NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F039371

Metagenome Family F039371

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039371
Family Type Metagenome
Number of Sequences 164
Average Sequence Length 52 residues
Representative Sequence AWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCPQR
Number of Associated Samples 129
Number of Associated Scaffolds 164

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.76 %
% of genes near scaffold ends (potentially truncated) 79.27 %
% of genes from short scaffolds (< 2000 bps) 70.12 %
Associated GOLD sequencing projects 117
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.488 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(18.902 % of family members)
Environment Ontology (ENVO) Unclassified
(33.537 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.439 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 26.03%    Coil/Unstructured: 73.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 164 Family Scaffolds
PF02515CoA_transf_3 28.05
PF03631Virul_fac_BrkB 17.07
PF00359PTS_EIIA_2 6.71
PF00285Citrate_synt 4.27
PF00903Glyoxalase 4.27
PF07298NnrU 3.66
PF08241Methyltransf_11 1.83
PF08808RES 1.22
PF05359DUF748 1.22
PF02353CMAS 1.22
PF13191AAA_16 0.61
PF01699Na_Ca_ex 0.61
PF14592Chondroitinas_B 0.61
PF13432TPR_16 0.61
PF00023Ank 0.61
PF13795HupE_UreJ_2 0.61
PF00378ECH_1 0.61
PF00069Pkinase 0.61

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 164 Family Scaffolds
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 28.05
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 17.07
COG0372Citrate synthaseEnergy production and conversion [C] 4.27
COG4094Uncharacterized membrane proteinFunction unknown [S] 3.66
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.44
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 1.22
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 1.22
COG2230Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferasesLipid transport and metabolism [I] 1.22
COG2982Uncharacterized conserved protein AsmA involved in outer membrane biogenesisCell wall/membrane/envelope biogenesis [M] 1.22
COG5654Predicted toxin component of a toxin-antitoxin system, contains RES domainDefense mechanisms [V] 1.22
COG0387Cation (Ca2+/Na+/K+)/H+ antiporter ChaAInorganic ion transport and metabolism [P] 0.61
COG0530Ca2+/Na+ antiporterInorganic ion transport and metabolism [P] 0.61


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.49 %
UnclassifiedrootN/A19.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2035918004|FACENC_F56XM5W01AOYE0All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium511Open in IMG/M
3300004027|Ga0055459_10073115All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium853Open in IMG/M
3300004114|Ga0062593_100777089All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium948Open in IMG/M
3300004463|Ga0063356_100659078All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1429Open in IMG/M
3300005172|Ga0066683_10003402All Organisms → cellular organisms → Bacteria → Proteobacteria7265Open in IMG/M
3300005174|Ga0066680_10192322All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1288Open in IMG/M
3300005186|Ga0066676_10003190All Organisms → cellular organisms → Bacteria → Proteobacteria7229Open in IMG/M
3300005186|Ga0066676_10283949All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1090Open in IMG/M
3300005186|Ga0066676_11180774All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium501Open in IMG/M
3300005332|Ga0066388_105656809All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium633Open in IMG/M
3300005343|Ga0070687_101387211All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300005356|Ga0070674_100981605All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium740Open in IMG/M
3300005364|Ga0070673_101403782All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium657Open in IMG/M
3300005440|Ga0070705_101633065All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium543Open in IMG/M
3300005447|Ga0066689_10049304All Organisms → cellular organisms → Bacteria2251Open in IMG/M
3300005456|Ga0070678_100386781All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1212Open in IMG/M
3300005467|Ga0070706_101813852All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium554Open in IMG/M
