| Basic Information | |
|---|---|
| Family ID | F039183 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 164 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MKKVLIALVATLVAVSVSGCVGVGKGKAPPVVTKG |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 164 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 68.55 % |
| % of genes near scaffold ends (potentially truncated) | 34.76 % |
| % of genes from short scaffolds (< 2000 bps) | 82.32 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.415 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.268 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 164 Family Scaffolds |
|---|---|---|
| PF03734 | YkuD | 4.27 |
| PF00106 | adh_short | 3.66 |
| PF00990 | GGDEF | 3.05 |
| PF00198 | 2-oxoacid_dh | 1.22 |
| PF08241 | Methyltransf_11 | 1.22 |
| PF02735 | Ku | 1.22 |
| PF12787 | EcsC | 1.22 |
| PF16576 | HlyD_D23 | 1.22 |
| PF13472 | Lipase_GDSL_2 | 1.22 |
| PF00149 | Metallophos | 1.22 |
| PF04392 | ABC_sub_bind | 1.22 |
| PF07729 | FCD | 1.22 |
| PF03401 | TctC | 1.22 |
| PF01425 | Amidase | 0.61 |
| PF01068 | DNA_ligase_A_M | 0.61 |
| PF13437 | HlyD_3 | 0.61 |
| PF10397 | ADSL_C | 0.61 |
| PF02687 | FtsX | 0.61 |
| PF01872 | RibD_C | 0.61 |
| PF01176 | eIF-1a | 0.61 |
| PF03989 | DNA_gyraseA_C | 0.61 |
| PF02776 | TPP_enzyme_N | 0.61 |
| PF04140 | ICMT | 0.61 |
| PF02798 | GST_N | 0.61 |
| PF01323 | DSBA | 0.61 |
| PF06032 | DUF917 | 0.61 |
| PF07750 | GcrA | 0.61 |
| PF03237 | Terminase_6N | 0.61 |
| PF01494 | FAD_binding_3 | 0.61 |
| PF09084 | NMT1 | 0.61 |
| PF00383 | dCMP_cyt_deam_1 | 0.61 |
| PF08546 | ApbA_C | 0.61 |
| PF13561 | adh_short_C2 | 0.61 |
| PF12071 | DUF3551 | 0.61 |
| PF11752 | DUF3309 | 0.61 |
| PF13458 | Peripla_BP_6 | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 164 Family Scaffolds |
|---|---|---|---|
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 4.27 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 4.27 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 1.22 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.22 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.22 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.22 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 1.22 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 1.22 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 1.22 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.61 |
| COG5352 | Uncharacterized conserved protein | Function unknown [S] | 0.61 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.61 |
| COG3535 | Uncharacterized conserved protein, DUF917 family | Function unknown [S] | 0.61 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.61 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.61 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.61 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.61 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.61 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.61 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.61 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.61 |
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.00 % |
| Unclassified | root | N/A | 50.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FIHLEPW02SOX2J | Not Available | 515 | Open in IMG/M |
| 2228664022|INPgaii200_c0426330 | Not Available | 569 | Open in IMG/M |
| 3300000955|JGI1027J12803_101369845 | Not Available | 612 | Open in IMG/M |
| 3300000955|JGI1027J12803_105852333 | Not Available | 1150 | Open in IMG/M |
| 3300001081|JGI12662J13196_1003509 | Not Available | 1200 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100012289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7040 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101636962 | Not Available | 542 | Open in IMG/M |
| 3300004114|Ga0062593_100639422 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1024 | Open in IMG/M |
| 3300004156|Ga0062589_100866362 | Not Available | 827 | Open in IMG/M |
| 3300004479|Ga0062595_101807458 | Not Available | 581 | Open in IMG/M |
| 3300005093|Ga0062594_100447319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1068 | Open in IMG/M |
| 3300005332|Ga0066388_103015802 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300005332|Ga0066388_103806488 | Not Available | 770 | Open in IMG/M |
| 3300005529|Ga0070741_11654303 | Not Available | 522 | Open in IMG/M |
