| Basic Information | |
|---|---|
| Family ID | F039240 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 164 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLAAVAS |
| Number of Associated Samples | 138 |
| Number of Associated Scaffolds | 164 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 16.67 % |
| % of genes near scaffold ends (potentially truncated) | 79.88 % |
| % of genes from short scaffolds (< 2000 bps) | 87.80 % |
| Associated GOLD sequencing projects | 132 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.146 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.854 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.610 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.976 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 11.76% Coil/Unstructured: 88.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 164 Family Scaffolds |
|---|---|---|
| PF04075 | F420H2_quin_red | 25.61 |
| PF00135 | COesterase | 14.02 |
| PF13599 | Pentapeptide_4 | 3.66 |
| PF00196 | GerE | 1.83 |
| PF00067 | p450 | 1.83 |
| PF13424 | TPR_12 | 1.83 |
| PF00941 | FAD_binding_5 | 1.83 |
| PF00132 | Hexapep | 1.22 |
| PF03450 | CO_deh_flav_C | 1.22 |
| PF00083 | Sugar_tr | 1.22 |
| PF07730 | HisKA_3 | 1.22 |
| PF02687 | FtsX | 1.22 |
| PF06724 | DUF1206 | 1.22 |
| PF01740 | STAS | 0.61 |
| PF00872 | Transposase_mut | 0.61 |
| PF07876 | Dabb | 0.61 |
| PF13738 | Pyr_redox_3 | 0.61 |
| PF13520 | AA_permease_2 | 0.61 |
| PF13469 | Sulfotransfer_3 | 0.61 |
| PF03704 | BTAD | 0.61 |
| PF13649 | Methyltransf_25 | 0.61 |
| PF05345 | He_PIG | 0.61 |
| PF07883 | Cupin_2 | 0.61 |
| PF01244 | Peptidase_M19 | 0.61 |
| PF02148 | zf-UBP | 0.61 |
| PF08245 | Mur_ligase_M | 0.61 |
| PF00266 | Aminotran_5 | 0.61 |
| PF03853 | YjeF_N | 0.61 |
| PF00805 | Pentapeptide | 0.61 |
| PF01596 | Methyltransf_3 | 0.61 |
| PF08281 | Sigma70_r4_2 | 0.61 |
| PF01734 | Patatin | 0.61 |
| PF04993 | TfoX_N | 0.61 |
| PF09678 | Caa3_CtaG | 0.61 |
| PF10025 | DUF2267 | 0.61 |
| PF02604 | PhdYeFM_antitox | 0.61 |
| PF13191 | AAA_16 | 0.61 |
| PF00072 | Response_reg | 0.61 |
| PF02585 | PIG-L | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 164 Family Scaffolds |
|---|---|---|---|
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 14.02 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 1.83 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 1.22 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 1.22 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 1.22 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 1.22 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.61 |
| COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 0.61 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.61 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.61 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.61 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.61 |
| COG0062 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domain | Nucleotide transport and metabolism [F] | 0.61 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.61 |
| COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.61 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.61 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.61 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.61 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.07 % |
| Unclassified | root | N/A | 32.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_139834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1335 | Open in IMG/M |
| 3300004080|Ga0062385_11099244 | Not Available | 539 | Open in IMG/M |
| 3300004152|Ga0062386_100215724 | Not Available | 1513 | Open in IMG/M |
| 3300005328|Ga0070676_11186979 | Not Available | 579 | Open in IMG/M |
| 3300005435|Ga0070714_101535534 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 650 | Open in IMG/M |
| 3300005602|Ga0070762_11239810 | Not Available | 517 | Open in IMG/M |
| 3300005610|Ga0070763_10100498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1458 | Open in IMG/M |
| 3300005610|Ga0070763_10109700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1401 | Open in IMG/M |
| 3300005614|Ga0068856_100605591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1116 | Open in IMG/M |
| 3300005834|Ga0068851_10175344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1185 | Open in IMG/M |
| 3300005840|Ga0068870_10049160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2223 | Open in IMG/M |