3300005536|Ga0070697_100761256All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium856Open in IMG/M
3300005556|Ga0066707_10701411All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium634Open in IMG/M
3300005586|Ga0066691_10060425All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2053Open in IMG/M
3300005598|Ga0066706_10004288All Organisms → cellular organisms → Bacteria6781Open in IMG/M
3300005617|Ga0068859_101507759All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium742Open in IMG/M
3300005764|Ga0066903_101800028All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1170Open in IMG/M
3300005764|Ga0066903_102273227All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1047Open in IMG/M
3300005764|Ga0066903_102820505All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium943Open in IMG/M
3300005764|Ga0066903_106795961All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium594Open in IMG/M
3300005764|Ga0066903_107446295All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium565Open in IMG/M
3300005840|Ga0068870_11205574All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium548Open in IMG/M
3300006163|Ga0070715_10284253All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium878Open in IMG/M
3300006173|Ga0070716_101423826All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300006796|Ga0066665_10097638All Organisms → cellular organisms → Bacteria2147Open in IMG/M
3300006796|Ga0066665_11230823All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria572Open in IMG/M
3300006844|Ga0075428_100207646All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2117Open in IMG/M
3300006903|Ga0075426_10220203All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300006903|Ga0075426_11416785All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium528Open in IMG/M
3300006969|Ga0075419_11195031All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium561Open in IMG/M
3300009012|Ga0066710_101498201All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1041Open in IMG/M
3300009038|Ga0099829_10138157All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1935Open in IMG/M
3300009094|Ga0111539_11584141All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium760Open in IMG/M
3300009100|Ga0075418_11102600All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium860Open in IMG/M
3300009137|Ga0066709_100037041All Organisms → cellular organisms → Bacteria5293Open in IMG/M
3300010043|Ga0126380_10095680All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1766Open in IMG/M
3300010047|Ga0126382_11520435All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium617Open in IMG/M
3300010047|Ga0126382_12461844All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium507Open in IMG/M
3300010301|Ga0134070_10285595All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium626Open in IMG/M
3300010303|Ga0134082_10065682All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1406Open in IMG/M
3300010320|Ga0134109_10237473All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium683Open in IMG/M
3300010333|Ga0134080_10331075All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium690Open in IMG/M
3300010336|Ga0134071_10191412All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1007Open in IMG/M
3300010358|Ga0126370_12133624All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium551Open in IMG/M
3300010359|Ga0126376_12717505All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium544Open in IMG/M
3300010361|Ga0126378_13161473All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
3300010361|Ga0126378_13274667All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium515Open in IMG/M
3300010397|Ga0134124_11330100All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium742Open in IMG/M
3300010397|Ga0134124_11934147All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium626Open in IMG/M
3300010397|Ga0134124_13158253All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300012198|Ga0137364_10138489All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1750Open in IMG/M
3300012205|Ga0137362_10784835All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria817Open in IMG/M
3300012206|Ga0137380_11433762All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium575Open in IMG/M
3300012923|Ga0137359_10437091All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1158Open in IMG/M