| 3300005562|Ga0058697_10606899 | Not Available | 572 | Open in IMG/M |
| 3300005564|Ga0070664_102232833 | Not Available | 519 | Open in IMG/M |
| 3300005575|Ga0066702_10906872 | Not Available | 526 | Open in IMG/M |
| 3300005587|Ga0066654_10244788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 944 | Open in IMG/M |
| 3300005764|Ga0066903_100099224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3924 | Open in IMG/M |
| 3300005764|Ga0066903_100159990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3262 | Open in IMG/M |
| 3300005764|Ga0066903_100272779 | All Organisms → cellular organisms → Bacteria | 2641 | Open in IMG/M |
| 3300005764|Ga0066903_100356693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 2369 | Open in IMG/M |
| 3300005764|Ga0066903_100385009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2295 | Open in IMG/M |
| 3300005764|Ga0066903_100391086 | All Organisms → cellular organisms → Bacteria | 2280 | Open in IMG/M |
| 3300005764|Ga0066903_100571633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1947 | Open in IMG/M |
| 3300005764|Ga0066903_100677007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1811 | Open in IMG/M |
| 3300005764|Ga0066903_101092010 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
| 3300005764|Ga0066903_101267821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1374 | Open in IMG/M |
| 3300005764|Ga0066903_101611496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1231 | Open in IMG/M |
| 3300005764|Ga0066903_101718690 | Not Available | 1195 | Open in IMG/M |
| 3300005764|Ga0066903_101762116 | Not Available | 1181 | Open in IMG/M |
| 3300005764|Ga0066903_103700159 | Not Available | 823 | Open in IMG/M |
| 3300005764|Ga0066903_104287435 | Not Available | 762 | Open in IMG/M |
| 3300005764|Ga0066903_105615836 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005764|Ga0066903_108997610 | Not Available | 506 | Open in IMG/M |
| 3300006028|Ga0070717_10355182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1311 | Open in IMG/M |
| 3300006046|Ga0066652_100007672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6624 | Open in IMG/M |
| 3300006046|Ga0066652_100215159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1662 | Open in IMG/M |
| 3300006237|Ga0097621_102244867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium albiziae | 522 | Open in IMG/M |
| 3300006572|Ga0074051_10526790 | Not Available | 516 | Open in IMG/M |
| 3300006791|Ga0066653_10122628 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300006800|Ga0066660_11327686 | Not Available | 563 | Open in IMG/M |
| 3300006852|Ga0075433_11702626 | Not Available | 543 | Open in IMG/M |
| 3300006871|Ga0075434_100579657 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300006893|Ga0073928_10000307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 117262 | Open in IMG/M |
| 3300007258|Ga0099793_10440835 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300009038|Ga0099829_10830841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 767 | Open in IMG/M |
| 3300009038|Ga0099829_11198618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 629 | Open in IMG/M |
| 3300009038|Ga0099829_11588160 | Not Available | 540 | Open in IMG/M |
| 3300009088|Ga0099830_10541504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia birgiae | 952 | Open in IMG/M |
| 3300009088|Ga0099830_10585253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 915 | Open in IMG/M |
| 3300009088|Ga0099830_11865213 | Not Available | 502 | Open in IMG/M |
| 3300009089|Ga0099828_10430543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1190 | Open in IMG/M |
| 3300009089|Ga0099828_10930414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia birgiae | 776 | Open in IMG/M |
| 3300009098|Ga0105245_13153589 | Not Available | 511 | Open in IMG/M |
| 3300009100|Ga0075418_11577577 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300009553|Ga0105249_12979389 | Not Available | 544 | Open in IMG/M |
| 3300009792|Ga0126374_11180516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300010047|Ga0126382_10565442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 928 | Open in IMG/M |
| 3300010146|Ga0126320_1382452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1058 | Open in IMG/M |
| 3300010147|Ga0126319_1617607 | Not Available | 1082 | Open in IMG/M |
