NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F039235

Metagenome / Metatranscriptome Family F039235

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039235
Family Type Metagenome / Metatranscriptome
Number of Sequences 164
Average Sequence Length 46 residues
Representative Sequence MTRIPYVRREELGPEGQQLWDSIVNGRGDLVVTADGGLAGPFNAFV
Number of Associated Samples 139
Number of Associated Scaffolds 164

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 32.93 %
% of genes near scaffold ends (potentially truncated) 96.95 %
% of genes from short scaffolds (< 2000 bps) 85.98 %
Associated GOLD sequencing projects 134
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (62.805 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(33.537 % of family members)
Environment Ontology (ENVO) Unclassified
(26.829 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.902 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.84%    β-sheet: 2.70%    Coil/Unstructured: 59.46%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 164 Family Scaffolds
PF11706zf-CGNR 6.10
PF00877NLPC_P60 5.49
PF00378ECH_1 4.88
PF00478IMPDH 3.66
PF03636Glyco_hydro_65N 3.05
PF00920ILVD_EDD 3.05
PF00561Abhydrolase_1 3.05
PF00903Glyoxalase 2.44
PF02567PhzC-PhzF 1.83
PF13548DUF4126 1.83
PF13450NAD_binding_8 1.83
PF01625PMSR 1.22
PF01425Amidase 1.22
PF14200RicinB_lectin_2 1.22
PF07077DUF1345 1.22
PF05721PhyH 1.22
PF02720DUF222 1.22
PF03795YCII 1.22
PF07729FCD 1.22
PF04960Glutaminase 1.22
PF04191PEMT 0.61
PF11796DUF3323 0.61
PF08450SGL 0.61
PF00890FAD_binding_2 0.61
PF13006Nterm_IS4 0.61
PF00067p450 0.61
PF03446NAD_binding_2 0.61
PF03861ANTAR 0.61
PF13738Pyr_redox_3 0.61
PF01548DEDD_Tnp_IS110 0.61
PF07282OrfB_Zn_ribbon 0.61
PF12697Abhydrolase_6 0.61
PF07690MFS_1 0.61
PF13193AMP-binding_C 0.61
PF13185GAF_2 0.61
PF01609DDE_Tnp_1 0.61
PF01494FAD_binding_3 0.61
PF00027cNMP_binding 0.61
PF09084NMT1 0.61
PF05685Uma2 0.61
PF01243Putative_PNPOx 0.61
PF13602ADH_zinc_N_2 0.61
PF00440TetR_N 0.61
PF07228SpoIIE 0.61
PF08281Sigma70_r4_2 0.61
PF04248NTP_transf_9 0.61
PF04199Cyclase 0.61
PF00579tRNA-synt_1b 0.61
PF01557FAA_hydrolase 0.61
PF00719Pyrophosphatase 0.61
PF00106adh_short 0.61

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 164 Family Scaffolds
COG0129Dihydroxyacid dehydratase/phosphogluconate dehydrataseCarbohydrate transport and metabolism [G] 6.10
COG0791Cell wall-associated hydrolase, NlpC_P60 familyCell wall/membrane/envelope biogenesis [M] 5.49
COG1554Phosphatase/phosphodiesterase/kojibiose phosphorylase YcjT/PafA/Npp1, AlkP superfamilyCarbohydrate transport and metabolism [G] 3.05
COG0384Predicted epimerase YddE/YHI9, PhzF superfamilyGeneral function prediction only [R] 1.83
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 1.22
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 1.22
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 1.22
COG2066GlutaminaseAmino acid transport and metabolism [E] 1.22
COG1802DNA-binding transcriptional regulator, GntR familyTranscription [K] 1.22
COG4291Uncharacterized membrane proteinFunction unknown [S] 1.22
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.22
COG5285Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) familySecondary metabolites biosynthesis, transport and catabolism [Q] 1.22
COG0225Peptide methionine sulfoxide reductase MsrAPosttranslational modification, protein turnover, chaperones [O] 1.22
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.61
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 0.61
COG3707Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domainsTranscription [K] 0.61
COG5421TransposaseMobilome: prophages, transposons [X] 0.61
COG3547TransposaseMobilome: prophages, transposons [X] 0.61
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.61
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.61
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.61
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.61
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.61
COG3293TransposaseMobilome: prophages, transposons [X] 0.61
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.61
COG2343Uncharacterized conserved protein, DUF427 familyFunction unknown [S] 0.61
COG2124Cytochrome P450Defense mechanisms [V] 0.61
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 0.61
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.61