3300012930|Ga0137407_10046315All Organisms → cellular organisms → Bacteria3505Open in IMG/M
3300012944|Ga0137410_11002350All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300012972|Ga0134077_10581687All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium505Open in IMG/M
3300013308|Ga0157375_10827399All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1074Open in IMG/M
3300013308|Ga0157375_11610650All Organisms → cellular organisms → Bacteria → Acidobacteria768Open in IMG/M
3300014154|Ga0134075_10275326All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium730Open in IMG/M
3300014877|Ga0180074_1128041All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium569Open in IMG/M
3300015245|Ga0137409_11224210All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium592Open in IMG/M
3300015359|Ga0134085_10481128All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium566Open in IMG/M
3300015374|Ga0132255_102862719All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium737Open in IMG/M
3300015374|Ga0132255_105279975All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium547Open in IMG/M
3300016445|Ga0182038_10820215All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium816Open in IMG/M
3300017659|Ga0134083_10185221All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium854Open in IMG/M
3300017659|Ga0134083_10237811All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium760Open in IMG/M
3300017659|Ga0134083_10553348All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300017966|Ga0187776_10921780All Organisms → cellular organisms → Bacteria → Proteobacteria636Open in IMG/M
3300018060|Ga0187765_11314920All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium512Open in IMG/M
3300018431|Ga0066655_10583080All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium751Open in IMG/M
3300018433|Ga0066667_10002567All Organisms → cellular organisms → Bacteria7250Open in IMG/M
3300018482|Ga0066669_10041037All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Candidatus Omnitrophica bacterium CG11_big_fil_rev_8_21_14_0_20_63_92838Open in IMG/M
3300018482|Ga0066669_11844017All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium560Open in IMG/M
3300021475|Ga0210392_11472840All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium509Open in IMG/M
(restricted) 3300023208|Ga0233424_10208039All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium785Open in IMG/M
3300025903|Ga0207680_10886576All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium639Open in IMG/M
3300025905|Ga0207685_10119362All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1155Open in IMG/M
3300025922|Ga0207646_10920210All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium775Open in IMG/M
3300025939|Ga0207665_11431105All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium550Open in IMG/M
3300025940|Ga0207691_10907868All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium737Open in IMG/M
3300026067|Ga0207678_12010374All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium503Open in IMG/M
3300026088|Ga0207641_10941554All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium859Open in IMG/M
3300026296|Ga0209235_1136069All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1006Open in IMG/M
3300026297|Ga0209237_1110930All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1180Open in IMG/M
3300026306|Ga0209468_1184777All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium527Open in IMG/M
3300026327|Ga0209266_1042339All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Candidatus Omnitrophica bacterium CG11_big_fil_rev_8_21_14_0_20_63_92309Open in IMG/M
3300026333|Ga0209158_1257661All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium598Open in IMG/M
3300026528|Ga0209378_1003449All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium10660Open in IMG/M
3300026529|Ga0209806_1166597All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Melaminivora → Melaminivora jejuensis821Open in IMG/M
3300026536|Ga0209058_1028747All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3468Open in IMG/M
3300027907|Ga0207428_10038455All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3889Open in IMG/M
3300028536|Ga0137415_10271731All Organisms → cellular organisms → Bacteria1501Open in IMG/M
