| Basic Information | |
|---|---|
| Family ID | F039320 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 164 |
| Average Sequence Length | 41 residues |
| Representative Sequence | AESIVFKGAVAVPPAAQKMIAYLNQKSPKNLSDPESLK |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 164 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.61 % |
| % of genes near scaffold ends (potentially truncated) | 98.17 % |
| % of genes from short scaffolds (< 2000 bps) | 88.41 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.902 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (35.976 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.146 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.073 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.76% β-sheet: 0.00% Coil/Unstructured: 74.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 164 Family Scaffolds |
|---|---|---|
| PF00440 | TetR_N | 53.05 |
| PF13533 | Biotin_lipoyl_2 | 6.71 |
| PF00005 | ABC_tran | 3.05 |
| PF16576 | HlyD_D23 | 1.83 |
| PF01145 | Band_7 | 1.22 |
| PF08544 | GHMP_kinases_C | 1.22 |
| PF12698 | ABC2_membrane_3 | 1.22 |
| PF00529 | CusB_dom_1 | 1.22 |
| PF04255 | DUF433 | 0.61 |
| PF02627 | CMD | 0.61 |
| PF12700 | HlyD_2 | 0.61 |
| PF04366 | Ysc84 | 0.61 |
| PF07228 | SpoIIE | 0.61 |
| PF00903 | Glyoxalase | 0.61 |
| PF12704 | MacB_PCD | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 164 Family Scaffolds |
|---|---|---|---|
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.61 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.61 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.61 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.90 % |
| Unclassified | root | N/A | 6.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001867|JGI12627J18819_10330337 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300002907|JGI25613J43889_10227243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 504 | Open in IMG/M |
| 3300003352|JGI26345J50200_1009335 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300004080|Ga0062385_10026847 | All Organisms → cellular organisms → Bacteria | 2255 | Open in IMG/M |
| 3300004091|Ga0062387_101374422 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300004092|Ga0062389_102023309 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300004479|Ga0062595_100678490 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300005178|Ga0066688_10653651 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300005458|Ga0070681_10438987 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300005468|Ga0070707_100582415 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300005536|Ga0070697_102058440 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005561|Ga0066699_10104032 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| 3300005586|Ga0066691_10447525 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300005598|Ga0066706_11067650 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005610|Ga0070763_10054314 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
| 3300005764|Ga0066903_106426199 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005842|Ga0068858_100125423 | All Organisms → cellular organisms → Bacteria | 2403 | Open in IMG/M |
| 3300005881|Ga0075294_1019039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 640 | Open in IMG/M |
| 3300005952|Ga0080026_10115743 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300006028|Ga0070717_10222893 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300006050|Ga0075028_100755771 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300006059|Ga0075017_100369774 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300006086|Ga0075019_10785989 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006172|Ga0075018_10562085 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300006175|Ga0070712_100059796 | All Organisms → cellular organisms → Bacteria | 2685 | Open in IMG/M |
| 3300006176|Ga0070765_101671748 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300006755|Ga0079222_12563245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 512 | Open in IMG/M |