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.61
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.61
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.61
COG0221Inorganic pyrophosphataseEnergy production and conversion [C] 0.61
COG0180Tryptophanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.61
COG0162Tyrosyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.61


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms62.80 %
UnclassifiedrootN/A37.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459010|GIO7OMY01D9JSGAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia511Open in IMG/M
2189573000|GPBTN7E01BRN9DAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii512Open in IMG/M
3300001356|JGI12269J14319_10014805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila5938Open in IMG/M
3300004081|Ga0063454_101547689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia569Open in IMG/M
3300004091|Ga0062387_100519270Not Available836Open in IMG/M
3300005434|Ga0070709_11407606Not Available564Open in IMG/M
3300005436|Ga0070713_102360462Not Available514Open in IMG/M
3300005445|Ga0070708_101857821Not Available559Open in IMG/M
3300005454|Ga0066687_10647401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → unclassified Actinoplanes → Actinoplanes sp. ATCC 53533628Open in IMG/M
3300005529|Ga0070741_11124526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia666Open in IMG/M
3300005537|Ga0070730_10646335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium673Open in IMG/M
3300005540|Ga0066697_10461406Not Available729Open in IMG/M
3300005602|Ga0070762_10172225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1309Open in IMG/M
3300005610|Ga0070763_10411933All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300005610|Ga0070763_10524712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii680Open in IMG/M
3300005764|Ga0066903_106897115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia590Open in IMG/M
3300006028|Ga0070717_10740553All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300006086|Ga0075019_10930473Not Available559Open in IMG/M
3300006102|Ga0075015_101050391All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300006176|Ga0070765_100169275All Organisms → cellular organisms → Bacteria1963Open in IMG/M
3300006755|Ga0079222_12423980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia526Open in IMG/M
3300006794|Ga0066658_10856066Not Available518Open in IMG/M
3300006854|Ga0075425_101842885All Organisms → cellular organisms → Bacteria → Terrabacteria group678Open in IMG/M
3300006914|Ga0075436_100221255Not Available1343Open in IMG/M
3300009174|Ga0105241_11514443Not Available646Open in IMG/M
3300009174|Ga0105241_11929715Not Available579Open in IMG/M
3300009523|Ga0116221_1287715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia711Open in IMG/M
3300009551|Ga0105238_11358541Not Available737Open in IMG/M
3300009683|Ga0116224_10418346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia638Open in IMG/M
3300009683|Ga0116224_10590045All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300009700|Ga0116217_10750354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii602Open in IMG/M
3300009824|Ga0116219_10255000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia995Open in IMG/M
3300009824|Ga0116219_10457022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia709Open in IMG/M
3300010048|Ga0126373_11023596All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300010303|Ga0134082_10246222Not Available740Open in IMG/M
3300010361|Ga0126378_11219819All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300010361|Ga0126378_12388294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia604Open in IMG/M
3300010366|Ga0126379_10005655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia8356Open in IMG/M
3300010373|Ga0134128_10974592Not Available938Open in IMG/M
3300010373|Ga0134128_12517893Not Available567Open in IMG/M
3300010376|Ga0126381_102148480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis803Open in IMG/M
3300010379|Ga0136449_101168068All Organisms → cellular organisms → Bacteria1216Open in IMG/M
3300010379|Ga0136449_104554357Not Available509Open in IMG/M
3300010866|Ga0126344_1032811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2631Open in IMG/M
