALEAKVKALRQAMELFDIFQQDDEVGSALAEVEAEL |
| Ga0181362_10489831 | 3300017723 | Freshwater Lake | KVKALRQAMELFDIFQQDDEVGSALAEVEAELDKFKFK |
| Ga0181365_11741951 | 3300017736 | Freshwater Lake | MKREMKALEAKIKALREAMELFDIFQQDDEVGTALAEVEAELEKFKFK |
| Ga0181356_10664673 | 3300017761 | Freshwater Lake | MKPELRVLEAKIKELRSIMEKWECFFQDDEVGIALAEVEAELEKFKFK |
| Ga0181356_12346912 | 3300017761 | Freshwater Lake | MKREMKALEAKIKALREKIEFIDYLLAPDNEVGPALAEVEEELDKFRWK |
| Ga0181343_10444343 | 3300017766 | Freshwater Lake | MKREMKALEAKIKELRNAMELFDIFQQDDEVGSALAEVEAELDKFKFK |
| Ga0181343_11018522 | 3300017766 | Freshwater Lake | MKRELKELEAKIKRLRTIMEYWQCFFQDDEVGIALAEVEEELEKFRFK |
| Ga0181358_11459023 | 3300017774 | Freshwater Lake | DLKIKALRDVMEWYQIFQQDDEVGSALAEVEAELEKFKFK |
| Ga0181357_100526910 | 3300017777 | Freshwater Lake | MKRELKALEAKVKALRQAMELFDIFQQDDEVGSALAEVEVELEKFRFK |
| Ga0181357_12454421 | 3300017777 | Freshwater Lake | REMKPLEAKIKALREAMELFDIFQQDDEVGSALAEVEAELEKFKFK |
| Ga0181349_11345401 | 3300017778 | Freshwater Lake | LKVLEAKIKELRRVMELFDLFQQDDEVGLALQEVEQELDKFRFK |
| Ga0181348_10418815 | 3300017784 | Freshwater Lake | MKREMKALEAKIKALREAMELFDIFQQDDEVGLALAEVEAELEKFKFK |
| Ga0181355_10399572 | 3300017785 | Freshwater Lake | MKREMKVLEAKVKELRRVMELFDLFQQDDEVGLALQEVEQELDKFRFK |
| Ga0181355_10937561 | 3300017785 | Freshwater Lake | LRAMKREMKPLEAKIKALREAMELFDIFQQDDEVGLALAEVEAELEKFKFK |
| Ga0181355_10937563 | 3300017785 | Freshwater Lake | MKPEMRVLEAKIKELRSIMEKWECFFQDDEVGIALAEVEAELEKFKFK |
| Ga0181355_11277721 | 3300017785 | Freshwater Lake | AMKREMKPLEAKIKALREAMELFDIFQQDDEVGTALAEVEAELEKFKFK |
| Ga0181355_12648701 | 3300017785 | Freshwater Lake | MKREMKALEAKIKALREKMEYWDIFQQDDEVGTALAEVEA |
| Ga0188851_10074252 | 3300018682 | Freshwater Lake | MKPEMKALEAKIKALRDVMEWYQIFHQDDEVGLALAEVEAELDKFKFK |
| Ga0181359_10026697 | 3300019784 | Freshwater Lake | MKREMKALEAKIQALRAKMEQWECFFQDDEVGIALAEVEEELDKFRFK |
| Ga0181359_10669674 | 3300019784 | Freshwater Lake | MKREMKPLEAKIKALREAMELFDIFQQDDEVGLALAEVEAELEKFKFK |
| Ga0181359_10727634 | 3300019784 | Freshwater Lake | MKREMKALEAKIKALREAMELFDIFQQDDEVGSALAEVEAELDKFKFK |
| Ga0181359_11126264 | 3300019784 | Freshwater Lake | MKRELKVLEAKIKELRRVMELFDLFQQDDEVGLALQEVS |
| Ga0181359_11881501 | 3300019784 | Freshwater Lake | MKREMKPLEAKIKALREAMELFDIFQQDDEVGSALAEVEAELEKFKFK |
| Ga0181359_12408592 | 3300019784 | Freshwater Lake | MKPELKALDLKIKALRDVMEWYQIFQQDDEVGLALAEVEAELAKFKFK |
