Metagenome Family F039503

Overview

Basic Information

• Family ID: F039503
• Family Type: Metagenome
• Number of Sequences: 163
• Average Sequence Length: 38 residues
• Representative Sequence: VVRVAGGPSLWQDNGLRRLKANLVRGRVKPIGNGSAEQ
• Number of Associated Samples: 8
• Number of Associated Scaffolds: 163

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Eukaryota
• % of genes with valid RBS motifs: 63.19 %
• % of genes near scaffold ends (potentially truncated): 24.54 %
• % of genes from short scaffolds (< 2000 bps): 15.34 %
• Associated GOLD sequencing projects: 6
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Eukaryota (97.546 % of family members)
• NCBI Taxonomy ID: 2759
• Taxonomy: All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules (57.055 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (100.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 27.27%
  β-sheet: 0.00%
  Coil/Unstructured: 72.73%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 163 Family Scaffolds
PF07727	RVT_2	3.68
PF03732	Retrotrans_gag	2.45
PF00078	RVT_1	1.84
PF03321	GH3	1.84
PF06955	XET_C	1.23
PF07714	PK_Tyr_Ser-Thr	1.23
PF14223	Retrotran_gag_2	1.23
PF01150	GDA1_CD39	1.23
PF13855	LRR_8	1.23
PF00656	Peptidase_C14	1.23
PF00665	rve	1.23
PF03416	Peptidase_C54	1.23
PF12428	DUF3675	0.61
PF00561	Abhydrolase_1	0.61
PF00249	Myb_DNA-binding	0.61
PF04564	U-box	0.61
PF01926	MMR_HSR1	0.61
PF10536	PMD	0.61
PF00010	HLH	0.61
PF07876	Dabb	0.61
PF04570	zf-FLZ	0.61
PF00262	Calreticulin	0.61
PF01582	TIR	0.61
PF03644	Glyco_hydro_85	0.61
PF13520	AA_permease_2	0.61
PF00295	Glyco_hydro_28	0.61
PF08284	RVP_2	0.61
PF13374	TPR_10	0.61
PF01397	Terpene_synth	0.61
PF05184	SapB_1	0.61
PF05701	WEMBL	0.61
PF02458	Transferase	0.61
PF13976	gag_pre-integrs	0.61
PF04937	DUF659	0.61
PF00501	AMP-binding	0.61
PF00201	UDPGT	0.61
PF02892	zf-BED	0.61
PF00456	Transketolase_N	0.61
PF03634	TCP	0.61
PF13912	zf-C2H2_6	0.61
PF00651	BTB	0.61
PF13947	GUB_WAK_bind	0.61
PF08423	Rad51	0.61
PF02238	COX7a	0.61
PF06454	THH1_TOM1-3_dom	0.61
PF08263	LRRNT_2	0.61
PF04852	ALOG_dom	0.61
PF12796	Ank_2	0.61
PF05903	Peptidase_C97	0.61
PF07992	Pyr_redox_2	0.61
PF00535	Glycos_transf_2	0.61
PF01501	Glyco_transf_8	0.61
PF13952	DUF4216	0.61
PF00225	Kinesin	0.61
PF13178	DUF4005	0.61

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 163 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	4.91
COG5371	Nucleoside diphosphatase, GDA1/CD39 family	Nucleotide transport and metabolism [F]	2.45
COG1819	UDP:flavonoid glycosyltransferase YjiC, YdhE family	Carbohydrate transport and metabolism [G]	1.23
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	1.23
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	1.23
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	1.23
COG4249	Uncharacterized conserved protein, contains caspase domain	General function prediction only [R]	1.23
COG4584	Transposase	Mobilome: prophages, transposons [X]	1.23
COG0021	Transketolase	Carbohydrate transport and metabolism [G]	0.61
COG0468	RecA/RadA recombinase	Replication, recombination and repair [L]	0.61
COG1442	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase	Cell wall/membrane/envelope biogenesis [M]	0.61
COG3959	Transketolase, N-terminal subunit	Carbohydrate transport and metabolism [G]	0.61
COG4724	Endo-beta-N-acetylglucosaminidase D	Carbohydrate transport and metabolism [G]	0.61
COG5434	Polygalacturonase	Carbohydrate transport and metabolism [G]	0.61
COG5597	N-acetylglucosaminyl transferase	Cell wall/membrane/envelope biogenesis [M]	0.61

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	98.16 %
Unclassified	root	N/A	1.84 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	98.16 %
Unclassified	root	N/A	1.84 %

Level 3

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	97.55 %
Unclassified	root	N/A	1.84 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.61 %

Level 4

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	96.93 %
Unclassified	root	N/A	1.84 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.61 %

Level 5

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	96.93 %
Unclassified	root	N/A	1.84 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.61 %

Level 6

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	95.71 %
Unclassified	root	N/A	1.84 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.61 %

Level 7

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	95.71 %
Unclassified	root	N/A	1.84 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.61 %

Level 8

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	79.14 %
Unclassified	root	N/A	1.84 %
Mycobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae	0.61 %

Level 9

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	79.14 %
Unclassified	root	N/A	1.84 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.61 %

Level 10

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	79.14 %
Unclassified	root	N/A	1.84 %
Mycobacterium tuberculosis complex	species group	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex	0.61 %

Level 11

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	79.14 %
Unclassified	root	N/A	1.84 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.61 %

Level 12

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	68.10 %
Unclassified	root	N/A	1.84 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.61 %

Level 13

Name	Rank	Taxonomy	Distribution
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	67.48 %
Unclassified	root	N/A	1.84 %
Ranunculales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Ranunculales	0.61 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.61 %