| 3300006046|Ga0066652_100740187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 938 | Open in IMG/M |
| 3300006052|Ga0075029_100525486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 783 | Open in IMG/M |
| 3300006059|Ga0075017_100680194 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300006175|Ga0070712_101549277 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 579 | Open in IMG/M |
| 3300006176|Ga0070765_100221168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1726 | Open in IMG/M |
| 3300006176|Ga0070765_102187593 | Not Available | 516 | Open in IMG/M |
| 3300006354|Ga0075021_10924967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 567 | Open in IMG/M |
| 3300006358|Ga0068871_101956200 | Not Available | 558 | Open in IMG/M |
| 3300006575|Ga0074053_10013251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 735 | Open in IMG/M |
| 3300006579|Ga0074054_12084340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 787 | Open in IMG/M |
| 3300006605|Ga0074057_12295004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1873 | Open in IMG/M |
| 3300006755|Ga0079222_11180933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 683 | Open in IMG/M |
| 3300006804|Ga0079221_10252090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1004 | Open in IMG/M |
| 3300006854|Ga0075425_101857635 | Not Available | 675 | Open in IMG/M |
| 3300009101|Ga0105247_11149078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 615 | Open in IMG/M |
| 3300009143|Ga0099792_10213753 | Not Available | 1104 | Open in IMG/M |
| 3300009520|Ga0116214_1126230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 947 | Open in IMG/M |
| 3300009525|Ga0116220_10000887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11902 | Open in IMG/M |
| 3300009525|Ga0116220_10155639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 982 | Open in IMG/M |
| 3300009525|Ga0116220_10305452 | Not Available | 701 | Open in IMG/M |
| 3300009683|Ga0116224_10256108 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 835 | Open in IMG/M |
| 3300009698|Ga0116216_10513542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
| 3300010333|Ga0134080_10561029 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 551 | Open in IMG/M |
| 3300010396|Ga0134126_11571835 | Not Available | 724 | Open in IMG/M |
| 3300010396|Ga0134126_13042431 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 506 | Open in IMG/M |
| 3300010876|Ga0126361_10655038 | All Organisms → cellular organisms → Bacteria | 2426 | Open in IMG/M |
| 3300010876|Ga0126361_10715589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1381 | Open in IMG/M |
| 3300010876|Ga0126361_11018027 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300010880|Ga0126350_10053733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 858 | Open in IMG/M |
| 3300010880|Ga0126350_10352724 | Not Available | 1232 | Open in IMG/M |
| 3300010880|Ga0126350_11253251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 648 | Open in IMG/M |
| 3300011120|Ga0150983_11798901 | Not Available | 541 | Open in IMG/M |
| 3300012201|Ga0137365_10019788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5239 | Open in IMG/M |
| 3300012209|Ga0137379_11405497 | Not Available | 601 | Open in IMG/M |
| 3300012354|Ga0137366_10005649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9809 | Open in IMG/M |
| 3300012357|Ga0137384_10668376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 845 | Open in IMG/M |
| 3300012924|Ga0137413_10223023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1280 | Open in IMG/M |
| 3300012987|Ga0164307_11141600 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 642 | Open in IMG/M |
| 3300013307|Ga0157372_12951523 | Not Available | 544 | Open in IMG/M |
| 3300014166|Ga0134079_10197981 | Not Available | 841 | Open in IMG/M |
| 3300016371|Ga0182034_10192983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1569 | Open in IMG/M |
| 3300017937|Ga0187809_10290856 | Not Available | 600 | Open in IMG/M |
| 3300017946|Ga0187879_10205877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1102 | Open in IMG/M |
| 3300017961|Ga0187778_10324632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 999 | Open in IMG/M |
| 3300017972|Ga0187781_10024413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 4188 | Open in IMG/M |
| 3300018007|Ga0187805_10583279 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300018025|Ga0187885_10192000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 950 | Open in IMG/M |