| 3300006796|Ga0066665_11461410 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300007076|Ga0075435_100510191 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300007255|Ga0099791_10040083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2078 | Open in IMG/M |
| 3300007258|Ga0099793_10345888 | Not Available | 726 | Open in IMG/M |
| 3300007258|Ga0099793_10722630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300007265|Ga0099794_10098097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1461 | Open in IMG/M |
| 3300009038|Ga0099829_10703342 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300009038|Ga0099829_10843486 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300009088|Ga0099830_10317168 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1247 | Open in IMG/M |
| 3300009088|Ga0099830_11835419 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300009088|Ga0099830_11858528 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300009089|Ga0099828_10902761 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300009089|Ga0099828_11446106 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300009090|Ga0099827_10560937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300009137|Ga0066709_101603912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 931 | Open in IMG/M |
| 3300009545|Ga0105237_10700140 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300009792|Ga0126374_11056497 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300010159|Ga0099796_10391271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300010358|Ga0126370_12266663 | Not Available | 537 | Open in IMG/M |
| 3300010359|Ga0126376_10061280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2708 | Open in IMG/M |
| 3300010360|Ga0126372_10028285 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3461 | Open in IMG/M |
| 3300010360|Ga0126372_10709952 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300010360|Ga0126372_11256834 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300010360|Ga0126372_13278077 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300010364|Ga0134066_10006259 | All Organisms → cellular organisms → Bacteria | 2237 | Open in IMG/M |
| 3300010366|Ga0126379_10146365 | All Organisms → cellular organisms → Bacteria | 2194 | Open in IMG/M |
| 3300010366|Ga0126379_13580769 | Not Available | 520 | Open in IMG/M |
| 3300010379|Ga0136449_101711205 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300010398|Ga0126383_10344419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1508 | Open in IMG/M |
| 3300010877|Ga0126356_10044325 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300011270|Ga0137391_11293344 | Not Available | 576 | Open in IMG/M |
| 3300011271|Ga0137393_10379938 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1209 | Open in IMG/M |
| 3300011271|Ga0137393_10669673 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300011271|Ga0137393_10726138 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300011271|Ga0137393_11563892 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012096|Ga0137389_10086188 | All Organisms → cellular organisms → Bacteria | 2466 | Open in IMG/M |
| 3300012096|Ga0137389_10836960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300012096|Ga0137389_11158149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300012199|Ga0137383_10998184 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300012202|Ga0137363_10982633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300012203|Ga0137399_10903140 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300012203|Ga0137399_11252106 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300012203|Ga0137399_11269137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 620 | Open in IMG/M |
| 3300012207|Ga0137381_10606965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