Level 14

Name	Rank	Taxonomy	Distribution
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	67.48 %
Unclassified	root	N/A	1.84 %
Ranunculaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Ranunculales → Ranunculaceae	0.61 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.61 %

Level 15

Name	Rank	Taxonomy	Distribution
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	67.48 %
Unclassified	root	N/A	1.84 %
Thalictroideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Ranunculales → Ranunculaceae → Thalictroideae	0.61 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.61 %

Level 16

Name	Rank	Taxonomy	Distribution
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	67.48 %
Unclassified	root	N/A	1.84 %
Aquilegia	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Ranunculales → Ranunculaceae → Thalictroideae → Aquilegia	0.61 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.61 %

Level 17

Name	Rank	Taxonomy	Distribution
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	67.48 %
Unclassified	root	N/A	1.84 %
Aquilegia coerulea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Ranunculales → Ranunculaceae → Thalictroideae → Aquilegia → Aquilegia coerulea	0.61 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.61 %

Level 18

Name	Rank	Taxonomy	Distribution
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	67.48 %
Unclassified	root	N/A	1.84 %
Aquilegia coerulea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Ranunculales → Ranunculaceae → Thalictroideae → Aquilegia → Aquilegia coerulea	0.61 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.61 %

Level 19

Name	Rank	Taxonomy	Distribution
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	67.48 %
Unclassified	root	N/A	1.84 %
Aquilegia coerulea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Ranunculales → Ranunculaceae → Thalictroideae → Aquilegia → Aquilegia coerulea	0.61 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.61 %

Level 20

Name	Rank	Taxonomy	Distribution
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	66.26 %
Unclassified	root	N/A	1.84 %
Aquilegia coerulea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Ranunculales → Ranunculaceae → Thalictroideae → Aquilegia → Aquilegia coerulea	0.61 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.61 %

Level 21

Name	Rank	Taxonomy	Distribution
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	66.26 %
Unclassified	root	N/A	1.84 %
Aquilegia coerulea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Ranunculales → Ranunculaceae → Thalictroideae → Aquilegia → Aquilegia coerulea	0.61 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.61 %

Level 22

Name	Rank	Taxonomy	Distribution
NPAAA clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade	66.26 %
Unclassified	root	N/A	1.84 %
Aquilegia coerulea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Ranunculales → Ranunculaceae → Thalictroideae → Aquilegia → Aquilegia coerulea	0.61 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.61 %

Level 23

Name	Rank	Taxonomy	Distribution
indigoferoid/millettioid clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade	66.26 %
Unclassified	root	N/A	1.84 %
Aquilegia coerulea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Ranunculales → Ranunculaceae → Thalictroideae → Aquilegia → Aquilegia coerulea	0.61 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.61 %

Level 24

Name	Rank	Taxonomy	Distribution
Phaseoleae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	66.26 %
Unclassified	root	N/A	1.84 %
Aquilegia coerulea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Ranunculales → Ranunculaceae → Thalictroideae → Aquilegia → Aquilegia coerulea	0.61 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.61 %

Level 25

Name	Rank	Taxonomy	Distribution
Vigna	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	59.51 %
Unclassified	root	N/A	1.84 %
Cajanus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Cajanus	0.61 %
Glycine	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine	0.61 %
Phaseolus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Phaseolus	0.61 %
Aquilegia coerulea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Ranunculales → Ranunculaceae → Thalictroideae → Aquilegia → Aquilegia coerulea	0.61 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.61 %

Level 26

Name	Rank	Taxonomy	Distribution
Vigna unguiculata	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	55.21 %
Unclassified	root	N/A	1.84 %
Glycine subgen. Soja	subgenus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja	0.61 %
Cajanus cajan	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Cajanus → Cajanus cajan	0.61 %
Phaseolus vulgaris	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Phaseolus → Phaseolus vulgaris	0.61 %
Vigna angularis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna angularis	0.61 %
Aquilegia coerulea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Ranunculales → Ranunculaceae → Thalictroideae → Aquilegia → Aquilegia coerulea	0.61 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.61 %