3300028587|Ga0247828_10025443All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2368Open in IMG/M
3300028587|Ga0247828_10064831All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1630Open in IMG/M
3300028587|Ga0247828_11238769All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300028589|Ga0247818_10745234All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium681Open in IMG/M
3300031474|Ga0170818_100105363All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium694Open in IMG/M
3300031572|Ga0318515_10776516All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300031640|Ga0318555_10141620All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1285Open in IMG/M
3300031713|Ga0318496_10353571All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium812Open in IMG/M
3300031719|Ga0306917_11575611All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300031720|Ga0307469_11809163All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium590Open in IMG/M
3300031765|Ga0318554_10487377All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium698Open in IMG/M
3300031820|Ga0307473_10560579All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium782Open in IMG/M
3300031820|Ga0307473_11447578All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria519Open in IMG/M
3300031820|Ga0307473_11560450All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300031821|Ga0318567_10716717All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium567Open in IMG/M
3300031831|Ga0318564_10266945All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium758Open in IMG/M
3300031859|Ga0318527_10047460All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1662Open in IMG/M
3300031910|Ga0306923_10643545All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1186Open in IMG/M
3300031942|Ga0310916_11205236All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium626Open in IMG/M
3300031947|Ga0310909_10211625All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1614Open in IMG/M
3300031962|Ga0307479_11426128All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium651Open in IMG/M
3300032010|Ga0318569_10109416All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1254Open in IMG/M
3300032041|Ga0318549_10296088All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium729Open in IMG/M
3300032075|Ga0310890_11318403All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium591Open in IMG/M
3300032174|Ga0307470_11216182All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium613Open in IMG/M
3300032177|Ga0315276_12069637All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium579Open in IMG/M
3300032179|Ga0310889_10363941All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium711Open in IMG/M
3300032180|Ga0307471_100027229All Organisms → cellular organisms → Bacteria4329Open in IMG/M
3300032180|Ga0307471_103416896All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300032205|Ga0307472_100510379All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1039Open in IMG/M
3300033290|Ga0318519_10119235All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1443Open in IMG/M
3300033502|Ga0326731_1085400All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium728Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil18.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.15%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil7.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil6.71%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.10%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.10%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.49%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.27%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.27%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.88%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.83%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.22%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.22%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.22%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.22%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.22%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.22%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.61%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.61%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.61%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.61%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.61%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.61%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.61%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.61%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2035918004Soil microbial communities from sample at FACE Site 2 North Carolina CO2-EnvironmentalOpen in IMG/M