3300010880|Ga0126350_10727959Not Available1003Open in IMG/M
3300011119|Ga0105246_10733063Not Available870Open in IMG/M
3300011270|Ga0137391_10062149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3198Open in IMG/M
3300012206|Ga0137380_10764121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii836Open in IMG/M
3300012210|Ga0137378_10147843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2177Open in IMG/M
3300012469|Ga0150984_101354172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii604Open in IMG/M
3300012915|Ga0157302_10124149Not Available846Open in IMG/M
3300012961|Ga0164302_11371291Not Available575Open in IMG/M
3300013104|Ga0157370_11302851Not Available654Open in IMG/M
3300013296|Ga0157374_10367624Not Available1431Open in IMG/M
3300013297|Ga0157378_12733567Not Available546Open in IMG/M
3300013306|Ga0163162_12186152Not Available635Open in IMG/M
3300013307|Ga0157372_11661340Not Available735Open in IMG/M
3300013307|Ga0157372_12526577Not Available590Open in IMG/M
3300014201|Ga0181537_10928564Not Available589Open in IMG/M
3300016294|Ga0182041_11016934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia750Open in IMG/M
3300016387|Ga0182040_11835571All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300017822|Ga0187802_10142958All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300017926|Ga0187807_1084042Not Available996Open in IMG/M
3300017928|Ga0187806_1001001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales7104Open in IMG/M
3300017932|Ga0187814_10410827Not Available528Open in IMG/M
3300017934|Ga0187803_10367384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300017972|Ga0187781_10138956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1701Open in IMG/M
3300017993|Ga0187823_10316181Not Available547Open in IMG/M
3300017995|Ga0187816_10149946All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300018001|Ga0187815_10052438All Organisms → cellular organisms → Bacteria → Proteobacteria1716Open in IMG/M
3300020580|Ga0210403_11061966Not Available631Open in IMG/M
3300020581|Ga0210399_10441259Not Available1084Open in IMG/M
3300020581|Ga0210399_10588031All Organisms → cellular organisms → Bacteria → Terrabacteria group921Open in IMG/M
3300021088|Ga0210404_10402263Not Available766Open in IMG/M
3300021181|Ga0210388_10173596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1880Open in IMG/M
3300021374|Ga0213881_10047240All Organisms → cellular organisms → Bacteria → Proteobacteria1820Open in IMG/M
3300021401|Ga0210393_11076282Not Available649Open in IMG/M
3300021402|Ga0210385_10997031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis643Open in IMG/M
3300021404|Ga0210389_10718232Not Available783Open in IMG/M
3300021404|Ga0210389_11382216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii538Open in IMG/M
3300021405|Ga0210387_10213896All Organisms → cellular organisms → Bacteria1677Open in IMG/M
3300021407|Ga0210383_10654478Not Available904Open in IMG/M
3300021433|Ga0210391_10055831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3139Open in IMG/M
3300021475|Ga0210392_10037386All Organisms → cellular organisms → Bacteria2905Open in IMG/M
3300021477|Ga0210398_10078486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2683Open in IMG/M
3300021479|Ga0210410_10256903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1567Open in IMG/M
3300025320|Ga0209171_10036848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3449Open in IMG/M
3300025906|Ga0207699_10966588Not Available629Open in IMG/M
3300025916|Ga0207663_10942394Not Available691Open in IMG/M
3300025929|Ga0207664_10331979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1343Open in IMG/M
3300025936|Ga0207670_10769928Not Available800Open in IMG/M
3300025945|Ga0207679_11603084Not Available596Open in IMG/M
3300025949|Ga0207667_11761469Not Available584Open in IMG/M
3300026550|Ga0209474_10682065Not Available531Open in IMG/M
3300027168|Ga0208239_1022540Not Available607Open in IMG/M
3300027855|Ga0209693_10002369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae8397Open in IMG/M
3300027884|Ga0209275_10539973Not Available667Open in IMG/M
3300027889|Ga0209380_10056275Not Available2234Open in IMG/M
3300027889|Ga0209380_10070839Not Available1991Open in IMG/M
3300027889|Ga0209380_10322024Not Available908Open in IMG/M
3300027895|Ga0209624_10172593All Organisms → cellular organisms → Bacteria1433Open in IMG/M