| 3300012210|Ga0137378_11857103 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300012211|Ga0137377_11017991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300012349|Ga0137387_10635285 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300012349|Ga0137387_10945511 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300012351|Ga0137386_11110493 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300012357|Ga0137384_10455028 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300012359|Ga0137385_10997609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300012359|Ga0137385_11041608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300012363|Ga0137390_10873440 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300012917|Ga0137395_10522344 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300012918|Ga0137396_10108887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1986 | Open in IMG/M |
| 3300012918|Ga0137396_11103316 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012918|Ga0137396_11208668 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012922|Ga0137394_10682209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 866 | Open in IMG/M |
| 3300012924|Ga0137413_11693382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300012925|Ga0137419_10194502 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1498 | Open in IMG/M |
| 3300012925|Ga0137419_10959177 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300012925|Ga0137419_11309643 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300012929|Ga0137404_11320105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 665 | Open in IMG/M |
| 3300012929|Ga0137404_11412649 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300012930|Ga0137407_10793885 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300012930|Ga0137407_11995512 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300012931|Ga0153915_12703253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300014150|Ga0134081_10146833 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300014157|Ga0134078_10668335 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300015052|Ga0137411_1159023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 795 | Open in IMG/M |
| 3300015053|Ga0137405_1142687 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300015054|Ga0137420_1032000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 976 | Open in IMG/M |
| 3300015054|Ga0137420_1264925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1033 | Open in IMG/M |
| 3300015054|Ga0137420_1307132 | All Organisms → cellular organisms → Bacteria | 9053 | Open in IMG/M |
| 3300015242|Ga0137412_10352166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1146 | Open in IMG/M |
| 3300015264|Ga0137403_10505730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 1079 | Open in IMG/M |
| 3300015357|Ga0134072_10172366 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300016404|Ga0182037_11298217 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300017659|Ga0134083_10147134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 952 | Open in IMG/M |
| 3300017933|Ga0187801_10020457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2247 | Open in IMG/M |
| 3300017937|Ga0187809_10253903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300017948|Ga0187847_10364203 | Not Available | 792 | Open in IMG/M |
| 3300017955|Ga0187817_11009330 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300018433|Ga0066667_10286453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1272 | Open in IMG/M |
| 3300020199|Ga0179592_10221474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
| 3300020579|Ga0210407_10333649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1186 | Open in IMG/M |
| 3300020579|Ga0210407_10566356 | Not Available | 886 | Open in IMG/M |
| 3300021170|Ga0210400_10875198 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300021170|Ga0210400_11290380 | Not Available | 585 | Open in IMG/M |
| 3300021476|Ga0187846_10415795 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300021479|Ga0210410_11196974 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300024331|Ga0247668_1132367 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300025922|Ga0207646_10978278 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300025922|Ga0207646_11711345 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300026291|Ga0209890_10010582 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3757 | Open in IMG/M |
| 3300026305|Ga0209688_1032685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 998 | Open in IMG/M |