3300004027Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014877Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10DEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300023208 (restricted)Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MGEnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033502Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fractionEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
FACENCA_78654802035918004SoilTHWDWSRSVTTDQGYAALGEFGERGLRVIAYSRAVRFGTLGACLQR
Ga0055459_1007311513300004027Natural And Restored WetlandsAWDWSRTPSSDHGFVAVGEFGDAGLGVIAYSRAVRFGSLGVCPQR*
Ga0062593_10077708913300004114SoilRSAVEIVYDTLLWEHVHGERLLARTWDWSRSVTLDQGYAALGEFGEKGLRLIAYSRAVRFGTLGVCVQR*
Ga0063356_10065907833300004463Arabidopsis Thaliana RhizosphereERLLADAWDWSSTPSSDNGYVAVGGFGDDGLGVIAYSRAVRFGTLGVCAQR*
Ga0066674_1011708133300005166SoilEIAFDTLLWERVHGERLLAATWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR*
Ga0066674_1047326723300005166SoilRSAPEIALDTLLWQRVHGERLLAATWDWSRSLSTDQGYAALGEFGPDGLRVIAYSRAVRFGTLGVCAQR*
Ga0066683_1000340273300005172SoilWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCPQR*
Ga0066680_1019232213300005174SoilAEIAFDTLCWHRAHGERLLAGAWDWSRSETLDGGYASLGEFGPQGLRVIAYSGAVRFGTLGACPQR*
Ga0066676_1000319013300005186SoilSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCPQR*
Ga0066676_1020357523300005186SoilPRRRSAAEIAFDTLLWERVHGERLLAAAWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR*
Ga0066676_1028394913300005186SoilWDWSRSETIDRGYASLGEFGPEGLRVIAYSAAVRFGTLGVCPQR*
Ga0066676_1118077423300005186SoilCWDWSRSLSTDQGYAALGEFGTKGLRLTAYSRAVKFGTLGVCPQR*
Ga0066388_10565680933300005332Tropical Forest SoilWDWSRSESNDGGLAALGEFRGQGLGVIAYSRAVRFGTLGVCPQR*
Ga0070687_10138721113300005343Switchgrass RhizosphereRVHGERLLSGCWDWSRSVSTDQGLAALGEFGPQGLRLIAYSRAVKFGTLGVCPQR*
Ga0070674_10098160513300005356Miscanthus RhizosphereLLAGAWDWSRSPSNDQGYAALGEFGERGLGVIAYSRAVKFGTLGVCPQR*
Ga0070673_10140378213300005364Switchgrass RhizosphereWSRSESNDRGLAALGEFGENGLGVIAYSRAVRFGSLGVCPQR*
Ga0070705_10132414313300005440Corn, Switchgrass And Miscanthus RhizosphereRRSASEIAFDTLCWRKAHGERLLADCWDWSRSTSTDEGEAALGEFGEKGLRVIAYSHAVKFGTLGVCAQR*
Ga0070705_10163306513300005440Corn, Switchgrass And Miscanthus RhizosphereWDWSRSVSTDQGFAALGEFGAQGLRLIAYSRAVKFGTLGVCPQR*
Ga0066686_1082022913300005446SoilALDTLLWQRVHGERLLAATWDWSRSLSTDQGYAALGEFGPDGLRVIAYSRAVRFGTLGVCAQR*
Ga0066689_1004930413300005447SoilRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCPQR*
Ga0066681_1029766623300005451SoilRSAPEIAFDTLLWERVHGERLLTAAWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCPQR*
Ga0070678_10038678113300005456Miscanthus RhizosphereERLLAGAWDWSRSPSNDQGYAALGEFGERGLGVIAYSRAVKFGTLGVCPQR*
Ga0070706_10181385213300005467Corn, Switchgrass And Miscanthus RhizosphereLLAQTWDWSRTVSLDQGYAALGEFGEKGLRLIAYSRAVRFGTLGVCVQR*
Ga0070697_10076125613300005536Corn, Switchgrass And Miscanthus RhizosphereGERLLAGAWDWSCSETLDGGYAALGEFGPQGLRVITYSGAVRFGTLGACPQR*
Ga0066695_1077057613300005553SoilRRSAAEIAFDTLLWERVHGERLLAAAWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR*
Ga0066707_1070141113300005556SoilERVHGERLLTAAWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR*
Ga0066704_1022074233300005557SoilLLWERVHGERLLAATWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR*
Ga0066691_1006042513300005586SoilWDWSRSVSTDQGYAALGEFGPHGLHVIAYSRAVRFGTLGVCAQR*
Ga0066706_1000428813300005598SoilERVHGERLLTAAWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCPQR*
Ga0066706_1017941513300005598SoilFDTLLWERVHGERLLAATWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR*
Ga0068859_10150775913300005617Switchgrass RhizosphereWERVHGERLLANTWDWSRTVSLDQGYAALGEFGEKGLRLIAYSRDVRFGTLGVCVQR*
Ga0066903_10180002813300005764Tropical Forest SoilRAWDWSRSESVDGGLAALGEFRPQGLGVIAYSRAVRFGTLGVCPQR*
Ga0066903_10227322733300005764Tropical Forest SoilSAVEIAWDSLLWQRIRDERLLANAWDWSRSESSDRGLAALGEFGPQGIGVIAYSRAVRFGTLGVCPQR*