3300028780|Ga0302225_10590522Not Available515Open in IMG/M
3300028906|Ga0308309_10093407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2308Open in IMG/M
3300029943|Ga0311340_10806984Not Available790Open in IMG/M
3300029951|Ga0311371_11398297Not Available788Open in IMG/M
3300030738|Ga0265462_10920813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. 8I-2737Open in IMG/M
3300031231|Ga0170824_127739316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia714Open in IMG/M
3300031236|Ga0302324_100046798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7859Open in IMG/M
3300031525|Ga0302326_10020783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria13491Open in IMG/M
3300031525|Ga0302326_13433040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia528Open in IMG/M
3300031543|Ga0318516_10885428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia503Open in IMG/M
3300031679|Ga0318561_10448115All Organisms → cellular organisms → Bacteria → Terrabacteria group710Open in IMG/M
3300031681|Ga0318572_10051607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2216Open in IMG/M
3300031682|Ga0318560_10194972All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300031708|Ga0310686_102150001Not Available545Open in IMG/M
3300031708|Ga0310686_109684221Not Available508Open in IMG/M
3300031708|Ga0310686_110150600Not Available804Open in IMG/M
3300031708|Ga0310686_110758406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1241Open in IMG/M
3300031713|Ga0318496_10064459Not Available1921Open in IMG/M
3300031723|Ga0318493_10071636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1690Open in IMG/M
3300031724|Ga0318500_10010293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3246Open in IMG/M
3300031736|Ga0318501_10410065All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300031747|Ga0318502_10006558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5034Open in IMG/M
3300031754|Ga0307475_11006803Not Available655Open in IMG/M
3300031764|Ga0318535_10157180Not Available1014Open in IMG/M
3300031768|Ga0318509_10838527Not Available508Open in IMG/M
3300031781|Ga0318547_10779211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales595Open in IMG/M
3300031782|Ga0318552_10196042Not Available1021Open in IMG/M
3300031782|Ga0318552_10226009All Organisms → cellular organisms → Bacteria → Terrabacteria group949Open in IMG/M
3300031782|Ga0318552_10294101All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300031782|Ga0318552_10657767All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300031798|Ga0318523_10014667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3285Open in IMG/M
3300031805|Ga0318497_10696808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia569Open in IMG/M
3300031832|Ga0318499_10028875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1989Open in IMG/M
3300031835|Ga0318517_10117021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1178Open in IMG/M
3300031860|Ga0318495_10097183All Organisms → cellular organisms → Bacteria → Terrabacteria group1324Open in IMG/M
3300031896|Ga0318551_10719725Not Available579Open in IMG/M
3300031897|Ga0318520_10060933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2016Open in IMG/M
3300031945|Ga0310913_10802364All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300032001|Ga0306922_10075359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3535Open in IMG/M
3300032008|Ga0318562_10436020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia761Open in IMG/M
3300032008|Ga0318562_10768849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia552Open in IMG/M
3300032009|Ga0318563_10103404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1508Open in IMG/M
3300032010|Ga0318569_10417986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria625Open in IMG/M
3300032041|Ga0318549_10470285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia566Open in IMG/M
3300032043|Ga0318556_10083732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1596Open in IMG/M
3300032064|Ga0318510_10012916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2497Open in IMG/M
3300032064|Ga0318510_10375663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia602Open in IMG/M
3300032067|Ga0318524_10515319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300032076|Ga0306924_12320913All Organisms → cellular organisms → Bacteria → Proteobacteria543Open in IMG/M