| 3300018057|Ga0187858_10143725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1594 | Open in IMG/M |
| 3300018058|Ga0187766_10340811 | Not Available | 979 | Open in IMG/M |
| 3300018482|Ga0066669_10923620 | Not Available | 783 | Open in IMG/M |
| 3300019082|Ga0187852_1242928 | Not Available | 730 | Open in IMG/M |
| 3300019890|Ga0193728_1134434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1106 | Open in IMG/M |
| 3300020581|Ga0210399_10020178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 5276 | Open in IMG/M |
| 3300020582|Ga0210395_11219510 | Not Available | 552 | Open in IMG/M |
| 3300021170|Ga0210400_10753497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 799 | Open in IMG/M |
| 3300021171|Ga0210405_11026452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 620 | Open in IMG/M |
| 3300021180|Ga0210396_10954519 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300021181|Ga0210388_10371187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1258 | Open in IMG/M |
| 3300021181|Ga0210388_11645346 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 532 | Open in IMG/M |
| 3300021401|Ga0210393_10170169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1755 | Open in IMG/M |
| 3300021401|Ga0210393_10230613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1500 | Open in IMG/M |
| 3300021401|Ga0210393_11240413 | Not Available | 599 | Open in IMG/M |
| 3300021402|Ga0210385_11123195 | Not Available | 603 | Open in IMG/M |
| 3300021405|Ga0210387_10213658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1678 | Open in IMG/M |
| 3300021406|Ga0210386_10499214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1051 | Open in IMG/M |
| 3300021407|Ga0210383_10821699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 795 | Open in IMG/M |
| 3300021474|Ga0210390_10418533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1132 | Open in IMG/M |
| 3300021477|Ga0210398_10434957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1069 | Open in IMG/M |
| 3300021477|Ga0210398_11019286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 660 | Open in IMG/M |
| 3300021477|Ga0210398_11165303 | Not Available | 610 | Open in IMG/M |
| 3300021559|Ga0210409_10852411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 784 | Open in IMG/M |
| 3300024225|Ga0224572_1037749 | Not Available | 913 | Open in IMG/M |
| 3300024271|Ga0224564_1090362 | Not Available | 618 | Open in IMG/M |
| 3300024288|Ga0179589_10295938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 727 | Open in IMG/M |
| 3300025434|Ga0208690_1026916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 950 | Open in IMG/M |
| 3300025633|Ga0208480_1079229 | Not Available | 802 | Open in IMG/M |
| 3300025928|Ga0207700_11742589 | Not Available | 549 | Open in IMG/M |
| 3300025931|Ga0207644_11039688 | Not Available | 688 | Open in IMG/M |
| 3300026035|Ga0207703_12029382 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 551 | Open in IMG/M |
| 3300027096|Ga0208099_1021827 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300027109|Ga0208603_1021065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1044 | Open in IMG/M |
| 3300027110|Ga0208488_1039316 | Not Available | 848 | Open in IMG/M |
| 3300027497|Ga0208199_1102079 | Not Available | 592 | Open in IMG/M |
| 3300027567|Ga0209115_1055189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 905 | Open in IMG/M |
| 3300027575|Ga0209525_1073938 | Not Available | 819 | Open in IMG/M |
| 3300027590|Ga0209116_1002317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4442 | Open in IMG/M |
| 3300027783|Ga0209448_10059660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1283 | Open in IMG/M |
| 3300027812|Ga0209656_10000824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 20019 | Open in IMG/M |
| 3300027853|Ga0209274_10626259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 556 | Open in IMG/M |
| 3300027879|Ga0209169_10207814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1024 | Open in IMG/M |
| 3300027884|Ga0209275_10063017 | Not Available | 1817 | Open in IMG/M |
| 3300027889|Ga0209380_10592590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
| 3300027911|Ga0209698_11249799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300028138|Ga0247684_1019629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1065 | Open in IMG/M |
| 3300028745|Ga0302267_10414513 | Not Available | 554 | Open in IMG/M |
| 3300028755|Ga0307316_10218781 | Not Available | 688 | Open in IMG/M |