Ga0066903_10282050513300005764Tropical Forest SoilWSRSESNDGGLAALGEFRAQGLGVIAYSRAVRFGTLGVCPQR*
Ga0066903_10382491313300005764Tropical Forest SoilAIEIAWDTLCWQRAHGEHLLGDAWDWSRSETTDRGFAALGEYGPDGLRVIAYSRAVRFGTLGVCPQR*
Ga0066903_10679596133300005764Tropical Forest SoilWDTLLWQRARDERLLAHGWDWSRSASNDGGLAALGEFGPRGLGVIAYSRAVRFGTLGVCPQR*
Ga0066903_10744629533300005764Tropical Forest SoilANAWDWSRSPSNDQGFAALGEFGERGLGVIAYSRAVRFGTLGVCAQR*
Ga0068870_1120557433300005840Miscanthus RhizosphereLDQGYAALGEFGEKGLRLIAYSRAVRFGTLGVCVQR*
Ga0070715_1028425313300006163Corn, Switchgrass And Miscanthus RhizosphereWSRSVTTDQGYAALGEFGERGLRVIAYSRAVRFGTLGACLQR*
Ga0070716_10142382613300006173Corn, Switchgrass And Miscanthus RhizosphereDERLLASAWDWSRSESNDGGLAALGEFGPQGLGVIAYSRAVRFGTLGACPQR*
Ga0066653_1049157323300006791SoilRSAAEIAFDTLLWERVHGERLLAATWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR*
Ga0066665_1009763813300006796SoilWERVHGERLLTAAWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCPQR*
Ga0066665_1090512023300006796SoilLCWQRAHGERLLGGQCGWSRSISTDQGYAALGEFGEHGLRVIAYSRAVRFGTLGVCPQR*
Ga0066665_1123082313300006796SoilGERLLAATWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR*
Ga0075428_10020764613300006844Populus RhizosphereWDWSRTVSLDQGYAALGEFGEKGLRLIAYSRAVRFGTLGVCVQR*
Ga0075426_1022020343300006903Populus RhizosphereHWDWSRSVSTDQGHAALGEFGEGGLRVIAYSRAVRFGTLGVCPQR*
Ga0075426_1141678523300006903Populus RhizosphereCWQRAHGERLLARTWDWSRSVSTDQGHAALGEFGPEGLHVIAYSRAVRFGTLGVCTQR*
Ga0075419_1119503113300006969Populus RhizosphereQGYAALGEFGEKGLRLIAYSRAVRFGTLGVCVQR*
Ga0066710_10149820113300009012Grasslands SoilTLLWHRVHGERLLATTWDWSRSLTTDQGYAALGEFGERGLRVIAYSRAVRFGTLGVCTQR
Ga0099829_1013815713300009038Vadose Zone SoilWDWSRSVSTDQGHAALGEFGEHGLRVIAYSRAVRFGTLGVCAQR*
Ga0111539_1158414133300009094Populus RhizosphereFQRARSERLLAGAWDWSRSPSNDQGYAALGEFGERGLGVIAYSRAVRFGTLGVCPQR*
Ga0075418_1110260033300009100Populus RhizosphereHGERLLANTWDWSRTVSLDQGYAALGEFGEKGLRLIAYSRAVRFGTLGVCAQR*
Ga0066709_10003704113300009137Grasslands SoilAWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCPQR*
Ga0066709_10292730813300009137Grasslands SoilPRRRSAPEIALDTLLWQRVHGERLLAATWDWSRSLSTDQGYAALGEFGPDGLRVIAYSRAVRFGTLGVCAQR*
Ga0066709_10469416513300009137Grasslands SoilPEIAFDTLCWQRAHGERLLAACWDWSRSVSTDQGYAALGEFGAAGLRVTAYSRAVRFGTLGVCAQR*
Ga0126380_1009568043300010043Tropical Forest SoilQRAYGEHLLQTGWDWSRSESIDGGLAALGEFGAQGLGVIAYSRAVRFGTLGACPQR*
Ga0126382_1152043513300010047Tropical Forest SoilHGERLLASTWDWSRSPSTDGGFAALGEFSEGGLRVVAYSRAVVFGTLGVCAQR*
Ga0126382_1246184423300010047Tropical Forest SoilLWQRVHGERLLATTWDWSRSLTTDQGYAALGEFGERGLRVIAYSRAVRFGTLGVCTQR*
Ga0134070_1028559513300010301Grasslands SoilAAWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCPQR*
Ga0134082_1006568213300010303Grasslands SoilSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR*
Ga0134109_1023747323300010320Grasslands SoilWQRAHGERLLGGQWDWSRSVSTDQGYAALGEFGEHGLRVIAYSRAVRFGTLGVCPQR*
Ga0134080_1014502613300010333Grasslands SoilAAEIAFDTLLWERVHGERLLAAAWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR*
Ga0134080_1033107523300010333Grasslands SoilVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR*
Ga0134080_1055341613300010333Grasslands SoilRRRSAAEIAFDTLCWHRAHGERLLSRAWDWSRSETIDRGYASLGEFGPDGLRVIAYSAAVRFGTLGVCPQR*
Ga0134071_1019141223300010336Grasslands SoilWDWSRSLSTDQGYAALGEFGPDGLRVIAYSRAVRFGTLGVCAQR*
Ga0126370_1213362423300010358Tropical Forest SoilHWDWSRSLTTDQGYAALGEFTEHGLRVIAYSRAVRFGTLGACVQK*
Ga0126376_1271750513300010359Tropical Forest SoilDEHLLASGWDWSRSESIDGGFAALGEFGPQGLGVIAYSRAVRFGTLGVCPQR*
Ga0126378_1316147313300010361Tropical Forest SoilTLLWQRSRDERLLAKSWDWSRSTSTDGGLAALGEFGPQGLGVIAYSRAVRFGTLGVCPQR
Ga0126378_1327466723300010361Tropical Forest SoilRSESVDEGLVALGEFSDKGLGVIAYSRAVRFGTLGACPQR*
Ga0134124_1133010013300010397Terrestrial SoilWDWSRSVSTDQGHAALGEFGDGGLRVIAYSRAVRFGTLGVCPQR*
Ga0134124_1193414733300010397Terrestrial SoilLADAWDWSRTPSSDHGFVAVGEFHDAGLGVIAYSRAVRFGTLGVCPQR*
Ga0134124_1315825313300010397Terrestrial SoilGERLLADAWDWSRSVSTDQGYAALGEFGTGALRITAYSRAVRFGTLGVCPQR*
Ga0134123_1289634913300010403Terrestrial SoilFDTLCWHRAHGERLLATAWDWSRSVSTDLGHAALGEFGPNGIRVTAYSRAVRFGTLGVCAQR*
Ga0137364_1013848913300012198Vadose Zone SoilLLARTWDWSRSVSTDEGHAALGEFGPDGLRITAYSRAVRFGTLGVCAQR*
Ga0137382_1048517033300012200Vadose Zone SoilAFDTLCWQRAHGVRLLGGQWDWSRSVSTDQGYAALGEFGEHGLRVIAYSRAVRFGTLGVCPQR*