Level 27

Name	Rank	Taxonomy	Distribution
Vigna unguiculata	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	55.21 %
Unclassified	root	N/A	1.84 %
Vigna angularis var. angularis	varietas	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna angularis → Vigna angularis var. angularis	0.61 %
Glycine max	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	0.61 %
Cajanus cajan	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Cajanus → Cajanus cajan	0.61 %
Phaseolus vulgaris	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Phaseolus → Phaseolus vulgaris	0.61 %
Aquilegia coerulea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Ranunculales → Ranunculaceae → Thalictroideae → Aquilegia → Aquilegia coerulea	0.61 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.61 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300006943|Ga0099822_1000068	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	55642
3300006943|Ga0099822_1001092	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Cajanus → Cajanus cajan	30055
3300006943|Ga0099822_1001612	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	26726
3300006943|Ga0099822_1001634	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	26623
3300006943|Ga0099822_1001907	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	25224
3300006943|Ga0099822_1002882	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	21765
3300006943|Ga0099822_1003992	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	19087
3300006943|Ga0099822_1004011	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	19056
3300006943|Ga0099822_1005449	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	16625
3300006943|Ga0099822_1007067	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	14561
3300006943|Ga0099822_1007121	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	14503
3300006943|Ga0099822_1008408	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	13205
3300006943|Ga0099822_1009398	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	12328
3300006943|Ga0099822_1009567	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	12188
3300006943|Ga0099822_1010648	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	11367
3300006943|Ga0099822_1011423	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	10820
3300006943|Ga0099822_1012656	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	10043
3300006943|Ga0099822_1012973	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	9859
3300006943|Ga0099822_1013164	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	9752
3300006943|Ga0099822_1014883	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	8851
3300006943|Ga0099822_1015708	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	8453
3300006943|Ga0099822_1016028	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	8315
3300006943|Ga0099822_1017518	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	7640
3300006943|Ga0099822_1018028	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	7424
3300006943|Ga0099822_1018308	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7317
3300006943|Ga0099822_1018585	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	7213
3300006943|Ga0099822_1019820	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	6780
3300006943|Ga0099822_1021004	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	6381
3300006943|Ga0099822_1021023	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	6376
3300006943|Ga0099822_1021058	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	6367
3300006943|Ga0099822_1027759	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	4615
3300006943|Ga0099822_1029361	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	4285
3300006943|Ga0099822_1030694	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	4029
3300006943|Ga0099822_1034971	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	3298
3300006943|Ga0099822_1037629	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	2929
3300006943|Ga0099822_1038555	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2814
3300006943|Ga0099822_1039085	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	2747
3300006943|Ga0099822_1041265	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	2499
3300006943|Ga0099822_1042450	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	2374
3300006943|Ga0099822_1048505	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1876
3300006943|Ga0099822_1048892	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1847
3300006943|Ga0099822_1051359	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1689
3300006943|Ga0099822_1052466	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1623
3300006943|Ga0099822_1066309	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1084
3300006943|Ga0099822_1079730	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	815
3300006943|Ga0099822_1090314	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	685
3300006943|Ga0099822_1090940	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	678
3300006943|Ga0099822_1107915	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	550
3300006944|Ga0099823_1000613	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	24982
3300006944|Ga0099823_1001666	Not Available	18916
3300006944|Ga0099823_1002372	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	16943
3300006944|Ga0099823_1004468	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	13673
3300006944|Ga0099823_1004888	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	13219
3300006944|Ga0099823_1012239	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	8682
3300006944|Ga0099823_1012867	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	8453
3300006944|Ga0099823_1013200	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	8327
3300006944|Ga0099823_1016296	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7311
3300006944|Ga0099823_1017180	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	7059
3300006944|Ga0099823_1018168	All Organisms → cellular organisms → Eukaryota	6799
3300006944|Ga0099823_1019467	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	6478
3300006944|Ga0099823_1032127	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	4293
3300006944|Ga0099823_1034731	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	3975
3300006944|Ga0099823_1046984	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	2808
3300006944|Ga0099823_1074890	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1420
3300006944|Ga0099823_1089822	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1061
3300006944|Ga0099823_1089905	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1059
3300006944|Ga0099823_1091016	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1038
3300006944|Ga0099823_1094901	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	972
3300006944|Ga0099823_1099712	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	897
3300006944|Ga0099823_1102223	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	864
3300006944|Ga0099823_1121018	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	673
3300006944|Ga0099823_1145593	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	528
3300021320|Ga0214544_1000021	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	169445
3300021320|Ga0214544_1000032	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	148239
3300021320|Ga0214544_1000045	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	138835
3300021320|Ga0214544_1000271	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	86749
3300021320|Ga0214544_1000653	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	65877
3300021320|Ga0214544_1000693	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	64798