| Ga0181359_12610661 | 3300019784 | Freshwater Lake | DMKREMKALEAKIKALREKMEYWDIFQQDDEVGTALAEVEAELELFKFK |
| Ga0181359_12704153 | 3300019784 | Freshwater Lake | MKREMKALEAKIKALREKMEYWDIFQQDDEVGTALAEVEAE |
| Ga0211732_11709454 | 3300020141 | Freshwater | MKREMKELEAKIKELRLKMEYWDCFQQDDEVGQALAEVEEELDKFRWK |
| Ga0211736_109700422 | 3300020151 | Freshwater | MKPEMKALEAKIKALRSIMEKWECFFQDDEVGLALAEVEAELDKFKFK |
| Ga0211734_106727632 | 3300020159 | Freshwater | MKREMKALEAKIKELRLKMEYWDCFQQDDEVGQALAEVEEELDKFRWK |
| Ga0211733_1026347014 | 3300020160 | Freshwater | MKELEEKIKELRSKMEYWECFFQDDEVGVALKEVEEALTKIKYHESNN |
| Ga0211735_100360136 | 3300020162 | Freshwater | MKREMKELEAKIKALRATMEYWDCFQQDDEVGQALAEVEEELDKFRWK |
| Ga0211729_101414563 | 3300020172 | Freshwater | MKPEMKPLEAKIKALREAMELFDIFQQDDEVGSALAEVEAELDKFKFK |
| Ga0211731_100457401 | 3300020205 | Freshwater | MKREMKPLEAKIKALREAMELFDIFQQDDEVGSALAEVEAELDKFKFK |
| Ga0211731_103512554 | 3300020205 | Freshwater | MKREMKELEAKIKELRLKMEYWDCFQQDDEVGQALAEVEAELDKFRWK |
| Ga0208597_10291154 | 3300020562 | Freshwater | MKPELKALEAKVKALRKAMELFDIFQQDDEVGSALAEVEAELEKFRFK |
| Ga0208229_10602751 | 3300020569 | Freshwater | MKRDLKELEAKIKSLRAIMEYWECFFQDDEVGLALAEVEEELEKFRFK |
| Ga0207909_10021264 | 3300020572 | Freshwater | MKPELKALEAKVKALRQAMELFDIFQQDDEVGSALAEVEAELDKFKFK |
| Ga0214163_10872291 | 3300021141 | Freshwater | MKREMKPLEAKVKALRQAMELFDIFQQDDEVGSALAE |
| Ga0214163_11048071 | 3300021141 | Freshwater | LEAKVKALRQAMELFDIFQQDDEVGSALAEVEAELEKFKFK |
| Ga0222713_102333482 | 3300021962 | Estuarine Water | MLALADVKESMKKELKELEAKLKALREAMERYDVFQQDDEIGLALAEVEAELDQFRFR |
| Ga0222712_101803773 | 3300021963 | Estuarine Water | MKREMKPLEAKIKALREAMELFDIFQQDDEVGTALAEVEAELEKFKFK |
| Ga0222712_105147973 | 3300021963 | Estuarine Water | KALEAKVKALRSIMEKWECFFQDDEVGLALAEVEAELDKFKFK |
| Ga0181353_10761962 | 3300022179 | Freshwater Lake | MKKELKELEAKLKALREAMERYDVFQQDDEIGLALAEVEAELDQFRFR |
| Ga0181353_10834983 | 3300022179 | Freshwater Lake | MWNFTIKNKRDMKRELKALEAKVRELRNIMESYDLFQQDDEVGQALKDVEAELDEFRFK |
| Ga0181354_11249563 | 3300022190 | Freshwater Lake | MKRELKVLEAKIKELRRVMELFDLFQQDDEVGLALQEVEQELDKFRFK |
| Ga0196905_10222582 | 3300022198 | Aqueous | MSALKDVKREHMKKEIRELEARIKELRRLMEFFEIFQQDDEVGQALAEVEAELEKFRFK |
| Ga0181351_11328201 | 3300022407 | Freshwater Lake | LKIKALRDVMEWYQIFQQDDEVGSALAEVEAELEKFKFK |
| Ga0181351_12773961 | 3300022407 | Freshwater Lake | MKPELKALEAKVKALRQAMELFDIFQQDDEVGSALAEVEAELEKFKFK |