| 3300028768|Ga0307280_10006083 | Not Available | 3144 | Open in IMG/M |
| 3300028768|Ga0307280_10006533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3050 | Open in IMG/M |
| 3300028775|Ga0302231_10146789 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 984 | Open in IMG/M |
| 3300028801|Ga0302226_10041753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2233 | Open in IMG/M |
| 3300028806|Ga0302221_10037262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 2280 | Open in IMG/M |
| 3300028808|Ga0302228_10118656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1231 | Open in IMG/M |
| 3300028808|Ga0302228_10279763 | Not Available | 749 | Open in IMG/M |
| 3300028879|Ga0302229_10139098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1129 | Open in IMG/M |
| 3300028884|Ga0307308_10348363 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 709 | Open in IMG/M |
| 3300028906|Ga0308309_10320060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1316 | Open in IMG/M |
| 3300028906|Ga0308309_10460269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1096 | Open in IMG/M |
| 3300028906|Ga0308309_10902405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 767 | Open in IMG/M |
| 3300028906|Ga0308309_10967339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 738 | Open in IMG/M |
| 3300029882|Ga0311368_10313079 | Not Available | 1185 | Open in IMG/M |
| 3300029907|Ga0311329_10061186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 3244 | Open in IMG/M |
| 3300029910|Ga0311369_10014521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9642 | Open in IMG/M |
| 3300029910|Ga0311369_11461599 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 514 | Open in IMG/M |
| 3300029917|Ga0311326_10586977 | Not Available | 537 | Open in IMG/M |
| 3300029939|Ga0311328_10018504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 6700 | Open in IMG/M |
| 3300029943|Ga0311340_11198425 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300029944|Ga0311352_11183142 | Not Available | 581 | Open in IMG/M |
| 3300029951|Ga0311371_12605669 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 510 | Open in IMG/M |
| 3300029999|Ga0311339_10455551 | Not Available | 1315 | Open in IMG/M |
| 3300029999|Ga0311339_11106595 | Not Available | 733 | Open in IMG/M |
| 3300030007|Ga0311338_10490323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1291 | Open in IMG/M |
| 3300030007|Ga0311338_10554342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1192 | Open in IMG/M |
| 3300030007|Ga0311338_11583953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 600 | Open in IMG/M |
| 3300030053|Ga0302177_10395474 | Not Available | 724 | Open in IMG/M |
| 3300030054|Ga0302182_10139325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas lacus | 1053 | Open in IMG/M |
| 3300030399|Ga0311353_10697878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 876 | Open in IMG/M |
| 3300030524|Ga0311357_11679504 | Not Available | 532 | Open in IMG/M |
| 3300030598|Ga0210287_1174477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 578 | Open in IMG/M |
| 3300030706|Ga0310039_10165396 | Not Available | 887 | Open in IMG/M |
| 3300030743|Ga0265461_11789108 | Not Available | 687 | Open in IMG/M |
| 3300030760|Ga0265762_1148037 | Not Available | 557 | Open in IMG/M |
| 3300030815|Ga0265746_1023692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 760 | Open in IMG/M |
| 3300031028|Ga0302180_10477170 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 614 | Open in IMG/M |
| 3300031234|Ga0302325_11601153 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300031236|Ga0302324_100949800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1175 | Open in IMG/M |
| 3300031238|Ga0265332_10176351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 891 | Open in IMG/M |
| 3300031261|Ga0302140_10347072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1227 | Open in IMG/M |
| 3300031573|Ga0310915_10522050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
| 3300031708|Ga0310686_103543064 | Not Available | 573 | Open in IMG/M |
| 3300031708|Ga0310686_119423436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 708 | Open in IMG/M |
| 3300031771|Ga0318546_11124311 | Not Available | 552 | Open in IMG/M |
| 3300031781|Ga0318547_11036837 | Not Available | 513 | Open in IMG/M |
| 3300031823|Ga0307478_11152426 | Not Available | 646 | Open in IMG/M |
| 3300031938|Ga0308175_100115887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2502 | Open in IMG/M |