| 3300010339|Ga0074046_10433870 | Not Available | 790 | Open in IMG/M |
| 3300010339|Ga0074046_10687336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WD16 | 602 | Open in IMG/M |
| 3300010358|Ga0126370_10949311 | Not Available | 781 | Open in IMG/M |
| 3300010366|Ga0126379_12225497 | Not Available | 649 | Open in IMG/M |
| 3300010400|Ga0134122_12339905 | Not Available | 580 | Open in IMG/M |
| 3300010868|Ga0124844_1214860 | Not Available | 697 | Open in IMG/M |
| 3300010868|Ga0124844_1237469 | Not Available | 647 | Open in IMG/M |
| 3300011270|Ga0137391_11301304 | Not Available | 574 | Open in IMG/M |
| 3300012096|Ga0137389_10797334 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300012189|Ga0137388_10775807 | Not Available | 889 | Open in IMG/M |
| 3300012189|Ga0137388_11007910 | Not Available | 768 | Open in IMG/M |
| 3300012202|Ga0137363_11352185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia birgiae | 601 | Open in IMG/M |
| 3300012212|Ga0150985_103446473 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300012212|Ga0150985_106179278 | Not Available | 883 | Open in IMG/M |
| 3300012212|Ga0150985_106523321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1532 | Open in IMG/M |
| 3300012212|Ga0150985_108496504 | Not Available | 661 | Open in IMG/M |
| 3300012212|Ga0150985_111815692 | Not Available | 673 | Open in IMG/M |
| 3300012212|Ga0150985_113777932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2888 | Open in IMG/M |
| 3300012363|Ga0137390_10219086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1890 | Open in IMG/M |
| 3300012469|Ga0150984_112011313 | Not Available | 594 | Open in IMG/M |
| 3300012469|Ga0150984_112297072 | Not Available | 542 | Open in IMG/M |
| 3300012469|Ga0150984_112452368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2180 | Open in IMG/M |
| 3300012469|Ga0150984_116080149 | Not Available | 2346 | Open in IMG/M |
| 3300012915|Ga0157302_10215938 | Not Available | 698 | Open in IMG/M |
| 3300012971|Ga0126369_12885569 | Not Available | 563 | Open in IMG/M |
| 3300015077|Ga0173483_11000359 | Not Available | 501 | Open in IMG/M |
| 3300015371|Ga0132258_10298346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3962 | Open in IMG/M |
| 3300015371|Ga0132258_11530488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1684 | Open in IMG/M |
| 3300015373|Ga0132257_100031696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia broomeae | 5732 | Open in IMG/M |
| 3300015373|Ga0132257_101333417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 912 | Open in IMG/M |
| 3300015374|Ga0132255_102137299 | Not Available | 853 | Open in IMG/M |
| 3300015374|Ga0132255_103369981 | Not Available | 681 | Open in IMG/M |
| 3300015374|Ga0132255_104908116 | Not Available | 566 | Open in IMG/M |
| 3300016341|Ga0182035_10478918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1060 | Open in IMG/M |
| 3300016341|Ga0182035_12138220 | Not Available | 508 | Open in IMG/M |
| 3300016404|Ga0182037_10263235 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300016422|Ga0182039_10176714 | Not Available | 1681 | Open in IMG/M |
| 3300016422|Ga0182039_10819347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Fundidesulfovibrio → Fundidesulfovibrio magnetotacticus | 827 | Open in IMG/M |
| 3300016445|Ga0182038_10310668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1293 | Open in IMG/M |
| 3300018058|Ga0187766_11108335 | Not Available | 569 | Open in IMG/M |
| 3300018058|Ga0187766_11275876 | Not Available | 534 | Open in IMG/M |
| 3300018058|Ga0187766_11437952 | Not Available | 507 | Open in IMG/M |
| 3300018073|Ga0184624_10441740 | Not Available | 572 | Open in IMG/M |
| 3300018433|Ga0066667_11548478 | Not Available | 588 | Open in IMG/M |
| 3300018468|Ga0066662_11927508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 618 | Open in IMG/M |
| 3300018468|Ga0066662_12101785 | Not Available | 592 | Open in IMG/M |
| 3300018482|Ga0066669_11576514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia birgiae | 599 | Open in IMG/M |
| 3300019361|Ga0173482_10273371 | Not Available | 730 | Open in IMG/M |
| 3300021168|Ga0210406_10918846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 657 | Open in IMG/M |
| 3300021560|Ga0126371_13409934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300022557|Ga0212123_10006908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 18462 | Open in IMG/M |