| 3300026335|Ga0209804_1048063 | All Organisms → cellular organisms → Bacteria | 2093 | Open in IMG/M |
| 3300026499|Ga0257181_1017010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1046 | Open in IMG/M |
| 3300026508|Ga0257161_1033023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1021 | Open in IMG/M |
| 3300027383|Ga0209213_1073427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300027521|Ga0209524_1135697 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300027610|Ga0209528_1066137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300027645|Ga0209117_1165760 | Not Available | 571 | Open in IMG/M |
| 3300027667|Ga0209009_1103146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 724 | Open in IMG/M |
| 3300027698|Ga0209446_1140843 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300027701|Ga0209447_10135324 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300027737|Ga0209038_10101694 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300027775|Ga0209177_10146115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
| 3300027842|Ga0209580_10354475 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300027853|Ga0209274_10722845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300027875|Ga0209283_10057992 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
| 3300027875|Ga0209283_10099960 | All Organisms → cellular organisms → Bacteria | 1897 | Open in IMG/M |
| 3300027884|Ga0209275_10263666 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300027889|Ga0209380_10305467 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300028037|Ga0265349_1000881 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3092 | Open in IMG/M |
| 3300028138|Ga0247684_1005310 | All Organisms → cellular organisms → Bacteria | 2017 | Open in IMG/M |
| 3300028673|Ga0257175_1053640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 743 | Open in IMG/M |
| 3300029636|Ga0222749_10480868 | Not Available | 669 | Open in IMG/M |
| 3300031234|Ga0302325_10608901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1606 | Open in IMG/M |
| 3300031718|Ga0307474_10130405 | All Organisms → cellular organisms → Bacteria | 1890 | Open in IMG/M |
| 3300031718|Ga0307474_10745513 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300031736|Ga0318501_10434960 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300031753|Ga0307477_10279734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1154 | Open in IMG/M |
| 3300031768|Ga0318509_10695232 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300031823|Ga0307478_11247117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300031894|Ga0318522_10427273 | Not Available | 502 | Open in IMG/M |
| 3300031912|Ga0306921_11014187 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300031954|Ga0306926_12981171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 506 | Open in IMG/M |
| 3300031962|Ga0307479_10041256 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4431 | Open in IMG/M |
| 3300031962|Ga0307479_10108177 | All Organisms → cellular organisms → Bacteria | 2704 | Open in IMG/M |
| 3300031962|Ga0307479_11731461 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300032035|Ga0310911_10327444 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300032160|Ga0311301_11246817 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300032180|Ga0307471_100459360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1414 | Open in IMG/M |
| 3300032180|Ga0307471_101934145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300033289|Ga0310914_10824178 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300033547|Ga0316212_1001185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methyloterricola → Methyloterricola oryzae | 3487 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 35.