| Ga0244775_102665473 | 3300024346 | Estuarine | MKTEMKALEAKIKALRSIMEKWECFFQDDEVGLALAEVEAELDKFKFK |
| Ga0244776_101707575 | 3300024348 | Estuarine | MKNEMRVLEAKIKELRSIMEKWECFFQDDEVGIALAEVEAELAKFRFK |
| Ga0208147_10095834 | 3300025635 | Aqueous | MKKELRVLEAKLKALREKMEFWECFFQDDEVGQALAEVEAELEQFRFK |
| Ga0208784_12049262 | 3300025732 | Aqueous | MKKELRVLEAKLKALREKMEFWECFFQDDEVGQALAEVEAELEKFRFK |
| Ga0208974_10432661 | 3300027608 | Freshwater Lentic | MKREMKALEAKIQALREKMEQWQCFFQDDEVGIALAEVEEELDKFRWK |
| Ga0208974_10992442 | 3300027608 | Freshwater Lentic | MKQELKALDLKIKALRDVMEWYQIFQQDDEVGSALAEVEAELEKFKFK |
| Ga0208974_11085252 | 3300027608 | Freshwater Lentic | MKQELKALEAKVKALRKAMELFDIFQQDDEVGSALAEVEAELEKFKFK |
| Ga0208951_10895862 | 3300027621 | Freshwater Lentic | MKQELKALEAKVKALRQAMELFDIFQQDDEVGLALAEVEAELDKFKFK |
| Ga0209769_11022941 | 3300027679 | Freshwater Lake | MKPELKALDLKIKALRDVMEWYQIFQQDDEVGSAL |
| Ga0209443_12934662 | 3300027707 | Freshwater Lake | MKQELKALDLKIKALRDVMEWYQIFQQDDEVGLALAEVEAELDKFKFK |
| Ga0209599_101022112 | 3300027710 | Deep Subsurface | MKREMKPLEAKIKALREAMELFDIFQQDDEVGSALAEVEVELDKFKFK |
| Ga0209442_12103581 | 3300027732 | Freshwater Lake | MKALDLKIKALRDVMEWYQIFQQDDEVGLALAEVEAELDKFKFK |
| Ga0209297_10175514 | 3300027733 | Freshwater Lake | MKREMKTLEAKIKALRVAMELFDIFQQDDEVGSALAEVEAELDKFKFK |
| Ga0209087_10038532 | 3300027734 | Freshwater Lake | MKKELRELEAKLKALREAMERYDVFQQDDEVGQALAEVEAELGLKKV |
| Ga0209190_11203961 | 3300027736 | Freshwater Lake | VIMKREMKVLEAKIKELRRVMELFDLLQQDDEVGLALQEVEQELDKFRFK |
| Ga0209190_13938202 | 3300027736 | Freshwater Lake | MKRELKALEAKIKALRQAMELFDIFQQDDEVGSALAEVEAELDKFKFK |
| Ga0209085_12603081 | 3300027741 | Freshwater Lake | MKREMKTLEAKIKALRVAMELFDIFQQDDEVGSALAEVEAELDKFK |
| Ga0209596_10336688 | 3300027754 | Freshwater Lake | MKPELKALEAKIKALRSIMEKWECFFQDDEVGLALAEVEAELDKFKFK |
| Ga0209596_10742281 | 3300027754 | Freshwater Lake | MKQEMKALEAKIKALRDVMEWYQIFQQDDEVGSALAEV |
| Ga0209596_11289712 | 3300027754 | Freshwater Lake | MKRELKALEAKIKALRQAMELFDIFQQDDEVGSALAEVEAELEKFKFK |
| Ga0209444_100615552 | 3300027756 | Freshwater Lake | MKQELKALDLKIKALRDVMEWYQIFQQDDEVGSALAEVEAELDKFKFK |
| Ga0209768_102831832 | 3300027772 | Freshwater Lake | MKQELKALEAKVKALRQAMELFDIFQQDDEVGSALAEVEAELDKFKFK |
| Ga0209107_101256093 | 3300027797 | Freshwater And Sediment | MKQELKALEAKVKALRKAMELFDIFQQDDEVGSALAEVEAELDKFKFK |
| Ga0209354_103940411 | 3300027808 | Freshwater Lake | EAKVKALRQAMELFDIFQQDDEVGSALAEVEAELEKFKFK |