3300032089|Ga0318525_10004543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5803Open in IMG/M
3300032089|Ga0318525_10102744All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1457Open in IMG/M
3300032089|Ga0318525_10387640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia716Open in IMG/M
3300032089|Ga0318525_10466025All Organisms → cellular organisms → Bacteria → Proteobacteria647Open in IMG/M
3300032094|Ga0318540_10051657All Organisms → cellular organisms → Bacteria → Terrabacteria group1847Open in IMG/M
3300032160|Ga0311301_10981018All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300032261|Ga0306920_100592196Not Available1641Open in IMG/M
3300032770|Ga0335085_10425231Not Available1535Open in IMG/M
3300032782|Ga0335082_11387245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300032783|Ga0335079_12261421All Organisms → cellular organisms → Bacteria → Terrabacteria group517Open in IMG/M
3300032895|Ga0335074_10277542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1940Open in IMG/M
3300033158|Ga0335077_12098796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia522Open in IMG/M
3300033158|Ga0335077_12197457Not Available507Open in IMG/M
3300033290|Ga0318519_10475057All Organisms → cellular organisms → Bacteria → Terrabacteria group751Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil33.54%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.10%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil6.10%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.66%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.66%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.66%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.66%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.44%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.83%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.22%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.22%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.22%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.22%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.22%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.22%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.22%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.22%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.61%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.61%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.61%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.61%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.61%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.61%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.61%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.61%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.61%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.61%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.61%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027168Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F62_019493902170459010Grass SoilMTRIPYVRREELGPEGQQLWDGIVNGQGDLVLTAEG
N55_031776402189573000Grass SoilMTRIPYMRREELGPEGQQLWDAITDGRSDLVVTAEGGLAGPFN
JGI12269J14319_1001480513300001356Peatlands SoilMTRIPYVRREELGPEGQQLWDGLIDGLGGSLVTAEGGLAGPFNAFVTA
Ga0063454_10154768913300004081SoilMTRIPYVRRAELGPEGQQLWDGITDGRGDLVVTAEGGLAGPFNAFVTAPAAGRRL
Ga0062387_10051927023300004091Bog Forest SoilMTRIPYARREELGPEGQQLWDGIVNGRGDLVVTAEGGLAGPFNAFVT
Ga0070709_1140760613300005434Corn, Switchgrass And Miscanthus RhizosphereVKAGGALVIVRAMSRIPYVRREELEPEGQQLWDGIVNGRSDLVLTAEGGLAGPFNAFVT
Ga0070713_10236046213300005436Corn, Switchgrass And Miscanthus RhizosphereVKAGGALVIVRAMSRIPYVRREELGPEGQQLWDGIVNGRSDLILTAEGGLAGPFNAFVTA
Ga0070708_10185782123300005445Corn, Switchgrass And Miscanthus RhizosphereMSRIPYVRREELGPEGQQLWDGIVSSTSGDAVMTADGGLAGPFNAFV
Ga0066687_1064740123300005454SoilMSRIPYVRREELGPEGQRLWDAIVSGRDDLVVTAGGGLAGPFNAFVT
Ga0070741_1112452613300005529Surface SoilMTRIPYVRREQLGPEGQRLWDGIVERLGEQIMTADGGLGGPFNAF
Ga0070730_1064633513300005537Surface SoilMTRIPYVRREELGPEGQQLWDGIVTSVGELVVTADGGLAGPFNAFVTAPG
Ga0066697_1046140633300005540SoilMTRIPYVRREELGPEGQQLWDGIVSGQGDRLLTAEGGLAGPFNAFVT
Ga0070762_1017222523300005602SoilMTRIPYVRREELGPEGQQLWDGIVDGRGDLVVTAEGGLAGPFHAFVTAPGAGRRMSSLGATL