3300021320|Ga0214544_1000719	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	63621
3300021320|Ga0214544_1000790	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	61282
3300021320|Ga0214544_1000970	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	57155
3300021320|Ga0214544_1001048	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	55650
3300021320|Ga0214544_1001435	Not Available	49469
3300021320|Ga0214544_1001565	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	47778
3300021320|Ga0214544_1002015	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	42825
3300021320|Ga0214544_1002282	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	40482
3300021320|Ga0214544_1003822	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	30722
3300021320|Ga0214544_1003996	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	29949
3300021320|Ga0214544_1004191	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	29111
3300021320|Ga0214544_1004194	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	29076
3300021320|Ga0214544_1004278	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	28796
3300021320|Ga0214544_1004923	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	26357
3300021320|Ga0214544_1005100	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	25799
3300021320|Ga0214544_1005215	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	25392
3300021320|Ga0214544_1005245	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	25289
3300021320|Ga0214544_1005412	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	24745
3300021320|Ga0214544_1006794	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	20759
3300021320|Ga0214544_1007183	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	19809
3300021320|Ga0214544_1007740	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	18528
3300021320|Ga0214544_1008623	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	16764
3300021320|Ga0214544_1008813	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	16398
3300021320|Ga0214544_1008819	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	16390
3300021320|Ga0214544_1009120	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	15816
3300021320|Ga0214544_1009731	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	14780
3300021320|Ga0214544_1010964	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	12928
3300021320|Ga0214544_1011521	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	12167
3300021320|Ga0214544_1011853	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	11761
3300021320|Ga0214544_1012201	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	11353
3300021320|Ga0214544_1012545	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna angularis → Vigna angularis var. angularis	10950
3300021320|Ga0214544_1013523	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	9816
3300021320|Ga0214544_1013666	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	9667
3300021320|Ga0214544_1014172	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	9137
3300021320|Ga0214544_1015894	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7572
3300021320|Ga0214544_1017724	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	6250
3300021320|Ga0214544_1021187	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	4332
3300021320|Ga0214544_1030780	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1830
3300021320|Ga0214544_1051404	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	667
3300021320|Ga0214544_1057914	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	554
3300021321|Ga0214542_1000106	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	112114
3300021321|Ga0214542_1000669	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	64119
3300021321|Ga0214542_1000997	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	56307
3300021321|Ga0214542_1001543	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	47370
3300021321|Ga0214542_1001959	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	42666
3300021321|Ga0214542_1002554	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	37588
3300021321|Ga0214542_1004503	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	27600
3300021321|Ga0214542_1006205	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	22014
3300021321|Ga0214542_1006808	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	20486
3300021321|Ga0214542_1007069	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	19857
3300021321|Ga0214542_1009104	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	15764
3300021321|Ga0214542_1013163	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	10136
3300021321|Ga0214542_1013839	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	9394
3300021324|Ga0214545_1001870	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	40257
3300021324|Ga0214545_1002175	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	37760
3300021324|Ga0214545_1002464	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	35583
3300021324|Ga0214545_1004912	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	24681
3300021324|Ga0214545_1005201	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	23736
3300021324|Ga0214545_1007212	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	18792
3300021324|Ga0214545_1010608	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	13257
3300021324|Ga0214545_1012595	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	10936
3300021324|Ga0214545_1015831	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	8059
3300021327|Ga0214543_1009443	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Phaseolus → Phaseolus vulgaris	15141
3300021327|Ga0214543_1016113	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Ranunculales → Ranunculaceae → Thalictroideae → Aquilegia → Aquilegia coerulea	7961
3300027296|Ga0209389_1000982	Not Available	18888
3300027296|Ga0209389_1003667	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	12487
3300027296|Ga0209389_1009820	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	8599
3300027296|Ga0209389_1015399	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	6943
3300027296|Ga0209389_1024628	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	5273
3300027296|Ga0209389_1041504	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	3514
3300027296|Ga0209389_1046083	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	3180
3300027296|Ga0209389_1051374	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	2837
3300027296|Ga0209389_1060899	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	2330
3300027296|Ga0209389_1080117	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1584
3300027296|Ga0209389_1080899	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1560
3300027357|Ga0209589_1000348	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	61293
3300027357|Ga0209589_1001571	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	38001
3300027357|Ga0209589_1004762	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	23301
3300027357|Ga0209589_1004878	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	23009
3300027357|Ga0209589_1009170	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	15068
3300027357|Ga0209589_1014883	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	9562
3300027357|Ga0209589_1020883	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	5999
3300027357|Ga0209589_1022023	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	5520
3300027357|Ga0209589_1036842	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1954
3300027357|Ga0209589_1056373	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	827