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.10% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.49% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.05% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.44% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.22% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.22% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.61% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.61% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.61% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.61% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.61% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.61% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.61% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.61% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300003352 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005881 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_202 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J18819_103303371 | 3300001867 | Forest Soil | KKVSAENIIRKGAVAVPPAGQELVALLNKKSPKNLSDPTSLKE* |
| JGI25613J43889_102272431 | 3300002907 | Grasslands Soil | KVEATDIVFKGAVRVPPSSRALVDYLNKKTPKNLSDPESLK* |
| JGI26345J50200_10093351 | 3300003352 | Bog Forest Soil | KLEAEDIIFRGAVAVPPPAQKLIAYLNRKSPRNLSDPNSLKE* |
| Ga0062385_100268471 | 3300004080 | Bog Forest Soil | ERVYGKKLTAEDIIFKGAVAVPPPAQKLVSTLNLKTPKNNSDPNSLKE* |
| Ga0062387_1013744221 | 3300004091 | Bog Forest Soil | LTAEDIIFKGAVAVPPPAQKLVSTLNLKTPKNNSDPNSLKE* |
| Ga0062389_1020233092 | 3300004092 | Bog Forest Soil | KKVEAVSIVFKGAVAVPPPAQQMIAYLNQKSPKNMSDPNSLRE* |
| Ga0062595_1006784901 | 3300004479 | Soil | EAQDVVFKGVVPVPAAAQKMVAYLNKKSPKNLSDPDSLK* |
| Ga0066688_106536512 | 3300005178 | Soil | GNERLYGKKVEAESIVFQGAVAVPPAAQKLIAYLNQKSPKNTSDPESLK* |
| Ga0070681_104389871 | 3300005458 | Corn Rhizosphere | KQNVDAEAIIMKGAVAVPPPAQQMIAYLNRKSPKNTSDPNSLKE* |
| Ga0070707_1005824154 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MEARDIIRKGAVPVPAAGEQLVALLNQKSPKNLSDPNSLK* |
| Ga0070697_1020584401 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VEAESIIFKGAVPVPPAAQKLVSLLNRKSPKNLSDPGSNN* |
| Ga0066699_101040321 | 3300005561 | Soil | QIVRKGAAAVPPSGQEMIAFLNKKSPKNLSDPNSLKE* |
| Ga0066691_104475251 | 3300005586 | Soil | YGKKVEAESIVFKGALAVPPAAQKMIAYLNQKSPKNNSDPESLK* |
| Ga0066706_110676503 | 3300005598 | Soil | VFKGAVRVPAPAQPLVAYLNKKTPKNLSDPDSLK* |
| Ga0070763_100543141 | 3300005610 | Soil | IRKGAAAVPPSGQELIATLNKKSPKNLSDPNSLKE* |
| Ga0066903_1064261992 | 3300005764 | Tropical Forest Soil | KKVEAQDVIFKGVVAVPTSAQQMVAYLNKKTPKNLSDPASLK* |
| Ga0068858_1001254234 | 3300005842 | Switchgrass Rhizosphere | LYGKKVQAQDIVFKGVVPVPAAAQKMVVYLNQKSPKNLSDPESLK* |
| Ga0075294_10190392 | 3300005881 | Rice Paddy Soil | EKIYGRKIGAEDIIRKGAARTPPSGQQLVALLNKKSPKNLSDPESLK* |
| Ga0080026_101157432 | 3300005952 | Permafrost Soil | YGQKVSAQDIVFKGAVQVPAPAQPMIGYLNHRSPKNLSEPSSLHE* |
| Ga0070717_102228931 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | KVEATDIVFKGAVRVPPPARPLVEYLNKKTPKNLSDPESLK* |
| Ga0075028_1007557711 | 3300006050 | Watersheds | ANERIYGKKVEAESIVFKGAVAVPPAAQKMIAYLNQKSPKNMSDPDSLK* |
| Ga0075017_1003697741 | 3300006059 | Watersheds | RIYGKKVEAESIVFKGAVAVPPAAQKLVAYLNQKSPKNTSDPDSLK* |
| Ga0075019_107859891 | 3300006086 | Watersheds | YGKKVEAESIVFKGAVAVPPAAQKMVAYLNQKSPKNTSDPDSLK* |
| Ga0075018_105620851 | 3300006172 | Watersheds | ERIYGKKIEAESIVFKGAVAVPPSAQKMVAYLNQKSPKNTSDPDSLK* |
| Ga0070712_1000597961 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ERVYGKKVTAQDIVFNGTVRVPPPAQKMTSYLNKKSPKNLSDPDSLK* |
| Ga0070765_1016717482 | 3300006176 | Soil | EEIIFRGAVAVPPPGQKLVAYLNRKSPKNTSDPNSLKE* |
| Ga0079222_125632451 | 3300006755 | Agricultural Soil | MDAKDIVRKGGVATPPASQKMVSLLDQHSPKNTSDPNSLK* |
| Ga0066665_114614101 | 3300006796 | Soil | QIVRKGSVAVPPAGQEMIALLNKKSPKNLSDPNSLKE* |
| Ga0075435_1005101913 | 3300007076 | Populus Rhizosphere | LYGKTVEAQDVVFKGVVPVPAAAQKMVAYLNKKSPKNLSDPDSLK* |
| Ga0099791_100400831 | 3300007255 | Vadose Zone Soil | KIEAESIVFKGAVAVPPAAQKMIAYLNQKSPKNLSDPESLK* |
| Ga0099793_103458881 | 3300007258 | Vadose Zone Soil | EAESIVFKGAVAVPSAAQKMIAYLNQKSPKNTSDAATHK* |
| Ga0099793_107226301 | 3300007258 | Vadose Zone Soil | RIYAKKVEAESIVFKGAVAVPPAAQKMIAYLNQKSPKNTSDPESLK* |
| Ga0099794_100980972 | 3300007265 | Vadose Zone Soil | EKIYGRKIDARDIIRKGAVAVPPSGQKLVALRNQKSPKNESDPNSLK* |
| Ga0099829_107033422 | 3300009038 | Vadose Zone Soil | YGRKVTAEEIIRKGAVALPGAAQQMVALLNKKSPKNTSDPESLK* |
| Ga0099829_108434861 | 3300009038 | Vadose Zone Soil | KVTAEQVVRKGAVAVPPSGQEMIGLLNKKSPKNLSDPNSLKE* |