| 3300032180|Ga0307471_102426704 | Not Available | 663 | Open in IMG/M |
| 3300032783|Ga0335079_10120533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2961 | Open in IMG/M |
| 3300032805|Ga0335078_11932038 | Not Available | 635 | Open in IMG/M |
| 3300032828|Ga0335080_10498957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1292 | Open in IMG/M |
| 3300033475|Ga0310811_10565726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1159 | Open in IMG/M |
| 3300034199|Ga0370514_098964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
| 3300034817|Ga0373948_0008936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1718 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.85% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 15.24% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.32% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.27% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.88% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 3.66% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.05% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.44% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.44% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.22% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.22% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.22% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.22% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.22% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.22% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.61% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.61% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.61% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.61% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.61% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030598 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_02276110 | 2199352025 | Soil | VATPRPAVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLAAVGELAGS |
| Ga0062385_110992441 | 3300004080 | Bog Forest Soil | PAVVHHETDTYITTYAALDPLRSAGGTVALDGFFGWPLTTMAS* |
| Ga0062386_1002157241 | 3300004152 | Bog Forest Soil | HHETDTFTTTYAAIDPLRSENATVALDGFFGWPLAATAS* |
| Ga0070676_111869791 | 3300005328 | Miscanthus Rhizosphere | HHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLAAVAS* |
| Ga0070714_1015355341 | 3300005435 | Agricultural Soil | PRPAVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLAAVAS* |
| Ga0070762_112398102 | 3300005602 | Soil | TPRPAVVHHETDTFATTYTAIDPLRPDHAAVTLDGFFGWPLTAVAS* |
| Ga0070763_101004981 | 3300005610 | Soil | ETDTFITTYTAIDPLRSAGGPVTLDGFFGWPLAALAS* |
| Ga0070763_101097001 | 3300005610 | Soil | WPDGNQVATPRPAVVHHESDTFITTYTAIDPPRTADAAVALDGFFGWPLSAVAS* |
| Ga0068856_1006055911 | 3300005614 | Corn Rhizosphere | PRPAVVHAETDTFLTTYTAIDPPRQAGGPVINGGRVTLDGFFGWPLTAVAS* |
| Ga0068851_101753443 | 3300005834 | Corn Rhizosphere | TFITTYTAIDPPRSAGATLTLDGFFGWPLSAVAS* |
| Ga0068870_100491603 | 3300005840 | Miscanthus Rhizosphere | TPRPAVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLSAVAS* |
| Ga0066652_1007401871 | 3300006046 | Soil | PRPAVVHHETDTFITTYTAIDPPHPAGKPAGAALTLDGFFGWPLSAVAS* |
| Ga0075029_1005254862 | 3300006052 | Watersheds | VHQETGTFITTYTAIDPLRPAGNSARNPVTLDGFFGWLLAAVAS* |
| Ga0075017_1006801942 | 3300006059 | Watersheds | MHQETGTFITTQTAIDPLRSAGNSARNSVTLDGFFG* |
| Ga0070712_1015492771 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PAVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLAAVAS* |
| Ga0070765_1002211681 | 3300006176 | Soil | PARPAVVHQGTDTYITTYTAIDPLRKAGGRATLDGFFGWPLTSVAS* |
| Ga0070765_1021875932 | 3300006176 | Soil | PRPAVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLASVAS* |
| Ga0075021_109249673 | 3300006354 | Watersheds | VHRETDTFITTYTAIDPPRSAGATLTLDGFFGWPLTAVAS* |
| Ga0068871_1019562001 | 3300006358 | Miscanthus Rhizosphere | TPRPAVVHRETDTFITTYTAIASLRSASKPAGSTLTLDGFFGWPLAAVAS* |
| Ga0074053_100132512 | 3300006575 | Soil | VHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLSAVAS* |
| Ga0074054_120843403 | 3300006579 | Soil | PRPAVVHHETDTFITTYTAIDPPHPAGKPAGATLTLDGFFGWPLSAVAS* |
| Ga0074057_122950044 | 3300006605 | Soil | VHHETDTFITTYTAIDPPRPASKPAGATLTLDGFFGWPLSAVAS* |
| Ga0079222_111809332 | 3300006755 | Agricultural Soil | VATPRPAVVHAETDTFLTTYTAIDPPRQAGGPVINGGRVTLDGFFGWPLTAVAS* |
| Ga0079221_102520901 | 3300006804 | Agricultural Soil | TDTFLTTYTAIDPPRHAGGAVTLDGFFGWPLTAVAS* |
| Ga0075425_1018576351 | 3300006854 | Populus Rhizosphere | HETDTFITTYTAIDPPRSAGATLTLDGFFGWPLSAVAS* |