| 3300024330|Ga0137417_1358042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3686 | Open in IMG/M |
| 3300025320|Ga0209171_10003090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 23289 | Open in IMG/M |
| 3300025898|Ga0207692_11082990 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300025928|Ga0207700_11793089 | Not Available | 540 | Open in IMG/M |
| 3300025932|Ga0207690_11516746 | Not Available | 560 | Open in IMG/M |
| 3300025960|Ga0207651_10699964 | Not Available | 893 | Open in IMG/M |
| 3300026023|Ga0207677_10624120 | Not Available | 948 | Open in IMG/M |
| 3300026300|Ga0209027_1154285 | Not Available | 779 | Open in IMG/M |
| 3300027181|Ga0208997_1016238 | Not Available | 1028 | Open in IMG/M |
| 3300027537|Ga0209419_1129922 | Not Available | 503 | Open in IMG/M |
| 3300027635|Ga0209625_1115094 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300027812|Ga0209656_10377027 | Not Available | 640 | Open in IMG/M |
| 3300027824|Ga0209040_10089092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1768 | Open in IMG/M |
| 3300027862|Ga0209701_10533934 | Not Available | 632 | Open in IMG/M |
| 3300027862|Ga0209701_10544237 | Not Available | 624 | Open in IMG/M |
| 3300027875|Ga0209283_10778973 | Not Available | 590 | Open in IMG/M |
| 3300028814|Ga0307302_10098524 | Not Available | 1395 | Open in IMG/M |
| 3300031543|Ga0318516_10043159 | All Organisms → cellular organisms → Bacteria | 2432 | Open in IMG/M |
| 3300031544|Ga0318534_10361239 | Not Available | 835 | Open in IMG/M |
| 3300031682|Ga0318560_10020709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3006 | Open in IMG/M |
| 3300031744|Ga0306918_10026274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3614 | Open in IMG/M |
| 3300031744|Ga0306918_10936893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 674 | Open in IMG/M |
| 3300031744|Ga0306918_11251403 | Not Available | 572 | Open in IMG/M |
| 3300031768|Ga0318509_10819875 | Not Available | 514 | Open in IMG/M |
| 3300031781|Ga0318547_10236399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Oricola → Oricola indica | 1099 | Open in IMG/M |
| 3300031793|Ga0318548_10016889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3005 | Open in IMG/M |
| 3300031805|Ga0318497_10051850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2117 | Open in IMG/M |
| 3300031819|Ga0318568_10236875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1129 | Open in IMG/M |
| 3300031833|Ga0310917_10087323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1987 | Open in IMG/M |
| 3300031879|Ga0306919_10253023 | Not Available | 1326 | Open in IMG/M |
| 3300031879|Ga0306919_10371730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia birgiae | 1094 | Open in IMG/M |
| 3300031879|Ga0306919_10997837 | Not Available | 640 | Open in IMG/M |
| 3300031890|Ga0306925_10534765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1245 | Open in IMG/M |
| 3300031893|Ga0318536_10012368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3703 | Open in IMG/M |
| 3300031910|Ga0306923_10145334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2704 | Open in IMG/M |
| 3300031912|Ga0306921_12322659 | Not Available | 562 | Open in IMG/M |
| 3300031941|Ga0310912_11033669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia birgiae | 629 | Open in IMG/M |
| 3300031945|Ga0310913_10627771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 761 | Open in IMG/M |
| 3300031946|Ga0310910_11269150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300032052|Ga0318506_10279624 | Not Available | 740 | Open in IMG/M |
| 3300032055|Ga0318575_10629125 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300032060|Ga0318505_10409143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
| 3300032066|Ga0318514_10619906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300032089|Ga0318525_10305980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 816 | Open in IMG/M |
| 3300032261|Ga0306920_101999240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 812 | Open in IMG/M |
| 3300033290|Ga0318519_11017249 | Not Available | 515 | Open in IMG/M |