| Ga0099830_103171681 | 3300009088 | Vadose Zone Soil | KLYKGKVTAEQVVRKGAVAVPPSGQEMIGLLNKKSPKNLSDPNSLKE* |
| Ga0099830_118354191 | 3300009088 | Vadose Zone Soil | EIIRKGAVGVPGAAQQMVALLNKKSPKNTSDPESLK* |
| Ga0099830_118585282 | 3300009088 | Vadose Zone Soil | GKKVDAESIIFKGAVAVPPAAQKLIAYLNQKSPKNTSDPASLK* |
| Ga0099828_109027611 | 3300009089 | Vadose Zone Soil | IDARDIIRKGAVAVPPSGQKLVALLNQKSPKNESDPNSLK* |
| Ga0099828_114461062 | 3300009089 | Vadose Zone Soil | GKVTAEQVVRKGAVAVPPSGQEMIGLLNKKSPKNLSDPNSLKE* |
| Ga0099827_105609371 | 3300009090 | Vadose Zone Soil | ARDIIRKGAVAVPPSGQKLVALLNQKSPKNESDPNSLK* |
| Ga0066709_1016039121 | 3300009137 | Grasslands Soil | EKLYKGKVTAEQIVRKGSVAVPPAGQEMIALLNKKSPKNLSDPNSLKE* |
| Ga0105237_107001401 | 3300009545 | Corn Rhizosphere | VFKGVVPVPASAQKMVAYLNKKTPKNLSDPESLK* |
| Ga0126374_110564972 | 3300009792 | Tropical Forest Soil | LYGRKVAAQDIIFKGAVPVPAAAQKMVAYLNKKTPKNLSDPESLK* |
| Ga0099796_103912711 | 3300010159 | Vadose Zone Soil | TATEIVRGGAVKTPSAGQKMVALLNKKSPKNLSDPESLK* |
| Ga0126370_122666631 | 3300010358 | Tropical Forest Soil | IVRKGAVAVPPSGQELIGLLNKKSPKNLSDANSLKE* |
| Ga0126376_100612801 | 3300010359 | Tropical Forest Soil | IVRKGAVAVPPSGQELIGLLNKKSPKNLSDPNSLKE* |
| Ga0126372_100282851 | 3300010360 | Tropical Forest Soil | KKKVEAEDIIFKGAVPVPESAQKFVGYLNKKTPKNLSDPASLK* |
| Ga0126372_107099521 | 3300010360 | Tropical Forest Soil | GKRVEAENIILKGAVPVPSPAQGMVAYLNKKTPKNLSDPNSLK* |
| Ga0126372_112568341 | 3300010360 | Tropical Forest Soil | IVFKGSVAVPSSGQKMVAYLNQKSPKNKSDAASLKE* |
| Ga0126372_132780772 | 3300010360 | Tropical Forest Soil | YGKKLEAQDIVFKGAVRVPASGQQMIAYLNKKSPKNLSDPESLK* |
| Ga0134066_100062591 | 3300010364 | Grasslands Soil | PAEDIIRKGAVAVPPSGQEMIALLNKKSPKNLSDPGSLKE* |
| Ga0126379_101463651 | 3300010366 | Tropical Forest Soil | VEASDIIFKGAVPVPSSAQALVAYLNKKTPKNRSDPDSLK* |
| Ga0126379_135807691 | 3300010366 | Tropical Forest Soil | VEAEDIVRKGAVAVPPSGQELIGLLNKKSPKNLSDANSLKE* |
| Ga0136449_1017112052 | 3300010379 | Peatlands Soil | EAIIFKGAVAVPPPAQKLVSYLNRKSPKNMSDPNSLKE* |
| Ga0126383_103444191 | 3300010398 | Tropical Forest Soil | NEVLYKKKVEAGDIIFKGAVPVPPSAQKMVAYLNKRTPKNLSDPDSLK* |
| Ga0126356_100443251 | 3300010877 | Boreal Forest Soil | AEQIIFKGAVAVPPPAQKLIAYLNRKSPKNTSDPNSLKE* |
| Ga0137391_112933441 | 3300011270 | Vadose Zone Soil | EDIVFKGVAAVPPSAQKLIAYLNQKSPKNTSDPSSLKE* |
| Ga0137393_103799381 | 3300011271 | Vadose Zone Soil | SIVFKGAVAVPPAAQKMIAYLNQKSPKNTSDPDSLK* |
| Ga0137393_106696731 | 3300011271 | Vadose Zone Soil | EAIVRKGAVAVPPAAQQLIGVLNKKSPKNLSDPASLKE* |
| Ga0137393_107261381 | 3300011271 | Vadose Zone Soil | KKVEATDIVFKGAVRVPAPARAMVNYLNKKTPKNLSDPESLK* |
| Ga0137393_115638922 | 3300011271 | Vadose Zone Soil | SIIFKGAVAVPPSAQKFIAYLNQKSPKNLSDPASLKE* |
| Ga0137389_100861881 | 3300012096 | Vadose Zone Soil | KVEAESIIFKGAVAVPPAAQKLVAYLNQKSPKNTSDPASLK* |
| Ga0137389_108369601 | 3300012096 | Vadose Zone Soil | KVEAESIVFKGAVAVPPAAQKMIAYLNQKSPKNTSDPDSLK* |
| Ga0137389_111581491 | 3300012096 | Vadose Zone Soil | VEAESIVRKGAVAVPPSAQELISTLNKKSPKNLSDPASLKE* |
| Ga0137383_109981841 | 3300012199 | Vadose Zone Soil | SIVRKGAVAVPPSAQELIGMLNKKSPKNLSDPASLKE* |
| Ga0137363_109826331 | 3300012202 | Vadose Zone Soil | LYGKKVTATEIVRKGAVPVPSSAQKLVALLNKKSPKNLSDPESLK* |
| Ga0137399_109031402 | 3300012203 | Vadose Zone Soil | DNDGNERVYGKKVEAESIVFKGAVAVPPPAQKLVAYLNQKSPKNTSDPNSLKE* |
| Ga0137399_112521061 | 3300012203 | Vadose Zone Soil | ESIVFKGAVAVPPAAQKMIAYLNQKSPKNTSDPESLK* |
| Ga0137399_112691371 | 3300012203 | Vadose Zone Soil | SIVFRGAVAVPPAAQKMIAYLNQKSPKNLSDPESLK* |
| Ga0137381_106069651 | 3300012207 | Vadose Zone Soil | YKGKVTAEQIVRKGSVAVPPSGQEMIALLNKKSPKNLSDPNSLKE* |
| Ga0137378_118571032 | 3300012210 | Vadose Zone Soil | ESIVRKGAVAVPPSAQELIGMLNKKSPKNLSDPASLKE* |
| Ga0137377_110179912 | 3300012211 | Vadose Zone Soil | AESIVFKGTVAVPPAAQKMIAYLNQKSAKNTSDPESLK* |
| Ga0137387_106352851 | 3300012349 | Vadose Zone Soil | IIFKGAVAVPPSAQRFIAYLNQKSPKNLSDPASLKE* |
| Ga0137387_109455112 | 3300012349 | Vadose Zone Soil | EATDIIFKGKVAVPGPAQKLVAYLNQKTPKNLSDPESLK* |
| Ga0137386_111104932 | 3300012351 | Vadose Zone Soil | AEEIIRKGAVAVPPSGQEMIALLNKKSPKNLSDPGSLKE* |