| Ga0105247_111490781 | 3300009101 | Switchgrass Rhizosphere | VHAETDTFLTTYTAIDPPRPAGGPVINGGRVTLDGFFGWPLTAVAS* |
| Ga0099792_102137533 | 3300009143 | Vadose Zone Soil | VVVHHETDTFITTYTAIDPPRSADATLTLDGFFGWPLATVAS* |
| Ga0116214_11262302 | 3300009520 | Peatlands Soil | MDRPYATPRPTVVHQETGTFITTYTAIDPLRPASNSAGNSVTLDGFFGWLLAAVAS* |
| Ga0116220_1000088712 | 3300009525 | Peatlands Soil | VHHETDTFTTTYAAIDPLRSENATAALDGFFGWPLAATAS* |
| Ga0116220_101556391 | 3300009525 | Peatlands Soil | HHESDTFITTYTAIDPLRSANATVALDGFFGWPLSAVAS* |
| Ga0116220_103054521 | 3300009525 | Peatlands Soil | RPAVVHHETDNFITTYTAIDPLRTDDGSVALDGFFGWPLASVAS* |
| Ga0116224_102561081 | 3300009683 | Peatlands Soil | TPRPTVVHQETGTFITTYTAIDPLRPASNSAGNSVTLDGFFGWLLAAVAS* |
| Ga0116216_105135422 | 3300009698 | Peatlands Soil | MDRPYRATPRPTVVHQETDTLITTYTAIDPLRPAGNSARNPVTLDCFFGWLLAAVAS* |
| Ga0134080_105610291 | 3300010333 | Grasslands Soil | GNQVATPRPAVVHHETDTFITTYTAIDPPHPAGKPAGAALTLDGFFGWPLAAVAS* |
| Ga0134126_115718351 | 3300010396 | Terrestrial Soil | RPAVVHAETDTFLTTYTAIDPPRQAGGAVTLDGFFGWPLTAVAS* |
| Ga0134126_130424311 | 3300010396 | Terrestrial Soil | ETDTFLTTYTAIDPPRPAGGPVINGGRVTLDGFFGWPLTAVAR* |
| Ga0126361_106550383 | 3300010876 | Boreal Forest Soil | VYHESDTFTTAYTATDPLRPDHAAVTLDGFFGWPLTATAS* |
| Ga0126361_107155893 | 3300010876 | Boreal Forest Soil | VHHESDTLITTYAAIDPLRPAGNPARHAASAAVALDGFFGWPLAAQAS* |
| Ga0126361_110180271 | 3300010876 | Boreal Forest Soil | TDTYITTYTAIDPARSRGATVVLDGFFGWPLTANAS* |
| Ga0126350_100537331 | 3300010880 | Boreal Forest Soil | GATIGPERPAVVHQGTDTYITTYTAIDPLRSAGGRVTLDGFFGWPLRSVAS* |
| Ga0126350_103527241 | 3300010880 | Boreal Forest Soil | HHATDTYITTYTAIDPPRSRGATVALDGFFGWPLTANAS* |
| Ga0126350_112532511 | 3300010880 | Boreal Forest Soil | ATPRPGVVHHESDTFITTYTAIDPLRTANAPVALDGFFGWPLSAAAS* |
| Ga0150983_117989012 | 3300011120 | Forest Soil | PDGNQVATPRPAVVHHETDTFTTTYTAIDPLRPDHAAVTLDGFFGWPLTATAS* |
| Ga0137365_100197887 | 3300012201 | Vadose Zone Soil | VHHETDTFITTYTAIDPPHSAGATLTLNGFFGWPLSAVAS* |
| Ga0137379_114054971 | 3300012209 | Vadose Zone Soil | PAVVHHETDTFITSYAAIDPPRSANARVTLDGFFGWLLDAVAS* |
| Ga0137366_100056494 | 3300012354 | Vadose Zone Soil | VHHETDTFITTYTAIDPPRSAGATLTLNGFFGWPLSAVAS* |
| Ga0137384_106683761 | 3300012357 | Vadose Zone Soil | RPAVVHRETDTCITTYTAIGAPHSAGATRTRNGFFGWPLSGVAS* |
| Ga0137413_102230231 | 3300012924 | Vadose Zone Soil | TFITTYTAIDPPRSADATLTLDGFFGWPLATVAS* |
| Ga0164307_111416002 | 3300012987 | Soil | HETDTFITTYTAIDPPRSAGAALTLDGFFGWPLSAVAS* |
| Ga0157372_129515232 | 3300013307 | Corn Rhizosphere | AAPRPAVVHAETDTFLTTYTAIDPPRQAGGPVINGGRVTLDGFFGWPLTAVAS* |
| Ga0134079_101979812 | 3300014166 | Grasslands Soil | VHAETDTFLTTYTAIDPPRQTGGTVTLDGFFGWPLTAVAS* |
| Ga0182034_101929831 | 3300016371 | Soil | VHHESDTFTTTDTAIDPLRSANATAALDGFFGWPLTATAR |
| Ga0187809_102908563 | 3300017937 | Freshwater Sediment | ETDTFTATYAAIDPLRSDNATVALDGFFGWPLAATAS |
| Ga0187879_102058772 | 3300017946 | Peatland | VHQETGTFITTYTAIDPLRPAGNSARNSVTLDGFFGWLLAAVAS |
| Ga0187778_103246321 | 3300017961 | Tropical Peatland | MVHHETDTFITTYTAIDPLRSDNATVALDGFFGWPLAATAS |
| Ga0187781_100244131 | 3300017972 | Tropical Peatland | MVHHETDTFITTCTAIDPLRSDNATVALDGFFGWPLAATAS |
| Ga0187805_105832791 | 3300018007 | Freshwater Sediment | TDNFITTYTAIDPLRTDDGSVALDGFFGWPLASVAS |
| Ga0187885_101920002 | 3300018025 | Peatland | WPDGSQVATPRPAVVHHETDTFRITYTAIDSLRQANATVALDGFYGWPLAATAS |
| Ga0187858_101437252 | 3300018057 | Peatland | TPRPAVVHHETDTFRITYTAIDSLRQANATVALDGFYGWPLAATAS |
| Ga0187766_103408111 | 3300018058 | Tropical Peatland | RPPVVHHETDTFTTTYAAIDPLRSDNATVTLDGFFGWPLAATAS |
| Ga0066669_109236202 | 3300018482 | Grasslands Soil | VHAETDTFLTTYTAIDPPRQTGGTATLDGFFGWPLTAAAS |
| Ga0187852_12429281 | 3300019082 | Peatland | HETDTFTTTYTATDPLRPDHTAVTLNGFFGWPLTATAS |
| Ga0193728_11344342 | 3300019890 | Soil | VHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLAAVAS |
| Ga0210399_100201785 | 3300020581 | Soil | VHHESDTFITTYAAIDPPRAADATAALDGFFGWPLSAAAS |
| Ga0210395_112195102 | 3300020582 | Soil | DGNQVAIPRPAVVHHESDTFTTTYTAIDPLRSENTAVALDGFFGWPLTAVAS |
| Ga0210400_107534971 | 3300021170 | Soil | ESDTFITTYTAIDPPRTANATVALDGFFGWPLSARAS |
| Ga0210405_110264522 | 3300021171 | Soil | AIPRPAVVHHESDTFTTTYTAIDPLRSGNTAVALDGFFGWPLTAVAS |
| Ga0210396_109545192 | 3300021180 | Soil | DTYITTYTATDPSRAAGATVALDGFFGWPLTATAS |
| Ga0210388_103711871 | 3300021181 | Soil | ATIGAERPALVHRGTDTYITTYTATDPLRSAGGRVALDGFFGWPLTAVAS |
| Ga0210388_116453462 | 3300021181 | Soil | HEADTFITTYTAIDPLRSPHANVTLDGFFGWPLTTVAS |