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Rhizosphere	Host-Associated → Plants → Rhizosphere	100.00%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	100.00%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	100.00%

Habitat

Habitat	Taxonomy	Distribution
Root Nodules	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules	57.06%
Root Nodules	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules	42.94%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Host-Associated
3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Host-Associated
3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Host-Associated
3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Host-Associated
3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Host-Associated
3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Host-Associated
3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes)	Host-Associated
3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0099822_10000681	3300006943	Root Nodules	VRAAGDPSLWQDNGLRRLKANLVCGRVKPIGNGSAEQ*
Ga0099822_100109243	3300006943	Root Nodules	LTQVVRVAGGPSLWQDNGLRCLKANLVRGRVKPIGNGSAE*
Ga0099822_10016121	3300006943	Root Nodules	VVRVAGGPSLWQDNGLRRVKANLVSGRVKPIGNGSAEQ*
Ga0099822_100163427	3300006943	Root Nodules	MVRVAGHPNLGVSHGLRWGKVSNLVYGRVKPIGNGSTL*
Ga0099822_100190715	3300006943	Root Nodules	VVRVAGSPSLWQDNGLRCLKANFVSGRVKPTGNGYAEQ*
Ga0099822_100288212	3300006943	Root Nodules	VVRVAGGPSLWQDNDLKRLKANLVCGRVKPIGNGSAEQ*
Ga0099822_10039922	3300006943	Root Nodules	MVRIAGGPSLWQDNDLRCLRANLVRGRVKPIGNGSAEQ*
Ga0099822_100401117	3300006943	Root Nodules	VVRVAGDPSLWQDNDLRRLKTNLVRGRVKLIDNSFAEQ*
Ga0099822_10054499	3300006943	Root Nodules	VVRVAGGPSLWQDNDLRCLKANLVPGRVKPIGNGSVEQ*
Ga0099822_10070673	3300006943	Root Nodules	VVRVAEGPNLWQDNGLRCLKANLVRGRVKPIGNGSA*
Ga0099822_10071211	3300006943	Root Nodules	AGGPSLWQDNGLRRLKANLVSGRVKPIGNGSAEQ*
Ga0099822_100840813	3300006943	Root Nodules	VRVAGGPSRWQDNGLRCLKANLVRGRVKPIGNGSAEQ*
Ga0099822_10093987	3300006943	Root Nodules	VVRVAGGPSLWRDNDLRCLKANLVRGRVKLIGNGSAEQ*
Ga0099822_100956711	3300006943	Root Nodules	VVRVVGDPSFWQDNGLRCLKVNLVRDKVKAIDNGSAEQ*
Ga0099822_101064818	3300006943	Root Nodules	MYSGLTQVVRVVGGPCLWQDNGLRCLKAILVRGRVKPIGNGSAEQ*
Ga0099822_101142324	3300006943	Root Nodules	VVGVVGGPSLWQDNSLRCLNTNLIRGRGKPIGNGSVEQ*
Ga0099822_10126566	3300006943	Root Nodules	VVRVAGDPSIWQDNGLRCLKANLVRGRVKPIGNGSVEQ*
Ga0099822_101297316	3300006943	Root Nodules	MLQSELTQVVRVVGGPSLWQDNDLRCLKANLVCGWVKPIGNGSVEQ*
Ga0099822_10131648	3300006943	Root Nodules	VVRVVGGPSLWQDNGLRCLKANLVRGRVKPIGNGAAEQ*
Ga0099822_101488314	3300006943	Root Nodules	VVRVAGGPSLWQDNGLRRLKANLVCGRVKPIGNGSTEQ*
Ga0099822_101570813	3300006943	Root Nodules	VVKAAGGPSLWQDNGLRRLKANLVCGRVKPIGNGSA
Ga0099822_101602815	3300006943	Root Nodules	VVRVAGGPSLWQDNGLRRLKANLVCGRVKPFGNGSAEQ*
Ga0099822_101751810	3300006943	Root Nodules	VVKVAGDPSLWQDNDLRRLKVNLVCGRVKPIGNDSAEQ*
Ga0099822_10180288	3300006943	Root Nodules	VVRVAGDPSLWQDNVLRCLKANLVRGRVKPIGNGSTEQ*
Ga0099822_10183081	3300006943	Root Nodules	VRVAGGPSLWQDNGLRRLKANLVCGRVKPIGNGSA
Ga0099822_10185853	3300006943	Root Nodules	VSLKYSKLTQVVRVAGDPSLWQDNGPRRLKANLVRGRVKPIGNGFAEQ*
Ga0099822_10198207	3300006943	Root Nodules	VVRVAGGHSLWQDNGLRRLKANLVCGRVKPIGNGFAEQ*
Ga0099822_10210046	3300006943	Root Nodules	VVRVAGCPSLWQDNGLRCLKANLVRGKVKPTSNGSAEQ*
Ga0099822_10210237	3300006943	Root Nodules	VVRVAGDLSLWQDNGLRCLKANLMRGRVKRIDNGSAE*
Ga0099822_10210584	3300006943	Root Nodules	VTQVVRVVGGLSLWQDNGLRCLKANIVRGRVKPIGNGSAEQ*
Ga0099822_10277592	3300006943	Root Nodules	VVRVAGGSSLWQDNGLRRLKANLVRGRVKPIGNGSAEQ*
Ga0099822_10293612	3300006943	Root Nodules	VVRVARGPSLWQDNGLRCLKANLVRGRVKPIGNDSAEQ*