Ga0070763_1041193323300005610SoilVRRDELGSEGQQLWDGIVNTWGGLAVTASGGLAGPFNALVTAADAGRRLSALGATLRSAPTIERRLSE
Ga0070763_1052471213300005610SoilMTRIPYVRREELGPEGQQLWDGIVGGRGDLLVTAEGGLAGPFNAFV
Ga0066903_10689711523300005764Tropical Forest SoilMTRIPYVRREELGPEGQQLWDGIVGDRSDLVVTAEGGLAGPFNAFVT
Ga0070717_1074055313300006028Corn, Switchgrass And Miscanthus RhizosphereMTRIPYVRREELGPEGQQLWDGIVSGQGDRLLTADGGLAGPFNAF
Ga0075019_1093047313300006086WatershedsMTRIPYVRREDLGPEGQRLWDGIVGTWGDLAVTADGGLAGPFNAIVTAPDAGRRLS
Ga0075015_10105039113300006102WatershedsMTRIPSVRREELEPEGQQLWDSIVNGRGEEVVTADGGLAGPF
Ga0070765_10016927533300006176SoilMTRIPYVRREELGPEGQQLWDSIVNGRGDLLVTAEGGLAGPFNAFVTAPGA
Ga0079222_1242398013300006755Agricultural SoilMTRIPYVRREELGPEGQQLWDGIVGDRSDLVVTAEGGLAG
Ga0066658_1085606613300006794SoilMTRIPYVRREELGPEGQQLWDGIVSGQGDRLLTADGGLAGPFN
Ga0075425_10184288513300006854Populus RhizosphereMTRIPYVRREELGPEGQQLWDGIVGDRSDLVVTAE
Ga0075436_10022125523300006914Populus RhizosphereMTRIPYVRREELGPEGQQLWDGIVGDRSDLVVTAEGGLAGPF
Ga0105241_1151444313300009174Corn RhizosphereMSRIPYVRREELEPEGQQLWDGIVNGRSDLILTAEGGLAGPFNAFVTAPG
Ga0105241_1192971523300009174Corn RhizosphereMTRIPYVRREDLGPEGQQLWDGIVSSVSDGVVTADGGLA
Ga0116221_128771523300009523Peatlands SoilMTRIPYLRREELGPEGQQLWDSIVNGRGDLVVTADG
Ga0105238_1135854113300009551Corn RhizosphereMSRIPYVRREELEPEGQQLWDGIVNGRSDLVLTAEGGLAGPFNAFVTAPGAGR
Ga0116224_1041834613300009683Peatlands SoilMTRIPYVRREELGPEGQQLWDGLIDGLGGSLVTAEGGLAGPFN
Ga0116224_1059004523300009683Peatlands SoilMTRIPYVRREELGPEGQQLWDSIVNGLGDLVVTADGGLAGPFNAFVTAPG
Ga0116217_1075035413300009700Peatlands SoilMTRIPSVRREELGPEGQQLWDSIVNGRGDLVVTADGGLAGPFNAFVTAP
Ga0116219_1025500013300009824Peatlands SoilMTRIPSVRREELGPEGQQLWDSIVNGRGDLVVTADGGLAGPFNAFVTAPG
Ga0116219_1045702213300009824Peatlands SoilMTRIPYLRREELGPEGQQLWDSIVNGRGDLVVTADGGLAGPFNAFVTAPG
Ga0126373_1102359613300010048Tropical Forest SoilMTRIPYIRREELGPEGQQLWDSIVNGRGAQVLTPEGGLAGPF
Ga0134082_1024622233300010303Grasslands SoilMTRIPYVRREELGPEGQQLWDGIVGDRSDLVVTDEGG
Ga0126378_1121981923300010361Tropical Forest SoilMTRIPYVRREELGPEGQQLWDSIVNGRGAQVLSADG
Ga0126378_1238829423300010361Tropical Forest SoilMTRIPYVRREELGPEGQQLWDSIVNGRGDLVVTADGGLAGPFNAFVTA
Ga0126379_1000565533300010366Tropical Forest SoilMTRIPYVRREELGPEGQQLWDSIVNGRGAQVLSADGGLAGPFNA*
Ga0134128_1097459213300010373Terrestrial SoilMTRIPYVRRVELGPEGQQLWDGIVNGRSDLVVTAEGGLAGPFNAF
Ga0134128_1251789313300010373Terrestrial SoilMSRIPYVRREELEPEGQQLWDGIVNGRSDLVLTAEGGLAGPFNAFVTA
Ga0126381_10214848023300010376Tropical Forest SoilMTRIPYLRRDELGPEGQQLWDAIVDGRSDLVTAEGGLA
Ga0136449_10116806843300010379Peatlands SoilMTRIPYVRREELGPEGQQLWDSIVNGRGDLVVTADGGLAGPFNAFV
Ga0136449_10455435713300010379Peatlands SoilMTRIPYLRREELGPEGQQLWDSIVNGRGDLVVTADGGLAGPFNAFV
Ga0126344_103281133300010866Boreal Forest SoilMTRLPQLRREELGPEGQQLWDAILDGRGDLLVTAEGGLAGPFNA
Ga0126350_1072795913300010880Boreal Forest SoilMTRLPYVRREELGPEGQQLWDAILDGRGDLLVTAE
Ga0105246_1073306313300011119Miscanthus RhizosphereMSRIPYVRREELEPEGQQLWDGIVNGRSDLVLTAEGGLAGP
Ga0137391_1006214913300011270Vadose Zone SoilMTRIPYRRREELGPEGQQLWDSIVNGRGDLVVTADGGLAGPFNAFVTAPGAG
Ga0137380_1076412123300012206Vadose Zone SoilMTRIPYVRREELGPDGQQLWDGIVGDRSDLVVTAEGGLAGPFNAFVTAPGAGR
Ga0137378_1014784313300012210Vadose Zone SoilMTRIPYVRREELEPEGQQLWDGIVSSVSDVVVTADGGLAGPFNAFVTAPGGGCPRSARS*
Ga0150984_10135417213300012469Avena Fatua RhizosphereMTRIPYVRRAELGPEGQQLWDGITDGRGDLVVTAEGGLAGPFN
Ga0157302_1012414913300012915SoilMTRIPYVRREELGPEGQQLWDGIVDGRSDLVLTAEGGLAGPFNA
Ga0164302_1137129123300012961SoilMTRIPYVRREELGPEGQQLWDGIVGDRSDLVVTAEGGLAGPFNAFVTVPGAG
Ga0157370_1130285113300013104Corn RhizosphereMSRIPYVRREELGPEGQQLWDGIVNGRSDLILTAEGGLAGRSTRLSRR
Ga0157374_1036762413300013296Miscanthus RhizosphereMKAGGALVIVRAMSRIPYVRREELGPEGQQLWDGIVNGQSDLVLTAEGGLAGPFNAFVTA
Ga0157378_1273356713300013297Miscanthus RhizosphereMTRIPYVRREELGPEGQQLWDGIVNGRSDLVVTAEGGLAGPF
Ga0163162_1218615223300013306Switchgrass RhizosphereMSRIPYVRREELEPEGQQLWDGIVNGRSDLVLTAEGGLGGAVNAFVTATGAGGRLSEM
Ga0157372_1166134013300013307Corn RhizosphereMSRIPYVRREELGPEGQQLWDGIVNGRSDLILTAEGGLAGPFNAFVT
Ga0157372_1252657723300013307Corn RhizosphereMSRIPYVRREELEPEGQQLWDGIVNGRSDLILTAEGGLAGPFNAFVT
Ga0181537_1092856423300014201BogMTRIPYVRREELGPEGQQLWDGIVASLGGQVVTADGGLAGPFNAFVTVPGA
Ga0182041_1101693413300016294SoilMTRIPYARREELGPEGQQLWDAIVNGRDDLIVTGDGGLAGPFNAFVTA
Ga0182040_1183557113300016387SoilMTRIPYLRREELGPEGQQLWDAIVEGRSDLLVTAEGGLAGPFN