| Ga0137384_104550281 | 3300012357 | Vadose Zone Soil | KVTATEIVRQGAVPVPASGQKMVSLLDKKSPKNLSDPNSLK* |
| Ga0137385_109976091 | 3300012359 | Vadose Zone Soil | SIVFKGTVAVPPAAQKMIAYLNQKSPKNTSDPESLK* |
| Ga0137385_110416081 | 3300012359 | Vadose Zone Soil | AESIVFKGAVAVPPAAQKLIAYLNQKSPKNTSDPESLK* |
| Ga0137390_108734401 | 3300012363 | Vadose Zone Soil | KVDAESIIFKGAVAVPPAAQKLIAYLNQKSPKNTSDPASLK* |
| Ga0137395_105223441 | 3300012917 | Vadose Zone Soil | KLDAKDIIFKGVVRVPPSGRALVDYLNKKTPKNLSDPTSLK* |
| Ga0137396_101088873 | 3300012918 | Vadose Zone Soil | AESIVFKGAVAVPPAAQKMIAYLNQKSPKNLSDPESLK* |
| Ga0137396_111033161 | 3300012918 | Vadose Zone Soil | EAESIVFKGAVAVPPAAQKMIAYLNQKSPKNTSDPESLK* |
| Ga0137396_112086681 | 3300012918 | Vadose Zone Soil | ESIVFKGAVAVPPAAQKMIAYLNQKSPKNKSDPESLK* |
| Ga0137394_106822092 | 3300012922 | Vadose Zone Soil | ESIVFKGAVAVPPAAQKMIAYLNQKSPKNLSDPESLK* |
| Ga0137413_116933822 | 3300012924 | Vadose Zone Soil | VRKGAVPVPSSAQKLVALLNKKSPKNLSDPDSLK* |
| Ga0137419_101945021 | 3300012925 | Vadose Zone Soil | ERVYGKKVESTDIVFKGAVRVPPPARAMVDYLNKKTPKNLSDPESLK* |
| Ga0137419_109591772 | 3300012925 | Vadose Zone Soil | GKKVEAESIVFKGAVAVPPAAQKLIAYLNQKSPKNTSDPESLK* |
| Ga0137419_113096432 | 3300012925 | Vadose Zone Soil | ESIVFKGAVAVPPPAQKLVAYLNQRSPKNLSEAGSNK* |
| Ga0137404_113201052 | 3300012929 | Vadose Zone Soil | KKVEAESIVFKGAVAVPPAAQKMIAYLNQKSPKNLSDPESLK* |
| Ga0137404_114126491 | 3300012929 | Vadose Zone Soil | KKVEAESIVFKGAVAVPSAAQKMVAYLNQKSPRNTSEAATHK* |
| Ga0137407_107938851 | 3300012930 | Vadose Zone Soil | ANEKVYGKKVEAEDIVFKGAVRVPAPAQPLVAYLNKKTPKNLSDPDSLK* |
| Ga0137407_119955122 | 3300012930 | Vadose Zone Soil | AEDIVRKGAVAVAPSAQEMISLLNKKSPKNLSDPASLKE* |
| Ga0153915_127032531 | 3300012931 | Freshwater Wetlands | KVAAEDIIRKGAVRTPPNGQQLIALLNKKSPKNLSDPESLK* |
| Ga0134081_101468331 | 3300014150 | Grasslands Soil | TADDIIRKGAVAVPPSGQEMVALLNKKSPKNLSDPTSLKG* |
| Ga0134078_106683351 | 3300014157 | Grasslands Soil | VYDKKVEAQDIVFKGTVRVPTAAQPLVAYLNKKSPKNLSAK* |
| Ga0137411_11590232 | 3300015052 | Vadose Zone Soil | EAESIVFKGAVAVPPAAQKMIAYLNQKSPKNLSDPESLK* |
| Ga0137405_11426873 | 3300015053 | Vadose Zone Soil | KDIIFKGAVAVPPSAQKMVAYVNQKSPKNLSDPDSLK* |
| Ga0137420_10320002 | 3300015054 | Vadose Zone Soil | IVFKGAVAVPPAAQKMIAYLNQKSPKNTSDPDSLK* |
| Ga0137420_12649252 | 3300015054 | Vadose Zone Soil | GKKVTATEIVRKGAVPVPSSAQKLVALLNKKSPKNLSDPESLK* |
| Ga0137420_130713210 | 3300015054 | Vadose Zone Soil | VFKGVVAVLPAAQKMIAYLNQKSPKNTSDPESLK* |
| Ga0137412_103521663 | 3300015242 | Vadose Zone Soil | IVRKGSVAVPPSGQEMIALLNKKSPKNLSDPNSLKE* |
| Ga0137403_105057301 | 3300015264 | Vadose Zone Soil | DAESIVFKGAVAVPPAAQKLIAYLNQKSPKNLSDPESLK* |
| Ga0134072_101723661 | 3300015357 | Grasslands Soil | RKGAVAVPPAGQELVALLNKKSPKNLSDPTSLKE* |
| Ga0182037_112982171 | 3300016404 | Soil | EDIIFKGAAAVPPSAQKLVAYLNQKSPKNLSDPNSLKE |
| Ga0134083_101471341 | 3300017659 | Grasslands Soil | EKLYKGKVTAEQIVRKGSVAVPPAGQEMIALLNKKSPKNLSDPNSLKE |
| Ga0187801_100204571 | 3300017933 | Freshwater Sediment | GNVSAEAIIFKGAVAVPPAAQELVAFLNRKSPKNTSDPNSLKE |
| Ga0187809_102539031 | 3300017937 | Freshwater Sediment | DIVRKGTVAIPPSAQKLVSLLDQHSPKNTSDPESLK |
| Ga0187847_103642031 | 3300017948 | Peatland | NANLRLYGKDVTATQIIREGAVPVPASGQKLVSFLDKKSPKNLSNPQSLK |
| Ga0187817_110093301 | 3300017955 | Freshwater Sediment | SIIFKGAVAVPPAAQKLVAYLNQKSPKNTSDPNSLRE |
| Ga0066667_102864531 | 3300018433 | Grasslands Soil | KKVEAEPIVFKGTVAVPPAAQKMISYLNQKSPKNTSDPESLK |
| Ga0179592_102214741 | 3300020199 | Vadose Zone Soil | YKGKVTAEQIVRKGSVAVPPSGQEMIALLNKKSPKNLSDPNSLKE |
| Ga0210407_103336493 | 3300020579 | Soil | GKKSEAIDIVRKGTTAVPPSGQKMVSLLDQHSPKNTSDPNSLK |
| Ga0210407_105663562 | 3300020579 | Soil | KNIVREGEVAVPASGRELIALLNKESPKNLSDPKSLKE |
| Ga0210400_108751982 | 3300021170 | Soil | NLSAEDIIFKGAVAVPPPAQKLIAYLNRKSPKNTSDPNSLKE |
| Ga0210400_112903801 | 3300021170 | Soil | IVFKGAGAVPPAAQKMVAYLNQKSPKNLSDPDSLK |
| Ga0187846_104157951 | 3300021476 | Biofilm | ESIIFKGAAAVPPAAQQLIAYLNRKSPKNMSDPNSLKE |
| Ga0210410_111969741 | 3300021479 | Soil | ESIVFKGAVAVPSAAQKMIAYLNQKSPKNTSEAASHK |
| Ga0247668_11323672 | 3300024331 | Soil | IVFKGAVRVPASAQKLIAYLNKKTPKNLSDPESLK |
| Ga0207646_109782783 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ENIYGKKLDAKDIIFKGVVRVPPSGRALVDYLNKKTPKNLSDPTSLK |