Ga0099822_10306941	3300006943	Root Nodules	MQSVQTQVVRVAGGPSLWQDNGLRCLKANVVCGRVKPIGNGSIE*
Ga0099822_10349715	3300006943	Root Nodules	QVVRVAGGPSLWQDNGLRRLKANLVCGRVKPIGNGSAEQ*
Ga0099822_10376294	3300006943	Root Nodules	TQVVRVAGGPSLWQDNGLRRLKANLVSGRVKPIGNGSAEQ*
Ga0099822_10385556	3300006943	Root Nodules	VRVAGGPSLWQDNGLRRLKANLVCGRVKPIGNGSTEQ*
Ga0099822_10390853	3300006943	Root Nodules	MTQVVRVAGGPSLWQDNGLRCLKANLVHGRVKPIGNGSAEQ*
Ga0099822_10412654	3300006943	Root Nodules	VVRVAGGPSLWQGNGLRRLKANLVCGRVKPIGNGSAEQ*
Ga0099822_10424501	3300006943	Root Nodules	SKLTQVVRVAGGPSLWQDNGLRRLKANLVRGRVKPIGNGSVEQ*
Ga0099822_10485054	3300006943	Root Nodules	VRVAGGPSLWQDNGLRRLKANLVCGRVKPIGNGSAEQ*
Ga0099822_10488922	3300006943	Root Nodules	VVRVAGGPSLWQDNGLRRLKANLVRGMVKPIGNGSAEQ*
Ga0099822_10513592	3300006943	Root Nodules	MKFVEQTDQVVKVAGDPSLWQDNGLKRLKANLVCGRVKPIGNGSVEQ*
Ga0099822_10524661	3300006943	Root Nodules	VVRVAGGLSLGQDNGLRCLKANLVRGRVKPIGNGSAEQ*
Ga0099822_10663091	3300006943	Root Nodules	KLTQVVRVAGGPSLWQDNGLRRLKANLVCGRVKPIGNGSAE*
Ga0099822_10797301	3300006943	Root Nodules	VVRVAGGPSLWQDNGLRRLKANLVSGRVKPIGNGSAEQ
Ga0099822_10903141	3300006943	Root Nodules	VAGGPSLWQDNGLRRLKANLVCGRVKPIGNGSAEQ*
Ga0099822_10909401	3300006943	Root Nodules	RVAGGPSLWQDNGLRRLKANLVCGRVKPIGNGSAEQ*
Ga0099822_11079151	3300006943	Root Nodules	VAGGPSLWQDNGLRRLKANLVSGRVKPIGNGSAEQ*
Ga0099823_100061325	3300006944	Root Nodules	VVRVAGDPSLWQDNGLRCLKANLVHGMVKLIGNGSTKQ*
Ga0099823_10016661	3300006944	Root Nodules	VVRVAGGPSLWQNNDLRCLKANLVRGRVKPIDNGSTEQ*
Ga0099823_100237223	3300006944	Root Nodules	MRVAGGPSLWQDNDLRCLKANLVRGRVKPIGNGSTKQ*
Ga0099823_100446820	3300006944	Root Nodules	TQVVRVAGGPSLWQDNGLRRLKANLVCGRVKPIGNGFVEQ*
Ga0099823_100488827	3300006944	Root Nodules	VVKVIGGSSLWQDNGLRCFKANLVRGKVKPIGNGFAEQ*
Ga0099823_10122392	3300006944	Root Nodules	VVRVAGDPSLWQDNDLRCLKANLVRGRVKPMGNGSAEQ*
Ga0099823_10128671	3300006944	Root Nodules	VVRVARGPSLWQDNGLRCLKANLVRGRVKPIGNGSAKQ*
Ga0099823_10132008	3300006944	Root Nodules	VVRVAGGPSLWQDNGHRRLKVNLVCGKVKPIGNGSTEQ*
Ga0099823_101629614	3300006944	Root Nodules	VVRVARGPSLWQDNGLRRLKANLVHGRVKPIGNGSAEQ*
Ga0099823_10171808	3300006944	Root Nodules	VVRVAGGPSLWQDNGLRCLKANLVRGRVKPIGNGSAE*
Ga0099823_101816814	3300006944	Root Nodules	RVAGGPSLWQDNGLRRLKANLVCGRVKLISNGSAEQ*
Ga0099823_10194674	3300006944	Root Nodules	SKLTQVVRVAGDPSLWQDNGPRRLKANLVRGRVKPIGNGFAEQ*
Ga0099823_10321273	3300006944	Root Nodules	VRVVGDPSFWQDNGLRCLKVNLVRDKVKAIDNGSAEQ*
Ga0099823_10347314	3300006944	Root Nodules	VVRVAEGPSLWQDNGLRCLKVNLVSGKVKPIGNGSTEQ*
Ga0099823_10469841	3300006944	Root Nodules	VVRVAGGPSLWQDNDLRCLKTNLMRGRVKPIGNGSTEQ*
Ga0099823_10748901	3300006944	Root Nodules	THVVRVVGGPSLWQDNGLRCLKANLVRGRVKPIGNGSVEQ*
Ga0099823_10898221	3300006944	Root Nodules	AGGPSLWQDNGLRRLKANLVCGRVKPIGNGSAEQ*
Ga0099823_10899052	3300006944	Root Nodules	VAGDPSLWQDNGPRRLKANLVRGRVKPIGNGSAEQ*
Ga0099823_10910161	3300006944	Root Nodules	ILTQVVRVARGPSLWQDNGLRCLKANLVRGRVKPIGNGSVEQ*
Ga0099823_10949012	3300006944	Root Nodules	VVRVAGGPSLWQDNDLRRLKANLVCGRVKPIGNGSAE
Ga0099823_10997121	3300006944	Root Nodules	TQVVRVAGGLSLWQDNGLRCLKVNLVRGRVKPISNGSVEQ*
Ga0099823_11022234	3300006944	Root Nodules	QVVRVAGGPSLWQDNGLRCLKANLVYGRVKPIGNGSAEQ*
Ga0099823_11210182	3300006944	Root Nodules	VVRVAGGPSLWQDNGLRRLKANLVRGRVKPIGNGS
Ga0099823_11455931	3300006944	Root Nodules	VVRVAGDLSLWQDNGLRCLKVNLVRGRVKPIGNDSAEQ*
Ga0214544_100002124	3300021320	Root Nodules	VVRVAGGPSLWQDNGLRHLKANLVSGRVKPIGNGSAEQ
Ga0214544_100003259	3300021320	Root Nodules	VVRVAGGPSLWQDNGLRRLKANLVCGRVKPIGNGSAEQ
Ga0214544_10000452	3300021320	Root Nodules	VRVAGGASLWHENGLRCLKANLVRGRVKPIGNGTTEQ