Ga0187802_1014295823300017822Freshwater SedimentMTRIPYVRREELGPEGQQLWDSIVNGLGDLVVTADGGLAG
Ga0187807_108404223300017926Freshwater SedimentMVIVRVMTRIPYVRREELGPEGQQLWDAIVGGRGDLVVTADGGLAGPFNAF
Ga0187806_100100113300017928Freshwater SedimentMAIVRAMTRIPYLRRYELGPEGQQLWDGLTEGRGESLITAEGGLAGP
Ga0187814_1041082723300017932Freshwater SedimentMTRIPYVRREDLGPEGQQLWDALVDGQRELVVTADGGLAGPFN
Ga0187803_1036738413300017934Freshwater SedimentVRRDELGPEGQQLWDGLVNNLGDHIVTADGGLAGPFNAF
Ga0187781_1013895613300017972Tropical PeatlandMTRIPYVRREELGPEGQRLWDGIVGRVGEAVVTADGGLAG
Ga0187823_1031618123300017993Freshwater SedimentMTRIPYVRREELGPEGQQLLDGIVSGQGDRLLTAEGGLAG
Ga0187816_1014994613300017995Freshwater SedimentMTRIPYVRREELGPEGQQLWDSIVNGLGDLVVTADGG
Ga0187815_1005243843300018001Freshwater SedimentMVIVRVMTRIPYVRREELGPEGQQLWDAIVGGRGDLVVTADGGLAGPFNAFVTAPGAG
Ga0210403_1106196613300020580SoilMNRLPYLRRDELGPAGQALWDGLVDGRDAMLVGEHGGLVGPFNAFVT
Ga0210399_1044125913300020581SoilMTRIPYVRREELGPEGQQLWDSIVNGRGDLLVTAEGGLAG
Ga0210399_1058803133300020581SoilMTRIPYVRREDLGAEGQRLWDGIVNTWGDLAVTANGGLAGPFNAFVTAPDAGRR
Ga0210404_1040226323300021088SoilMTRIPYLRREELGPEGQQLWDAIVDGRSDLVVTAEGGLAGPFNAF
Ga0210388_1017359643300021181SoilMTRIPYLRREELGPEGQQLWDGLVSGQGDLVVAAGGGLAGPFNAFVTVPGAG
Ga0213881_1004724013300021374Exposed RockMTRIPYVRREELGPEGQQLWDGIVGDRSDLVVTAEGGLAGPFNAFVTV
Ga0210393_1107628223300021401SoilMTRIPYVRREELGPEGQQLWDSIVNGRGDLLVTAEGGLAGPFNAFVTAPG
Ga0210385_1099703113300021402SoilMTRIPYVRRDELGSEGQQLWDGIVRTWGGLAVTANG
Ga0210389_1071823213300021404SoilMTRIPYVRRDELGPEGQRLWDSIVNGRGDQVLTADGALAGPFNAIV
Ga0210389_1138221623300021404SoilMTRIPYLRREELGPEGQQLWDAITDGRSDLVVTAEGG
Ga0210387_1021389613300021405SoilMTRIPYVRREELGPEGQQLWDAITDGRSDLVVTAEGGLAGPFNAFVTAPGA
Ga0210383_1065447813300021407SoilMTRLPYVRREELGPEGQQLWDSIVNGRGDLLVTAEGGLAGPFNAFVTA
Ga0210391_1005583113300021433SoilVRRDELGSEGQQLWDGIVNTWGGLAVTASGGLAGPFNALVTAPDAGRRL
Ga0210392_1003738643300021475SoilMTRIPYLRREELGPEGQQLWDAITDGRSDLVVTAEGGLAGPFNAFVTA
Ga0210398_1007848613300021477SoilMTRIPYLRRDELGPEGQQLWDGLVSGQGDLVVAAGGGLAGPFNAFVT
Ga0210410_1025690313300021479SoilMSRIPYVRRDELGPEGQQLWDSIVIGRGDQVLTADGALAGPFNAFVTA
Ga0209171_1003684813300025320Iron-Sulfur Acid SpringLTRLPYVRREELGPEGQQLWDAILDGRGDLLVTAEGGLAGPF
Ga0207699_1096658823300025906Corn, Switchgrass And Miscanthus RhizosphereVKAGGALVIVRAMSRIPYVRREELGPEGQQLWDGIVNGRSDLILTAEGGLAG
Ga0207663_1094239423300025916Corn, Switchgrass And Miscanthus RhizosphereMTRIPYVRRDELGPEGQQLWDSIVNGRGDQVLTADGALAGPFNAFV
Ga0207664_1033197933300025929Agricultural SoilMTRIPYVRRDELGPEGQQLWDSIVNGRGDQVLTADGALAGPFNAFVTAP
Ga0207670_1076992823300025936Switchgrass RhizosphereMSRIPYVRREELEPEGQQLWDGIVNGRSDLILTAEGGLAGPFNAFVTAPGAGPAVR
Ga0207679_1160308423300025945Corn RhizosphereMSRIPYVRREELGPEGQQLWDGIVNGRSDLVLTAEGGLAGPFNAFVTAPGAGRR
Ga0207667_1176146913300025949Corn RhizosphereMKAGGALVIVRAMSRIPYVRREELGPEGQQLWDGIVNGQSDLVLTAEGGLAGPFNAFVT
Ga0209474_1068206513300026550SoilMTRIPYVRREELGPEGQQLWDGIVNGQGDLVVTAEGGLAG
Ga0208239_102254013300027168Forest SoilMSRLPTSRRDDLAPEAQQLWDAIVSGRGAQLVTAEGGLAGPFNAFVTAPEV
Ga0209693_1000236913300027855SoilMTRIPYVRRDELGSEGQQLWDGIVRTWGGLAVTANGGLAGPFNALVTAPDA
Ga0209275_1053997323300027884SoilMTRIPYVRREELGPEGQQLWDGIVDGRGDLVVTAEGGLAGPFHAFVTAPGAGRRM
Ga0209380_1005627513300027889SoilMSRIPYVRRDELGPEGQQLWDGIVNGRGDQVLTADGALAGPFNAFV
Ga0209380_1007083913300027889SoilMTRIPYVRREELGPEGQQLWDSIVNGRGDLLVTAEGGLAGPFNAFV
Ga0209380_1032202413300027889SoilMTRIPYVRREELGPEGQQLWDSIVNGRGDLLVTAEGGLAGPFNAFVTAP
Ga0209624_1017259313300027895Forest SoilVRREELGPEGQQLWDRLVNGLGDLVVTAGGGLAGPFNAFV
Ga0302225_1059052213300028780PalsaMTRIPYVRREELGPEGQQLWDGIVDGRGDLVVTAEG
Ga0308309_1009340713300028906SoilMTRIPYVRREELGPEGQQLWDGIVGGRGDLLVTAEAAWP
Ga0311340_1080698423300029943PalsaMTRIPYVRREELGPEGQQLWDGIVDGRGDLVVTAEGGLAGPF
Ga0311371_1139829713300029951PalsaMTRIPYVRREELGPEGQQLWDGIVDGRGDLVVTAEGGLAGP
Ga0265462_1092081313300030738SoilMASVRAMTRIPYLRRDELGPEGQQLWDGLVSGQGDLVVAAGGGLAGPFNA
Ga0170824_12773931623300031231Forest SoilMKYGYRSGMSRIPYLRREELGPDGQRLWDSIVDGRGDALVT
Ga0302324_10004679813300031236PalsaMTRIPYVRREELRPEGQQLWDGIVDNLGDRVATADGGLAGPFNAFVTAP
Ga0302326_10020783173300031525PalsaMTRIPYVRREELRPEGQQLWDGIVDNLGDRVATADGGLAGPFNAFVT
Ga0302326_1343304013300031525PalsaMTRIPYVRREELGPEGQQLRDSIVNGRGDRVTADGGLAG
Ga0318516_1088542813300031543SoilMVIVRAMTRIPYVRREELGPEGQQLWDALVNGRDDLIVTAGGGLA