| Ga0209550_1003424411 | 3300027892 | Freshwater Lake | MKQELKALDLKIKALRDVMEWYQIFQQDDEVGLALAEVEAELEKFKFK |
| Ga0209400_11450003 | 3300027963 | Freshwater Lake | MKQEMKALEAKIKALRDVMEWYQIFQQDDEVGSALAEVEAELDKFKFK |
| (restricted) Ga0247831_13202141 | 3300028559 | Freshwater | MKPEMKALDLKIKALRDVMEWYQIFQQDDEVGLALAEVEAELDKFKFK |
| Ga0307379_108215903 | 3300031565 | Soil | MKREMKALDLKIKALRDVMEWYQIFQQDDEVGLALAEVEAELEKFKFK |
| Ga0315907_105911251 | 3300031758 | Freshwater | MLALADVKESMKKELKELEAKLKALREAMERYDVFQQDDEIGLALAEVEAELANPDSDKK |
| Ga0315899_101140636 | 3300031784 | Freshwater | MKKELKELEAKLKALREAMERYDVFQQDDEIGLALAEVEAELANPDSDKKV |
| Ga0315899_109758151 | 3300031784 | Freshwater | MKREMKALEAKIQALRAKMEQWECFFQDDEVGIALAEVEEELDKFRWK |
| Ga0315909_104180932 | 3300031857 | Freshwater | MKPELKALEAKVKALRKAMELFDIFQQSDEVGSALAEVEAELDKFKFK |
| Ga0315294_108070413 | 3300031952 | Sediment | MKQELKALEAKVKALRQAMELFDIFQQDDEVGSALAEVEAELEKFKFK |
| Ga0315905_105296383 | 3300032092 | Freshwater | MKREMKALEAKIKALREKMEYWDIFQQDDEVGTALAEVEAELELFKFK |
| Ga0315905_108975621 | 3300032092 | Freshwater | MKREMKALEAKIQALREKMEQWECFFQDDEVGIALAEVEEE |
| Ga0334980_0108141_178_354 | 3300033816 | Freshwater | MLIFNKIKRDMKREMKELEAKIKALRAKMEQWECFFQDDEVGIALAEVEEELDKFRWK |
| Ga0334980_0257033_441_587 | 3300033816 | Freshwater | MKKELRELEAKLKALREAMERYDVFQQDDEVGQALAEVEAELDQFRFR |
| Ga0334982_0060354_1470_1616 | 3300033981 | Freshwater | MKRELKALEAKVRELRNIMESYDLFQQDDEVGQALKDVEAELDEFRFK |
| Ga0335003_0498515_87_233 | 3300033995 | Freshwater | MKRELKALELKLKALRQAMELFDIFQQDDEVGSALAEVEAELEKFRFK |
| Ga0334991_0065822_823_969 | 3300034013 | Freshwater | MKREMKALEAKIRALREKMEYWGIFQQDDEVGTALAEVEAELDEFRFK |
| Ga0335010_0411832_626_736 | 3300034092 | Freshwater | KSLRAIMEYWECFFQDDEVGLALAEVEEELEKFRFK |
| Ga0335012_0184108_7_141 | 3300034093 | Freshwater | MKPLEAKIKALREAMELFDIFQQDDEVGSALAEVEAELEKFKFK |
| Ga0335025_0577539_423_557 | 3300034096 | Freshwater | IRELEARIKELRRLMEFFEIFQQDDEVGQALAEVEAELEKFRFK |
| Ga0335029_0015999_927_1073 | 3300034102 | Freshwater | MKPELKALEAKVKALRQAMELFDIFQQSDEVGSALAEVEAELDKFKFK |
| Ga0335031_0087362_798_944 | 3300034104 | Freshwater | MKREMKELEAKIKALRAIMEYWECFFQDDEVGIALAEVEEELEKFRFK |
| Ga0335068_0000038_21876_22022 | 3300034116 | Freshwater | MKREMKPLEEKIKALRSIMEYWECFFQDDEVGQALAEVEAELDKFRFK |
| Ga0335056_0029337_74_220 | 3300034120 | Freshwater | MKRELKALEAKVRELRNMMESYDLFQQDDEVGQALKDVEAELDEFRFK |
| ⦗Top⦘ |