Ga0214544_100027157	3300021320	Root Nodules	VVRVARGPSFWQDNGLRCLKANLVRGRVKPIGNGSAE
Ga0214544_100065323	3300021320	Root Nodules	VVRVAGGPSLWQDNGHRRLKVNLVCGKVKPIGNGSTEQ
Ga0214544_100069353	3300021320	Root Nodules	MRVVGGSSLWQDNGPRQSWTNLVGGRVKLIDNGSAGQ
Ga0214544_100071942	3300021320	Root Nodules	VRVAGGPTLWQDNGLRRLKANLVRGRVKPIGNGSAEQ
Ga0214544_100079013	3300021320	Root Nodules	MLQSELTQVVRVVGGPSLWQDNDLRCLKANLVCGWVKPIGNGSVEQ
Ga0214544_100097015	3300021320	Root Nodules	VVRVAGGLSLGQDNGLRCLKANLVRGRVKPIGNGSAEQ
Ga0214544_10010481	3300021320	Root Nodules	VRAAGDPSLWQDNGLRRLKANLVCGRVKPIGNGSAEQ
Ga0214544_10014353	3300021320	Root Nodules	VVRVAEGPNLWQDNGLRCLKANLVRGRVKPIGNGSA
Ga0214544_10015652	3300021320	Root Nodules	LTQVVRVAGGLSLWQDNGLRRLKANLVCGRVKPIGNGYAEQ
Ga0214544_100201517	3300021320	Root Nodules	VVRVAGGPSLWQDNGLRRLKANLVRGRVKPIGNGSAEQ
Ga0214544_10022821	3300021320	Root Nodules	VVRVAGGLSLWQDNGLRCLKVNLVRGRVKPIGNGSAEQ
Ga0214544_10038225	3300021320	Root Nodules	VVTVAGGPSLWQDNGLRRLKANLVCGRVKPIGNGSAEQ
Ga0214544_10039961	3300021320	Root Nodules	VVRVAGGPSLWQDNGLRRVKANLVSGRVKPIGNGSAEQ
Ga0214544_10041916	3300021320	Root Nodules	VVRVVGDPSFWQDNGLRCLKVNLVRDKVKAIDNGSAEQ
Ga0214544_10041941	3300021320	Root Nodules	VVKVAGDPSLWQDNDLRRLKVNLVCGRVKPIGNDSAEQ
Ga0214544_100427811	3300021320	Root Nodules	VVRVARGPSLWQDNGLRCLKANLVRGRVKPIGNGSVEQ
Ga0214544_10049234	3300021320	Root Nodules	VVRVVGGPSVWQDNGLRCLKANLVRGRVKPIGNGSAEQ
Ga0214544_100510016	3300021320	Root Nodules	VVRVAGSPSLWQDNGLRCLKANFVSGRVKPTGNGYAEQ
Ga0214544_100521516	3300021320	Root Nodules	VVGVVGGPSLWQDNSLRCLNTNLIRGRGKPIGNGSVEQ
Ga0214544_100524510	3300021320	Root Nodules	VVRVAGDPSLWQDNGLRRLKANLVHGRVKPIGNGYAKQ
Ga0214544_10054125	3300021320	Root Nodules	LTQVVRVARGPSLWQDNGLGCLKANLVHGRVKPIGNGSAEQ
Ga0214544_10067941	3300021320	Root Nodules	MVRIAGGPSLWQDNDLRCLRANLVRGRVKPIGNGSAEQ
Ga0214544_100718311	3300021320	Root Nodules	VVRVAGGPSLWQDNGFRRLKANLVCGRVKRIGNGSTEQ
Ga0214544_10077407	3300021320	Root Nodules	VVRVAGDPSLWQDNVLRCLKANLVRGRVKPIGNGSTEQ
Ga0214544_10086239	3300021320	Root Nodules	VVRVAGGHSLWQDNGLRRLKANLVCGRVKPIGNGFAEQ
Ga0214544_10088137	3300021320	Root Nodules	VRVAEGPSLWQDNGLRCLKANLVLGRVKPIGNGSAEQ
Ga0214544_10088198	3300021320	Root Nodules	VVRVAGGLSLWQDNGLRCLKANLVRGRVKHIGNGFVEQ
Ga0214544_10091205	3300021320	Root Nodules	VSLKYSKLTQVVRVAGDPSLWQDNGPRRLKANLVRGRVKPIGNGFAEQ
Ga0214544_10097316	3300021320	Root Nodules	VVRVAGGPSLWQDNDLRRLKANLVCGRVKPIGNGSAEQ
Ga0214544_10109645	3300021320	Root Nodules	VVRVAGDLSLWQDNGLRCLKANLMRGRVKRIDNGSAE
Ga0214544_101152111	3300021320	Root Nodules	TQVVRVAGGPSLWQDNGLRRLKANLVCGRVKPIGNGSAEQ
Ga0214544_10118535	3300021320	Root Nodules	VVRVAGGPSLWRDNDLRCLKANLVRGRVKLIGNGSAEQ
Ga0214544_10122013	3300021320	Root Nodules	VVRVAGGSSLWQDNGLRRLKANLVRGRVKPIGNGSAEQ
Ga0214544_10125456	3300021320	Root Nodules	VVRVAGGPSFWQDNGLRRLKANLVRGRVKPIGNGSAEQ
Ga0214544_10135237	3300021320	Root Nodules	MVRVAGGPSLWQDNGLRCLKANIVRGRVKPIGNGSIEQ
Ga0214544_10136664	3300021320	Root Nodules	VVRVAGDPSLWQDNGLRRLKANLVCGRVKPIGNGSAEQ
Ga0214544_10141722	3300021320	Root Nodules	VVRVAGGPSLWQGNGLRRLKANLVCGRVKPIGNGSAEQ
Ga0214544_10158941	3300021320	Root Nodules	VVRVAGGPSLWQDNGPRRLKANLVRGRVKPIGNGSAEQ
Ga0214544_10177242	3300021320	Root Nodules	VTQVVRVVGGLSLWQDNGLRCLKANIVRGRVKPIGNGSAEQ
Ga0214544_10211874	3300021320	Root Nodules	VVRVARGPSLWQDNGLRCLKANLVRGRVKPIGNDSAEQ
Ga0214544_10307801	3300021320	Root Nodules	VVRVAGGPSLWQDNGLRRLKANLVRGMVKPIGNGSAEQ
Ga0214544_10514042	3300021320	Root Nodules	QVVRVAGGPSLWQDNDLRRLKANLVCGRVKPIGNGSAEQ
Ga0214544_10579141	3300021320	Root Nodules	VRVAGGPSLWQDNGLRRLKANLVSGRVKPIGNGSAEQ
Ga0214542_10001065	3300021321	Root Nodules	VVRVAGDPSLWQDNGLRCFKANLVGGRVKPIGNGSAEQ