Ga0318561_1044811523300031679SoilMRREELGPEGQQLWDAIVNGRDDLVVTADGGLAGPFNAFVTAPGAGRR
Ga0318572_1005160743300031681SoilMVIVRAMTRIPYMRREELGPEGQQLWDAIVNGRDDLVVTADGGPAGP
Ga0318560_1019497223300031682SoilMTRIPYVRREELGPEGQQLWDGIVNGRDDLLVTAEGGLAGPFNAF
Ga0310686_10215000113300031708SoilMTRIPYVRREELGPEGQQLWDSIVKSRSGSVVAADGGLTGPFNAFVT
Ga0310686_10968422123300031708SoilMTRIPYVRREELGPEGQQLWDGIVNGRDDLLVTAEGGLAGPFNAFVT
Ga0310686_11015060013300031708SoilMVIVRAMTRLPYVRREQLEPEGQQLWDNLVNGLSDLVVTAEGGLAGPFNA
Ga0310686_11075840623300031708SoilMTRIPYLRREELGPEGQQLWDGIVNGRGDLVITADGGLAGPFNAFVTAP
Ga0318496_1006445913300031713SoilMTRIPYLRRDELGPDGQQLWDAIVGGRSDLVTAEGGLAG
Ga0318493_1007163623300031723SoilIPYVRREELGPEGQQLWDGIVNGRDDLLVTAEGGLAAMTGS
Ga0318500_1001029343300031724SoilMTRIPYLRREELGPEGQQLWDSIVGSRGEVVVTADGGLAGPF
Ga0318501_1041006523300031736SoilMTRIPYVRREELGPEGQQLWDGIVNGRDDLLVTAEGGLAGPFNAFVTAP
Ga0318502_1000655843300031747SoilMTRIPYVRREELGPEGQQLWDGIVNGRDDLLVTAEGGLAGPFNAFV
Ga0307475_1100680313300031754Hardwood Forest SoilMTRIPYVRREELGPEGQQLWDSIVNGRGDLLVTAEGGLAGPFNAFVTAPGAGR
Ga0318535_1015718023300031764SoilMTRIPYLRRDELGPEGQQLWDAIVDGRSDLVTAEGGLAGPFNAFVTAP
Ga0318509_1083852723300031768SoilMTRIPYLRRDELGPDGQQLWDAIVGGRSDLVTAEGGLAGPFNAFVT
Ga0318547_1077921123300031781SoilMTRIPYARREELGPEGQQLWDAIVSGQGDLVVTADGGLAGPFNAFVTA
Ga0318552_1019604223300031782SoilMTRIPYLRRDELGPDGQQLWDAIVGDRSDLVTAEGGLAGPFNAFVTAPGA
Ga0318552_1022600913300031782SoilMTRIPSVRREELGPEGQQLWDSIVGSRGEVVVTADGGLAGPFN
Ga0318552_1029410113300031782SoilMTRIPYVRREELGPEGQQLWDSIVNGVGDLVVTTGGGLAGPFNA
Ga0318552_1065776723300031782SoilMRREELGPEGQQLWDALVTGRGEEIVTADGGLAGPFNAFVTAPGAGRR
Ga0318523_1001466713300031798SoilMTRIPYVRREELGPEGQQLWDGIVNGRDDLLVTAEGGLAGPFNA
Ga0318497_1069680823300031805SoilMTRIPYARREELGPEGQQLWDAIVSGQGDLVVTAD
Ga0318499_1002887513300031832SoilMTRIPYLRREELGPEGQQLWDSIVGSRGEVVVTADGGLAGPFNAFVTA
Ga0318517_1011702113300031835SoilVIVRAMTRIPYVRREELGPEGQQLWDGIVNGRDDLLVTAEGGLAAMTGS
Ga0318495_1009718333300031860SoilMTRIPSVRREELGPEGQQLWDSIVGSRGEVVVTADGGLAGPFNAFVTA
Ga0318551_1071972513300031896SoilMTRIPYVRREELGPEGQQLWDSIVNGVGDLVVTTGGGLAGPFNAFVT
Ga0318520_1006093313300031897SoilMVIVRAMTRIPYMRREELGPEGQQLWDAIVNGRDDLVVTADGGLAGPFNA
Ga0310913_1080236423300031945SoilMTRIPYVRREELGPEGQQLWDGIVNGRDDLLVTAEGGL
Ga0306922_1007535913300032001SoilMTRIPYLRREELGPEGQQLWDSIVGSRGEVVVTADGGLAGPFNAFVTAP
Ga0318562_1043602013300032008SoilMTRIPYVRREELGPEGQQLWDAIVNGRDDLIMTASGGLAGPFNAFVTAPGAGR
Ga0318562_1076884923300032008SoilMVIVRAMTRIPYMRREELGPEGQQLWDAIVNGRDDLVVTADGGLAGPFNAFVTAPG
Ga0318563_1010340433300032009SoilMTRIPSVRREELGPEGQQLWDSIVGSRGEVVVTADGGLAGPF
Ga0318569_1041798613300032010SoilMTRIPYVRREELGPEGQQLWDSIVNGVGDLVVTTGGGLAGPFNAFV
Ga0318549_1047028513300032041SoilMVIVRAMTRIPYMRREELGPEGQQLWDAIVNGRDDLVVTADGGLAGPFNAFVT
Ga0318556_1008373233300032043SoilMTRIPSVRREELGPEGQQLWDSIVGSRGEVVVTADG
Ga0318510_1001291613300032064SoilMTRIPYLRREELGPEGQQLWDSIVGSRGEVVVTADGGLAGPFNAFVTAPGAVT
Ga0318510_1037566313300032064SoilMTRIPYARREELGPEGQQLWDAIVSGQGDLVVTADGGLAR
Ga0318524_1051531923300032067SoilMTRIPYVRREELGPEGQQLWDSIVNGVGDLVVTTG
Ga0306924_1232091323300032076SoilMAIVRVMSRIPYLRREELGPEGQQLWDAIVGGRGDLVVTADGGLAGPFNA
Ga0318525_1000454343300032089SoilMTRIPYVRREELGPEGQQLWDGIVNGRDDLLVTAEGGLAAMTGS
Ga0318525_1010274433300032089SoilMTRIPYVRREELGPEGQQLWDAIVDGRGDLVTAEGGLAGPFNAFVTA
Ga0318525_1038764013300032089SoilMVIVRAMTRIPYMRREELGPEGQQLWDAIVNGRDDLVVTADG
Ga0318525_1046602513300032089SoilMAIVRVMSRIPYLRREELGPEGQQLWDAIVGGRGDLVVTADGGLAGPFNAFVTVPGAGRR
Ga0318540_1005165713300032094SoilMTRIPYVRREELGPEGQQLWDSIVNGVGDLVVTTGGGLAGPFNAFVTAPATARRP
Ga0311301_1098101813300032160Peatlands SoilMTRIPYVRREELGPEGQQLWDSIVNGRGDLVVTADGGLAGPFNAFVT
Ga0306920_10059219613300032261SoilMTRIPYLRRDELGPDGQQLWDAIVDGRSDLVTAEGGLAGPFNAF
Ga0335085_1042523113300032770SoilMSRIPYVRRDELGPEGQQLWDGIVNGRGDQVLTADGAMAGPFSAFVTAPDAGRR
Ga0335082_1138724513300032782SoilMTRIPYVRREELGPEGQQLWDGIVGDRSDLVVTAEGGLAGPFNAFVTVPG
Ga0335079_1226142113300032783SoilMTRIPYVRREELGPEGQQLWDSIISSRGGSVVRADGGLAGPFNAFVTAPG
Ga0335074_1027754233300032895SoilMTRIPYVQREELGPEGQQLWDSIVNGRGDLVVTADGGL
Ga0335077_1209879613300033158SoilMTRIPYVRREELGPEGQQLWDGIVGDRSDLVVTAEGG
Ga0335077_1219745723300033158SoilMTRIPYVRREDLGSEGQRLWDGIVGTWGALAVTANGGLAGPFNAFV
Ga0318519_1047505713300033290SoilMTRIPYVRREELGPEGQQLWDSIVNGVGDLVVTTGGGLAG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.