| Ga0210393_101701692 | 3300021401 | Soil | SPVATPRPAVVHHQTDTYITTYTALDPLRSAGGTVALDGFFGWPLTTIAS |
| Ga0210393_102306132 | 3300021401 | Soil | ATPRPAVVHHESDTFITTYTAIDPPHTPNATVALDGFFGWPLSAVAS |
| Ga0210393_112404131 | 3300021401 | Soil | AAPRPAVVHHETDTYITTYTALDPLLSSDGTVALDGFFGWPLTTVAS |
| Ga0210385_111231952 | 3300021402 | Soil | QATDTYITTYTATDPPRAAGATVALDGFFGWPLTATAS |
| Ga0210387_102136581 | 3300021405 | Soil | QTDTFITTYAAVDPLRSAGGRVTLDGFFGWPLTSVAS |
| Ga0210386_104992141 | 3300021406 | Soil | AAPRPEHPPTAVVHHESDTFITTYAAIDPPRAADATAALDGFFGWPLSAAAS |
| Ga0210386_117518662 | 3300021406 | Soil | HHETDTFVTTYAATDPPRSGGRRVMLDGFFGWPLMSVAR |
| Ga0210383_108216992 | 3300021407 | Soil | PALVHRGTDTYITTYTATDPLLSAGGRVALDGFFGWPLTAVAS |
| Ga0210390_104185332 | 3300021474 | Soil | VVHHESDTFITTYTAIDPPRTADATVALDGFFGWPLSAVAS |
| Ga0210398_104349572 | 3300021477 | Soil | WPDGNQVATPKPAVVHHESDTFITTYTAIDPPRTANATVALDGFFGWPLSARAS |
| Ga0210398_110192862 | 3300021477 | Soil | DIFTTTYTAIDPPRSDNTAVTLDGFFGWPLTAVAS |
| Ga0210398_111653031 | 3300021477 | Soil | ALVHHATDTYITTYTATDPPRAAGATVALDGFFGWPLTATAS |
| Ga0210409_108524111 | 3300021559 | Soil | HESDTFTTTYTAIDPLRSENTAVALDGFFGWPLTAVAS |
| Ga0224572_10377491 | 3300024225 | Rhizosphere | HETDTYITTYTALDPLRSAGGTVALDGFFGWPLTTMAS |
| Ga0224564_10903622 | 3300024271 | Soil | SNRPTLVHHATDTYITTYTATDPPRAAGATVALDGFFGWPLTATAS |
| Ga0179589_102959383 | 3300024288 | Vadose Zone Soil | VATPRPVVVHHETDTFITTYTAIDPPRSADATLTLDGFFGWPLATVAS |
| Ga0208690_10269163 | 3300025434 | Peatland | ATPRPAVVHHEADTFITTYTAIDPLQSAHASVTLDGFFGWPLTAVAS |
| Ga0208480_10792292 | 3300025633 | Arctic Peat Soil | PGPAVVHRETDTFITTYTAIDPLRSDNGTVALDGFFGWPLTAVAS |
| Ga0207700_117425891 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PRPAVVHAETDTFLTTYTAIDPPRRAGGAVTLDGFFGWPLTAVAS |
| Ga0207644_110396881 | 3300025931 | Switchgrass Rhizosphere | DTFLTTYTAIDPPRQAGGAVTLDGFFGWPLTAVAS |
| Ga0207703_120293821 | 3300026035 | Switchgrass Rhizosphere | DTFITTYTAIDPPRSADAALTLDGFFGWPLATVAS |
| Ga0208099_10218271 | 3300027096 | Forest Soil | QVATPRPAVVHHEADTFITTYTAIDPLRSPHANVTLDGFFGWPLTAVAS |
| Ga0208603_10210652 | 3300027109 | Forest Soil | VHHESDTFITTYAAIDPPRAADATAALDGFFGWPLSAVAS |
| Ga0208488_10393162 | 3300027110 | Forest Soil | PDSSPVATPRPAVVHHETDTYITTYTALDPIRSTGGTVALDGFFGWPLITAAS |
| Ga0208199_11020792 | 3300027497 | Peatlands Soil | VHQETGTFITTYTAIDPLRPASNSAGNSVTLDGFFGWLLAAVAS |
| Ga0209115_10551891 | 3300027567 | Forest Soil | VHHETDTYITTYTALDPLRSAGGTVALDGFFGWPLTAVAS |
| Ga0209525_10739383 | 3300027575 | Forest Soil | PAVVHREADTFITTYTAIDPLQSAHANVTLDGFFGWPLTAVAS |
| Ga0209116_10023175 | 3300027590 | Forest Soil | HEADTFITTYTAIDPLRSDGGTVALDGFFGWPLTATAS |
| Ga0209448_100596602 | 3300027783 | Bog Forest Soil | MHQETGTFITTQTAIDPLRSAGNSARNSVTPDGFFG |
| Ga0209656_1000082414 | 3300027812 | Bog Forest Soil | MHQETGTFITTQTAIDPLRSAGNSARNSVTLDGFFG |
| Ga0209274_106262591 | 3300027853 | Soil | PIATPRPAVVHHETDTYITTYTALDPLRSAGGMVALDGFFGWPLTAVAS |
| Ga0209169_102078142 | 3300027879 | Soil | IPRPAVVHHESDTFTTTYTAIDPLRSGNTAVALDGFFGWPLTAVAS |
| Ga0209275_100630171 | 3300027884 | Soil | DGNPVAKPRPPVVHHETETFITTYAAIDPLHSAGRTVTLDGFFGWPLTAHAS |
| Ga0209380_105925902 | 3300027889 | Soil | GNSVASPRPAVVHHETDTFVTTYAATDPPRSGGHRVMLDGFFGWPLMSVAR |
| Ga0209698_112497991 | 3300027911 | Watersheds | TPRPALIHHQTDTYITTYTAIDPLRSAGGTATLDGFFGWPLTAIAS |
| Ga0247684_10196291 | 3300028138 | Soil | VHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLSAVAS |
| Ga0302267_104145131 | 3300028745 | Bog | PRPAVVHHETDTFSITYTAIDSLRQANATVALDGFYGWPLAATAS |
| Ga0307316_102187812 | 3300028755 | Soil | RVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLAAVAS |
| Ga0307280_100060831 | 3300028768 | Soil | PRVPPGPRRPRVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLAAVAS |
| Ga0307280_100065331 | 3300028768 | Soil | VHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLA |
| Ga0302231_101467891 | 3300028775 | Palsa | VHREADTFITTYTAIDPLQPAHANVTLDGFFGWPLTAVAS |
| Ga0302226_100417533 | 3300028801 | Palsa | QVATPRPAVVHHEADAFITTYTAIDPLRSAHANVTLDGFFGWPLTAVAS |
| Ga0302221_100372621 | 3300028806 | Palsa | TPRPTVVHHETDTFSITCAAIDSLRQANATVALDGFLGWPLAATAS |
| Ga0302228_101186561 | 3300028808 | Palsa | VVHHEADTFITTYTAIDPLRSAHANVTLDGFFGWPLTAVAS |
| Ga0302228_102797631 | 3300028808 | Palsa | WPDSSPVATPRPIVVHHETDTFITTYTAIDPLRSAGGTVALDGFFGWPLTTVVS |
| Ga0302229_101390982 | 3300028879 | Palsa | GSQVATPRPAVVHHETDTFSITYTAIDSLRQANATVALDGFFGWPLAATVS |