Ga0137362_1078483513300012205Vadose Zone SoilHGERLLAATWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR*
Ga0137380_1143376213300012206Vadose Zone SoilSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR*
Ga0137359_1043709133300012923Vadose Zone SoilTTDHGYVALGEFGAPGLRVAAYSAGVRFGTLGVCPQR*
Ga0137407_1004631513300012930Vadose Zone SoilLLGGHWDWSRSETTDHGYVALGEFGAPGLRVAAYSTGVRFGTLGVCPQR*
Ga0137410_1100235013300012944Vadose Zone SoilSISTDQGYAALGEFGEHGLRVIAYSRAVRFGTLGVCPQR*
Ga0126369_1276082513300012971Tropical Forest SoilRSAIEIAWDTLCWQRAHGEHLLGDAWDWSRSETTDRGFAALGEYGPDGLRVIAYSRAVRFGTLGVCPQR*
Ga0134077_1058168713300012972Grasslands SoilAWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR*
Ga0157375_1082739913300013308Miscanthus RhizosphereTLLWEHVHGERLLAHTWDWSRSVTLDQGYAALGEFGEKGLRLIAYSRAVRFGTLGVCVQR
Ga0157375_1161065013300013308Miscanthus RhizosphereWDWSRSESNDRGLAALGEFGENGLGVIAYSRAVRFGSLGVCPQR*
Ga0134075_1027532613300014154Grasslands SoilEIAFDTLCWQRAHGEYLLSNSWDWSRSETIDRGYASLGEFGPEGLRVIAYSAAVRFGTLGVCPQR*
Ga0180074_112804123300014877SoilVRGERLLAQAWDWSRSPSNDQGYAALGEFGEKGLGVIAYSRAVRFGTLGVCSQR*
Ga0137409_1122421013300015245Vadose Zone SoilWSRSETTDRGYVALGEFGAPGLRVAAYSTGVRFGTLGVCPQR*
Ga0134085_1048112823300015359Grasslands SoilRRRSAPEIAFDTLCWERAHGERLLASCWDWSRSLSTDQGYAALGEFGPGGLRVIAYSRAVRFGTLGVCPQR*
Ga0132255_10286271933300015374Arabidopsis RhizosphereDRGLAALGEFGENGLGVIAYSRAVRFGSLGVCPQR*
Ga0132255_10374309433300015374Arabidopsis RhizosphereVEIAWDTLLWQRTHAERLLADAWDWSRSESSDRGLAALGEFGPQGLGVIAYSRAVRFGTLGVCPQR*
Ga0132255_10527997513300015374Arabidopsis RhizosphereTWEWSRTVSLDQGYAAIGELGEKGLRLIAYSRAVRFGTLGVCVQR*
Ga0182038_1082021513300016445SoilRSESVDEGLVALGEFGDKGLGVIAYSRAVRFGTLGVCPQR
Ga0134083_1018522113300017659Grasslands SoilWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR
Ga0134083_1023781113300017659Grasslands SoilRAWDWSRSETIDRGYASLGEFGPDGLRVIAYSAAVRFGTLGVCPQR
Ga0134083_1055334813300017659Grasslands SoilSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR
Ga0187776_1092178023300017966Tropical PeatlandLSDTWDWSRSVSTDQGYAALGEFGPTGVRVIAYSRAVRFGTLGVCAQR
Ga0187765_1131492023300018060Tropical PeatlandWDWSRSASSDQGLAALGEFGADGLRVIAYSRAVRFGTLGVCPQR
Ga0066655_1058308013300018431Grasslands SoilRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCPQR
Ga0066667_1000256713300018433Grasslands SoilAWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCPQR
Ga0066669_1004103713300018482Grasslands SoilWERVHGERLLTAAWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCPQR
Ga0066669_1184401713300018482Grasslands SoilSWDWSRSETIDRGYASLGEFGPEGLRVIAYSAAVRFGTLGVCPQR
Ga0210392_1147284023300021475SoilARELLAGAWDWSRSESVDEGLVALGEFGDKGLGVIAYSRAVRFGTLGVCPQR
(restricted) Ga0233424_1020803913300023208FreshwaterDSLLWREVSGHHLLSAHWDWSRTETDDNAFVALGGFGPDGLGVIGYSGAVRFGTLGICPQ
Ga0207680_1088657633300025903Switchgrass RhizosphereDHGFVAVGEFHDAGLGVIAYSRAVRFGTLGVCPQR
Ga0207685_1011936223300025905Corn, Switchgrass And Miscanthus RhizosphereATHWDWSRSVTTDQGYAALGEFGERGLRVIAYSRAVRFGTLGACLQR
Ga0207660_1108885433300025917Corn RhizosphereRSAVEIAFDTLVWHRVRGERLLTDSWDWSRSPSNDQGFAALGEFGERGLGVIAYSRAVRFGTLGVCPQR
Ga0207646_1092021023300025922Corn, Switchgrass And Miscanthus RhizosphereERLLTAAWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCPQR
Ga0207665_1143110513300025939Corn, Switchgrass And Miscanthus RhizosphereRARDERLLASAWDWSRSESNDGGLAALGEFGPQGLGVIAYSRAVRFGTLGACPQR
Ga0207691_1090786833300025940Miscanthus RhizosphereDTLLWHKVHGERLLASTWDSSRSESNDRGLAALGEFGENGLGVIAYSRAVRFGSLGVCPQ
Ga0207678_1201037423300026067Corn RhizosphereAWDWSRSPSNDQGYAALGEFGERGLGVIAYSRAVKFGTLGVCPQR
Ga0207641_1094155433300026088Switchgrass RhizosphereLAGAWDWSRSPSNDQGYAALGEFGERGLGVIAYSRAVKFGTLGVCPQR
Ga0209235_113606923300026296Grasslands SoilHGERLLAATWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR
Ga0209237_111093013300026297Grasslands SoilSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR
Ga0209236_121519923300026298Grasslands SoilPRRRSAPEIALDTLLWQRVHGERLLAATWDWSRSLSTDQGYAALGEFGPDGLRVIAYSRAVRFGTLGVCAQR
Ga0209468_118477723300026306SoilAWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR
Ga0209265_114723523300026308SoilLLWERVHGERLLAATWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR
Ga0209472_112836413300026323SoilRSAPEIAFDTLLWERVHGERLLTAAWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCPQR
Ga0209266_104233913300026327SoilAAWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCPQR
Ga0209802_108161233300026328SoilHRRSAVEIAFDTLCWQRVHGERLLGGHWDWSRSETTDHGYVALGEFGAPGLRVAAYSTGVRFGTLGVCPQR
Ga0209158_125766133300026333SoilTLCWQRVHGERLLGGHWDWSRSETTDHGYVALGEFGAPGLRVAAYSTGVRFGTLGVCPQR
Ga0209378_100344913300026528SoilLWERVHGERLLTAAWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCPQR
Ga0209806_116659713300026529SoilVDVAAHGVRLLGGQWDWSRSVSTDQGYAALGEFGEHGLRVIAYSRAVRFGTLGVCAQR
Ga0209058_102874713300026536SoilSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCPQR
Ga0209157_133792023300026537SoilRRRSASEIAFDTLCWQRAHGERLLGGHWDWSRSVSTDQGYAALGEFGEHGLRVIAYSRAVRFGTLGVCPQR
Ga0207428_1003845563300027907Populus RhizosphereVTLDQGYAALGEFGEKGLRLIAYSRAVRFGTLGVCVQR
Ga0137415_1027173133300028536Vadose Zone SoilGGQWDWSRSISTDQGYAGLGEFGEHGLRVIAYSRAVRFGTLGVCPQR
Ga0247828_1002544313300028587SoilTWDWSRTVSLDQGYAALGEFGEKGLRLIAYSRAVRFGTLGVCAQR
Ga0247828_1006483113300028587SoilVYDTLLWEHVHGERLLATTWDWSRSVTLDQGYAALGEFGEKGLRLIAYSRAVRFGTLGVCVQR
Ga0247828_1123876923300028587SoilGERLLAACWDWSRSVSTDQGHPALGEFGTAGLRVIAYSRAVRFGTLGVCPQR
Ga0247818_1074523433300028589SoilANTWDWSRTVSLDQGYAALGEFGEKGLRLIAYSRAVRFGTLGVCAQR
Ga0170818_10010536333300031474Forest SoilWSRSESNDGGLAAFGEFGPQGLGVIAYSRAVRFGTLGACPQR
Ga0318515_1077651623300031572SoilTHSERLLGGAWDWCRSESVDEGLVALGEFSDKGLGVIAYSRAVRFGTLGVCPQR
Ga0318555_1014162033300031640SoilHNERLLAGSWDWSRSESVDEGLVALGEFGDKGLGVIAYSRAVRFGTLGVCPQR
Ga0318496_1035357133300031713SoilSPSTDQGYAALGEFGAQGLRVVAYSRAVRFGTLGVCPQR
Ga0306917_1157561113300031719SoilERLLGGAWDWSRSESVDEGLVALGEFSDKGLGVIAYSRAVRFGTLGVCPQR
Ga0307469_1180916323300031720Hardwood Forest SoilTSIDEGLAALGEFGAKGLRVIAYSRAVKFGTLGVCAQR
Ga0318554_1048737733300031765SoilDEGLVALGEFGDKGLGVIAYSRAVRFGTLGACPQR
Ga0318543_1055926613300031777SoilRSAIEIAWDTLLWHRTHSERLLAGAWDWSRSESVDEGLVALGEFSDKGLGVIAYSRAVRFGTLGVCPQR
Ga0307473_1056057913300031820Hardwood Forest SoilTDGGYAALGELGPAGLRVIAYSGAVRFGTLGVCPQR
Ga0307473_1144757823300031820Hardwood Forest SoilRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQH
Ga0307473_1156045023300031820Hardwood Forest SoilRLLPDCWDWSRSTSTDEGEAALGEFGNAGLRVIAYSHAVKFGTLGVCAQR
Ga0318567_1071671733300031821SoilTLLWHRTHDERLLAGAWDWSRSESVDEGLVALGEFGDKGLGVIAYSRAVRFGTLGACPQR
Ga0318564_1026694533300031831SoilSVDEGLVALGEFGDKGLGVIAYSRAVRFGTLGACPQR
Ga0318527_1004746013300031859SoilAWDWSRSESVDEGLVALGEFSDKGLGVIAYSRAVRFGTLGVCPQR
Ga0306923_1064354533300031910SoilRRSAVEIAWDTLLWQRTHNERLLAGSWDWSRSESVDEGLVALGEFGDKGLGVIAYSRAVRFGTLGVCPQR
Ga0310916_1120523633300031942SoilLLAGAWDWSRSESVDEGLVALGEFSDKGLGVIAYSRAVRFGTLGVCPQR
Ga0310909_1021162513300031947SoilLWHRTHDERLLAGAWDWSRSESVDEGLVALGEFGDKGLGVIAYSRAVRFGTLGACPQR
Ga0307479_1142612813300031962Hardwood Forest SoilWSRSVSTDQGYAALGEFGDGGLRVIAYSRAVRFGTLGVCPQR
Ga0318563_1059940423300032009SoilEIAWDTLLWHRVRDERLLAGSWDWSRSESNDGGLAALGEFGPQGLGVIAYSKAVRFGTLGVCPQR
Ga0318569_1010941633300032010SoilLLWHRTHSERLLAGAWDWSRSESVDEGLVALGEFGAKGLGVIAYSRAVRFGTLGACPQR
Ga0318549_1029608833300032041SoilTLLWHRTHSERLLGGAWDWCRSESVDEGLVALGEFSDKGLGVIAYSRAVRFGTLGVCPQR
Ga0310890_1131840313300032075SoilGTRLLADAWDWSRTPSSDHGFVAVGEFHDAGLGVIAYSRAVRFGTLGVCPQR
Ga0315283_1233218823300032164SedimentEIAFDTLVWQRARGERLLGDAWDWSRSPSNDQGFAALGEFGPQGLGVIAYSRAVRFGTLGVCPQR
Ga0307470_1121618223300032174Hardwood Forest SoilRSVTTDQGYAALGEFGERGLRVIAYSRAVRFGTLGACLQR
Ga0315276_1206963733300032177SedimentDAWDWSRSPSNDQGFAALGEFGPQGLGVIAYSRAVRFGTLGVCPQR
Ga0310889_1036394113300032179SoilRLLANTWDWSRTVSLDQGYAAIGEFGEKGLRLIAYSRAVRFGTLGVCVQR
Ga0307471_10002722913300032180Hardwood Forest SoilRAHGERLLATHWDWSRSVTTDQGYAALGEFGERGLRVIAYSRAVRFGTLGACLQR
Ga0307471_10247566823300032180Hardwood Forest SoilPRRRSAPEIAFDTLLWERVHGERLLTAAWDWSRSVSTDQGYAALGEFGPHGLRVIAYSRAVRFGTLGVCAQR
Ga0307471_10341689613300032180Hardwood Forest SoilLCWHRVHGERLLATAWDWSRSVSTDQGYAALGEFGDAGLRITAYSRAVRFGTLGVCPQR
Ga0307472_10051037933300032205Hardwood Forest SoilTDRGYVALGEFGAQGLRVAAYSTGVRFGTLGVCPQR
Ga0318519_1011923513300033290SoilHDERLLAGAWDWSRSESVDEGLVALGEFGDKGLGVIAYSRAVRFGTLGACPQR
Ga0326731_108540033300033502Peat SoilATTDRGLAALGEFGAEGLRVVGYSRAVRFGTLGVCPQR
Ga0247830_1027452543300033551SoilVEIVYDTLLWEHVHGERLLAATWDWSRSVTLDQGYAALGEFGEKGLRLIAYSRAVRFGTLGVCVQR
Ga0247830_1148280223300033551SoilAVEIAFDVLCWHRLHGERLLAACWDWSRSVSTDQGHPALGEFGTAGLRVIAYSRAVRFGTLGVCPQR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.