| Ga0207646_117113451 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MEARDIIRKGAVPVPAAGEQLVALLNQKSPKNLSDPNSLK |
| Ga0209890_100105825 | 3300026291 | Soil | IVFKGAVAVPPPAQKLVSYLNRKSPKNLSESGSNK |
| Ga0209688_10326852 | 3300026305 | Soil | SIVFKGTVAVPPAAQKMIAYLNQKSPKNTSDPESLK |
| Ga0209804_10480631 | 3300026335 | Soil | NERLYGKKVEAESIVFQGAVAVPPAAQKLIAYLNQKSPKNTSDPESLK |
| Ga0257181_10170101 | 3300026499 | Soil | YGKKVEAESIVFKGAVAVPPAAQKMIAYLNQKSPKNTSDPESLK |
| Ga0257161_10330231 | 3300026508 | Soil | ATEIVRKGAVPVPSSAQKLVALLNKKSPKNLSDPESLK |
| Ga0209213_10734272 | 3300027383 | Forest Soil | KKVTATEIVRKGAVPVPSSAQKLVALLNKKSPKNLSDPDSLK |
| Ga0209524_11356971 | 3300027521 | Forest Soil | ERIYGKKVEAESIVFKGAVAVPPAAQKMIAYLNQKSPKNTSDPESLK |
| Ga0209528_10661372 | 3300027610 | Forest Soil | KVEAESIVFKGAVAVPPAAQKMIAYLNQKSPKNTSDPESLK |
| Ga0209117_11657601 | 3300027645 | Forest Soil | EAESIIFKGAVAVPPAAQKMIAYLNQKSPKNLSDPESLK |
| Ga0209009_11031462 | 3300027667 | Forest Soil | ESIVFKGAVAIPPAAQKMIAYLNQKSPKNLSDPESLK |
| Ga0209446_11408431 | 3300027698 | Bog Forest Soil | EEIIFKGAVAVPPPAQKLVSYLNRKSPKNNSDPNSLKE |
| Ga0209447_101353242 | 3300027701 | Bog Forest Soil | KLTAEEIIFRGAVAVPPPAQKLVAYLNRKSPKNLSDPNSLKE |
| Ga0209038_101016942 | 3300027737 | Bog Forest Soil | IIFKGAVAVPPPAQKLVSTLNLKTPKNNSDPNSLKE |
| Ga0209177_101461151 | 3300027775 | Agricultural Soil | IVFKGAAAVPPSAQKLIAYLNQKSPKNTSDPSSLRE |
| Ga0209580_103544752 | 3300027842 | Surface Soil | SIIFKGSVAVPPSAQKFIAYLNQKSPKNTSDPASLK |
| Ga0209274_107228452 | 3300027853 | Soil | RVYGGRIDAESIIFKGTVAVPPPAQKLIAYLNRKSPKNTSDPNSLKE |
| Ga0209283_100579921 | 3300027875 | Vadose Zone Soil | NARIYGKKVDAESIIFKGAVAVPPAAQKLIAYLNQKSPKNTSDPASLK |
| Ga0209283_100999603 | 3300027875 | Vadose Zone Soil | AEQVVRKGAVAVPPSGQEMIGLLNKKSPKNLSDPNSLKE |
| Ga0209275_102636662 | 3300027884 | Soil | NLSAEDNIFKGAVAVPPPAQKMIAYLNRKSPKNLSDPNSLKE |
| Ga0209380_103054671 | 3300027889 | Soil | AKKVTAEEIIFRGAVAVPPPGQKLIAYLNRKSPKNTSDPNSLKE |
| Ga0265349_10008811 | 3300028037 | Soil | EDIIFKGAVAVPPPAQKLVSTLNLKTPKNMSDPNSLKE |
| Ga0247684_10053101 | 3300028138 | Soil | KVEATDIIFEGKVAVPGPAQKLIAYLNQKSPKNLSDPQSLK |
| Ga0257175_10536402 | 3300028673 | Soil | KIEAESIVFKGAVAVPPAAQKMIAYLNQKSPKNLSDPESLK |
| Ga0222749_104808682 | 3300029636 | Soil | VYGQNVSAEAIIFKGAVAVPPAAQKLVAFLNRKSPKNTSDRNSL |
| Ga0302325_106089012 | 3300031234 | Palsa | KKIDATQIVREGSVPVPPSAGKLVNLLNTKSPKNLSDPNSLK |
| Ga0307474_101304051 | 3300031718 | Hardwood Forest Soil | YGKKVEAESIVFKGDVAVPSAAQKMVAYLNQKSPKNTSEAATHK |
| Ga0307474_107455131 | 3300031718 | Hardwood Forest Soil | LEAEQIIFKGAVAVPPPAQKLVAYLNRKSPKNLSDPNSLKE |
| Ga0318501_104349602 | 3300031736 | Soil | DIIRKGAVAVPPAGQELVAVLNKKSPKNLSDPGSLKE |
| Ga0307477_102797343 | 3300031753 | Hardwood Forest Soil | ISAEDIIFKGAVPVPPPAQKMVAYLNKKTPKNLSDPNSLK |
| Ga0318509_106952322 | 3300031768 | Soil | SVYGKKIGAQDIIFKGAVPVPAPAQKMVAYLNQKTPKNLSDPNSLK |
| Ga0307478_112471172 | 3300031823 | Hardwood Forest Soil | DIVRKGEVHVPPSGQKLVALLNKKSPKNQSDPNSLK |
| Ga0318522_104272731 | 3300031894 | Soil | IVRKGAVAVPASGQELVAILNKKSPKNLSDPNSLKE |
| Ga0306921_110141872 | 3300031912 | Soil | ATDIVFKGAVRVPASAQNMVTYLNKKTPKNLSDPESLK |
| Ga0306926_129811712 | 3300031954 | Soil | VVRKGAVAVPPSAQELIAVLNKRSPKNLSDPASLKE |
| Ga0307479_100412561 | 3300031962 | Hardwood Forest Soil | EADDIVRKGAVSVPPAAQEMISTLNKKSPKNLSDPASLRE |
| Ga0307479_101081771 | 3300031962 | Hardwood Forest Soil | DIVRKGAVAVPPAAQELIGVLNKKSPKNLSDPASLKE |
| Ga0307479_117314612 | 3300031962 | Hardwood Forest Soil | KVTAEEIIRKGAVGVPPSGQEMIALLNRKSPKNLSDPQSLK |
| Ga0310911_103274441 | 3300032035 | Soil | EVLYKKKVEAGDIIFKGAVPVPPSAQKMVAYLNKKTPKNLSDPDSLK |
| Ga0311301_112468172 | 3300032160 | Peatlands Soil | EAIIFKGAVAVPPPAQKLVSYLNRKSPKNMSDPNSLKE |
| Ga0307471_1004593604 | 3300032180 | Hardwood Forest Soil | VEAESIVFKGAVAVPPAGQKLVAYLNQKSPKNTSDPNSLKE |
| Ga0307471_1019341452 | 3300032180 | Hardwood Forest Soil | GKKIEAESIVFKGAVAVPPAAQKMIAYLNQKSPKNLSDPESLK |
| Ga0310914_108241782 | 3300033289 | Soil | QDIIFKGAVAVPAPAQKMIAYLNQKTPKNLSDPNSLK |
| Ga0316212_10011855 | 3300033547 | Roots | AEDIIFKGAVAVPPPAQKLVSTLNLKTPKNMSDPNSLKE |
| ⦗Top⦘ |