| Ga0307308_103483631 | 3300028884 | Soil | PARPVRNRVPAWPRRPRVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLAAVAS |
| Ga0308309_103200601 | 3300028906 | Soil | DTFITTYTAIDPPRTADATVALDGFFGWPLSAVAS |
| Ga0308309_104602691 | 3300028906 | Soil | GSMGPARPAVVHQGTDTYITTYTAIDPLRKAGGRATLDGFFGWPLTSVAS |
| Ga0308309_109024052 | 3300028906 | Soil | ESDTFTTTYTAIDPLRSGNTAVALDGFFGWPLTAVAS |
| Ga0308309_109673392 | 3300028906 | Soil | RETDTFATTYTAIDPLRPDHAAVTLDGFFGWPLTAVAS |
| Ga0311368_103130791 | 3300029882 | Palsa | VHHETDTFITTYTAIDPLRSAGGTVALDGFFGWPLTTVVS |
| Ga0311329_100611861 | 3300029907 | Bog | TDTFSITCAAIDSLRQANATVALDGFLGWPLAATAS |
| Ga0311369_100145211 | 3300029910 | Palsa | RPTVVHHETDTFSITCAAIDSLRQANATVALDGFLGWPLAATAS |
| Ga0311369_114615991 | 3300029910 | Palsa | VHHEADTFITTYTAIDPLQPAHANVTLDGFFGWPLTAVAS |
| Ga0311326_105869771 | 3300029917 | Bog | ATPRPAVVHHETDTFSITYTAIDSLRQANATVALDGFYGWPLAATAS |
| Ga0311328_100185046 | 3300029939 | Bog | VVHHETDTFSITCAAIDSLRQANATVALDGFLGWPLAATAS |
| Ga0311340_103495811 | 3300029943 | Palsa | AVVHHETDTFVTTYTALDPLRSAGGTVALDGFFGWPLTSVAS |
| Ga0311340_111984251 | 3300029943 | Palsa | ATPRLTVVHNETDTFITTYTAIDPLRAAGGTVVLDGFFGWPLTTVVS |
| Ga0311352_111831422 | 3300029944 | Palsa | DTFVTTYTALDPLRSAGGTVALDGFFGWPLTSVAS |
| Ga0311371_126056692 | 3300029951 | Palsa | SWPDGNQVATPRPAVVHHEADTFITTYTAIDPLQSAHASVTLDGFFGWPLTAVAS |
| Ga0311339_104555511 | 3300029999 | Palsa | DSSPVATPRPIVVHHETDTFITTYTAIDPLRSAGGTVALDGFFGWPLTTVVS |
| Ga0311339_111065952 | 3300029999 | Palsa | TDTFTTTYTAIDPLRPDHAAVTLDGFFGWPLTTTVS |
| Ga0311338_104903233 | 3300030007 | Palsa | SWPDGNQVATPRPAVVHHEADTFITTYTAIDPLRSPHANVTLDGFFGWPLTAVAS |
| Ga0311338_105543422 | 3300030007 | Palsa | DWPDGSQVATPRPAVVHHETDTFSITYTAIDSLRQANATVALDGFFGWPLAATVS |
| Ga0311338_115839532 | 3300030007 | Palsa | VHHETDTFTTTYTAIDPPRPDHAAVTLDGFFGWPLTATAS |
| Ga0302177_103954741 | 3300030053 | Palsa | TPRPAVVHHESDTFITTYTAIDPLRSANGTVALDGFFGWPLTSIAS |
| Ga0302182_101393252 | 3300030054 | Palsa | HHQADTFITTYTAIDPLRSDGGTVALDGFFGWPLTATAS |
| Ga0311353_106978782 | 3300030399 | Palsa | VATPRPIVVHHETDTFITTYTAIDPLRSAGGTVALDGFFGWPLTTVVS |
| Ga0311357_116795041 | 3300030524 | Palsa | VVHREADTFITTYTAIDPLQSAHARVTLDGFFGWPLTAVAS |
| Ga0210287_11744771 | 3300030598 | Soil | DGASIAATRPAVVHHATDTYITTYTAIDPLRSHGATVALDGFFGWQLTGTAS |
| Ga0310039_101653961 | 3300030706 | Peatlands Soil | PPVVHHETDTFTTTYAAIDPLRSENATAALDGFFGWPLAATAS |
| Ga0265461_117891082 | 3300030743 | Soil | FFSIYYSETFITTYAAIDPLRSAGRTVTLDGFFGWPLTAHAS |
| Ga0265762_11480371 | 3300030760 | Soil | VHHATDTYITTYTATDPPRAAGATVALDGFFGWPLTATAS |
| Ga0265746_10236921 | 3300030815 | Soil | PRPAVVHHESDTFTTTYTAIDPLRSESTAVALDGFFGWPLTAVAS |
| Ga0302180_104771702 | 3300031028 | Palsa | DTFITTYTAIDPLQSAHASVTLDGFFGWPLTAVAS |
| Ga0302325_116011531 | 3300031234 | Palsa | DTYLTTYAATDPPLSAGGAVELDGFFGWPLAATAS |
| Ga0302324_1009498001 | 3300031236 | Palsa | QVATPRPAVVHHETDTFSITYTAIDSLRQANATVALDGFFGWPLAATVS |
| Ga0265332_101763512 | 3300031238 | Rhizosphere | DGNQVAIPRPAVVHHESDTFTTTYTAIDPLRSGNAAVALDGFFGWPLTAVAS |
| Ga0302140_103470721 | 3300031261 | Bog | HHETDTFSITCAAIDSLRQANATVALDGFLGWPLAATAS |
| Ga0310915_105220502 | 3300031573 | Soil | VHHESDTFTTTDTAIDPLRSGNATAALDGFFGWPLTATAR |
| Ga0310686_1035430642 | 3300031708 | Soil | VVHHETDTFITTYTAIDPLLSAGGPVTLDGFFGWPLTATAS |
| Ga0310686_1194234361 | 3300031708 | Soil | AVVHHETDTFITTYTAIDPARSASAAVALDGFFGWPLSAVAS |
| Ga0318546_111243111 | 3300031771 | Soil | VVHHETDTFTTTYTAIDPLSSGNATVALDGFFGWPLTATAS |
| Ga0318547_110368371 | 3300031781 | Soil | NWPDGNQVATPRPAVVHHETDTFTTTYTAIDPLSSGNATVALDGFFGWPLTATAS |
| Ga0307478_111524261 | 3300031823 | Hardwood Forest Soil | SDTFITTYTAIDPPRTADAAVALDGFFGWPLSAVAS |
| Ga0308175_1001158875 | 3300031938 | Soil | VATPRPVVVHAETDTFLTTYTAIDPPRQAGGAVTLDGFFGWPLTAVAR |
| Ga0307471_1024267041 | 3300032180 | Hardwood Forest Soil | RPAVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLSAVAS |
| Ga0335079_101205331 | 3300032783 | Soil | VHHETDTFITTYTAIDPPRPAGKPAGATLTLDGFFGWPLSAVAS |
| Ga0335078_119320381 | 3300032805 | Soil | GNSVASPRPAVVHQQSDTFITTYAATDPLRTAGGQVALDGFFGWPLSSVAS |
| Ga0335080_104989573 | 3300032828 | Soil | VATPRPAVVHHETDTFITTYTAIDPPRPAGKPAGATLTLDGFFGWPLSAVAS |
| Ga0310811_105657263 | 3300033475 | Soil | RTSRPAVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLSAVAS |
| Ga0370514_098964_3_149 | 3300034199 | Untreated Peat Soil | VATPRPAVVHHETDTFLTTYTAIDPPHSASAAVALDGFFGWPLTTVAS |
| Ga0373948_0008936_1_111 | 3300034817 | Rhizosphere Soil | TDTFITTYTAIDPPRSAGATLTLDGFFGWPLSAVAS |
| ⦗Top⦘ |