Ga0214542_10006694	3300021321	Root Nodules	VVRVAGDPSLWQDNGLRRLKANLVRGRVKPIGNGSAEQ
Ga0214542_100099712	3300021321	Root Nodules	LTQVVRVAGGPSLWQDNGLRRLKANLVCGRVKPIGNGSAEQ
Ga0214542_10015437	3300021321	Root Nodules	VVRVAEDPSLWQDNDLRCLRANLVRGRVKPIGNGSTEQ
Ga0214542_100195921	3300021321	Root Nodules	VVRVAGGASLWHENGLRCLKANLVRGRVKPIGNGTTEQ
Ga0214542_10025548	3300021321	Root Nodules	VVRVAGDPSLWQDNDLRRLKTNLVRGRVKLIDNSFAEQ
Ga0214542_10045031	3300021321	Root Nodules	RNLTQVVRVAGGPSLWQDNGLRRLKANLVSGRVKPIGNGSAEQ
Ga0214542_10062054	3300021321	Root Nodules	VVRVAGGPSLWQDNDLKRLKANLVCGRVKPIGNGSAEQ
Ga0214542_10068089	3300021321	Root Nodules	VVRVAEGPSLWQDNGLRCLKANLVRGWVKPIGNDSV
Ga0214542_10070694	3300021321	Root Nodules	VVRVAVGPSLWQDNGPRHLKANRVRGRVKPIGNGSAEQ
Ga0214542_10091045	3300021321	Root Nodules	VSLKSSKLTQVVRVAGGPSLWQDNGLRRLKANLVRGRVKPIGNGSAEQ
Ga0214542_10131633	3300021321	Root Nodules	VVRVAGDPSIWQDNGLRCLKANLVRGRVKPIGNGSVEQ
Ga0214542_10138394	3300021321	Root Nodules	VVRVVGGPSLWQDNGLRCLKANLVRGRVKPIGNGAAEQ
Ga0214545_10018701	3300021324	Root Nodules	VVRVAGGPSLWQDNGLRRLKANLVRGRVKPIGNGSAKQ
Ga0214545_100217523	3300021324	Root Nodules	VRVAGGPSLWQDNGLRRLKANLVSGRVKPIGNGFAEQ
Ga0214545_100246424	3300021324	Root Nodules	VVRVAGGPSLWQDNDLRCLKANLVPGRVKPIGNGSVEQ
Ga0214545_100491220	3300021324	Root Nodules	VVRVAGGPSLWQDNGLRRLKANLVCGRVKPIGNGSTEQ
Ga0214545_100520121	3300021324	Root Nodules	VRVAAGPSLWQDNGLRRLKANLVRGRVKPIGNGSAEQ
Ga0214545_10072123	3300021324	Root Nodules	MRVARGPSLWQDNGLRCLKANLVCGRVKPIGNGSAEQ
Ga0214545_10106089	3300021324	Root Nodules	VVRVAGGPSLWQDNGLRRLKANLVSGRVKPIGNGSAK
Ga0214545_10125959	3300021324	Root Nodules	VVRVARGPSLWQDNDLRCLKANLVHGRVKAIGNGSVEQ
Ga0214545_10158311	3300021324	Root Nodules	MRMAGGLSLWQDNGLRCLKVNLVRGRVKPIGNGSAEQ
Ga0214543_10094433	3300021327	Root Nodules	VRVAGGPSLWQDNGPRRLKANLVRGRVKPIGNGSAEQ
Ga0214543_10161134	3300021327	Root Nodules	VVRVAGGPSLWQDNGLRRLKANLVSGRVKLIGNGSAEQ
Ga0209389_100098230	3300027296	Root Nodules	VVRVAGGPSLWQNNDLRCLKANLVRGRVKPIDNGSTEQ
Ga0209389_10036676	3300027296	Root Nodules	VVRVARGPSLWQDNGLRRLKANLVHGRVKPIGNGSAEQ
Ga0209389_10098205	3300027296	Root Nodules	VVRVAGDPSLWQDNDLRCLKANLVRGRVKPMGNGSAEQ
Ga0209389_10153992	3300027296	Root Nodules	LTQVVRVAGGPSLWQDNGLRCLKANLVRGRVKPIGNGSAE
Ga0209389_10246282	3300027296	Root Nodules	VRVAGGPSLWQDNGLRRLKANLVRGMVKPIGNGSAEQ
Ga0209389_10415041	3300027296	Root Nodules	SKLTQVVRVAGGPSLWQDNGLRRLKANLVCGRMKPIGNSSAEQ
Ga0209389_10460832	3300027296	Root Nodules	VVRVAGCPSLWQDNGLRCLKANLVRGKVKPTSNGSAEQ
Ga0209389_10513741	3300027296	Root Nodules	VAGGLSLCQDNGLRCLKVNLVRGRVKPIGNGSAEQ
Ga0209389_10608991	3300027296	Root Nodules	QVVRVAGGPSLWQDNGLRCLKANLVCGRVKPIDNGSAE
Ga0209389_10801172	3300027296	Root Nodules	VVRVAGGLSLWQDNGLRCLKVNLVRGRVKPISNGSVE
Ga0209389_10808991	3300027296	Root Nodules	VAGGPSLWQDNGLRRLKANLVSGRVKPIGNGSAEQ
Ga0209589_100034839	3300027357	Root Nodules	VVRAAGDPSLWQDNGLRRLKANLVCGRVKPIGNGSAEQ
Ga0209589_100157133	3300027357	Root Nodules	VAGDLSLWQDNGLRCLKVNLVRGRVKPIGNGSAEQ
Ga0209589_100476214	3300027357	Root Nodules	VVRVAGGPSLWQDNGLRRLKANLVCGRVKPFGNGSAEQ
Ga0209589_10048781	3300027357	Root Nodules	VVRVAGGPSLWQDNGLRRLKANLVCGRVKPIGNGSA
Ga0209589_100917010	3300027357	Root Nodules	VVRVAGGPSLWQDNGLRHLKANLVRGRVKPIGNGSAEK
Ga0209589_10148831	3300027357	Root Nodules	SKLAQVVRVAGGPSLWQDNGLRRLKANLVCGRVKPIGNGSAEQ
Ga0209589_10208836	3300027357	Root Nodules	VVRVAGGPSLWQDNGLRCLKANVVHGRVKPIGNGSTEQ
Ga0209589_10220234	3300027357	Root Nodules	VVRVVGGSSLWQDNGLRCLKANIVRGKVKPIGNGSAE
Ga0209589_10368421	3300027357	Root Nodules	QVVRVAGGPSLWQDNGLRRLKANLVSGRVKPIGNGFAEQ
Ga0209589_10563731	3300027357	Root Nodules	TLTQVVRVAGGPSLWQDNGLRRLKANLVCGRVKPIGNGSVEQ