| 3300033290|Ga0318519_11074149 | Not Available | 502 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 12.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.20% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.49% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.66% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.44% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.44% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.83% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.22% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.22% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.22% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.22% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.61% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.61% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001081 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_02171790 | 2070309004 | Green-Waste Compost | MKKIFVALVATVVAVGMAGCVGVGKGKAPPVVTKG |
| INPgaii200_04263302 | 2228664022 | Soil | MKKILVAMVATLVAISVSACVGPYGIGKGKGKAPPPIVTKG |
| JGI1027J12803_1013698451 | 3300000955 | Soil | MKKIMIALVATLVAMSVGACAYGYGKGKAPPPRVVTTKG* |
| JGI1027J12803_1058523333 | 3300000955 | Soil | MKKILVAMVATLVAISVSACVGPYGIGKGKGKAPPPIVTKG* |
| JGI12662J13196_10035091 | 3300001081 | Forest Soil | MKKLVFALLATLVAVSVAGCAGGMGKGKARPAVVTKG* |
| JGIcombinedJ26739_1000122899 | 3300002245 | Forest Soil | MKKLLFALIATIVAVSVSGCAGMGKGKAPPVVTKG* |
| JGIcombinedJ26739_1016369622 | 3300002245 | Forest Soil | MKKVLVALVAILVAVSVSGCAGGFGKGKAPPPRVVTKG* |
| Ga0062593_1006394222 | 3300004114 | Soil | REAVMKKVLIALVASLVAISVSGCAGYGFGKGKAPPPRVVTKG* |
| Ga0062589_1008663621 | 3300004156 | Soil | MKKVLIALVATLVAVSVSGCAGYGFGKGKAPPPRVVTKG* |
| Ga0062595_1018074581 | 3300004479 | Soil | KISPLIREAVMKKVLIALVASLVAISVSGCAGYGFGKGKAPPPRVVTKG* |
| Ga0062594_1004473192 | 3300005093 | Soil | MKKVLIALVASLVAISVSGCAGYGFGKGKAPPPRVVTKG* |
| Ga0066388_1030158022 | 3300005332 | Tropical Forest Soil | MHLYGGPSMKKIMVAVVATLVAISVSACVGPYGIGKGKGKAPPPVVTKG* |
| Ga0066388_1038064882 | 3300005332 | Tropical Forest Soil | MKKVLIALVATLVAVSVSGCAGYGLGKGKAPPPRVVTKG* |
| Ga0070741_116543031 | 3300005529 | Surface Soil | MKKILVAAVATLIAVSVAGCAAVGFGKGKAPPPVVTKG* |
| Ga0058697_106068992 | 3300005562 | Agave | MKKVLIAFVATLVAVSVAGCAGVGKGKGKAPAPVVTKG* |
| Ga0070664_1022328332 | 3300005564 | Corn Rhizosphere | VKKGEPMKKVLIALVATLVAVSVAGCAGIGKGKGKPPPPIVTKG* |
| Ga0066702_109068721 | 3300005575 | Soil | MKKVLIALVATLVAVSVSGCVGVGKGKAPPVVTKG* |
| Ga0066654_102447882 | 3300005587 | Soil | MKKVLTVLVATLVAVSVAGCVGIGKGKGKAPPPIVTKG* |
| Ga0066903_1000992246 | 3300005764 | Tropical Forest Soil | KIMVALVATLVAISLSGCAYGFGKGKGVPPRVVTKG* |
| Ga0066903_1001599904 | 3300005764 | Tropical Forest Soil | MKKIFVALVATIVAIGMAGCVGVGKGKAPPVVTKG* |
| Ga0066903_1002727792 | 3300005764 | Tropical Forest Soil | MKKLLFALVATIVAVSVSGCVGGYGKGKAPPIVTKG* |
| Ga0066903_1003566932 | 3300005764 | Tropical Forest Soil | MKKVFVALVATVVAVGMAGCVGIGKGKAPPVVTKG* |
| Ga0066903_1003850091 | 3300005764 | Tropical Forest Soil | MGAPMKKLLVAMVATLVAVSVAGCVGIGKGKGKAPPPIVTKG* |
| Ga0066903_1003910863 | 3300005764 | Tropical Forest Soil | MKKLLIALVATLVAVSVSGCVGVGKGKAPPVVTKG* |
| Ga0066903_1005716332 | 3300005764 | Tropical Forest Soil | MKKLLIALVATLVAVSVSGCVGIGKGKGKAPPVVTKG* |
| Ga0066903_1006770073 | 3300005764 | Tropical Forest Soil | MKKLLFALVATLVAVSVSGCVGIGKGKAPPVVTKG* |
| Ga0066903_1010920103 | 3300005764 | Tropical Forest Soil | MKKVLIALIATLVAVSVSGCVGVGKGKAPPVVTKG* |
| Ga0066903_1012678212 | 3300005764 | Tropical Forest Soil | MKKFVIALVATLVAVSVSACVGIGKGKGKAPPLPPPPIMTKG* |
| Ga0066903_1016114964 | 3300005764 | Tropical Forest Soil | MKKIMVAVVATLVAISVSACVGPYGIGKGKGKAPPPVVTKG* |
| Ga0066903_1017186903 | 3300005764 | Tropical Forest Soil | MKKVLVALVATLVAVSVSGCVGFGKGKAPPPIVSKG* |
| Ga0066903_1017621163 | 3300005764 | Tropical Forest Soil | MKKIMIALVATLVAMSVGACAYPYGYGKGKAPPPVVTKR* |
| Ga0066903_1037001592 | 3300005764 | Tropical Forest Soil | MKKIFVALVATVVAVGMAGCVGVGKGKAPPVVTKG* |
| Ga0066903_1042874352 | 3300005764 | Tropical Forest Soil | MKKIMVAMVATLVALSVGACAYGYGKGKAPPPRVVTKG* |
| Ga0066903_1056158362 | 3300005764 | Tropical Forest Soil | MKKILVALVATFVAIGMVGCVGGYGKGKAPPIVTKG* |
| Ga0066903_1089976102 | 3300005764 | Tropical Forest Soil | MKKLLFALVATLVAVSVSGCVGVGKGKAPPVVTKG* |
| Ga0070717_103551822 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKVVVAAAAVITLVSLAGCAGIGKGKGKAPPPIPVITKG* |
| Ga0066652_1000076729 | 3300006046 | Soil | MKKIFVAMVATIVAIGMAGCVGVGKGKAPPVVTKG* |
| Ga0066652_1002151592 | 3300006046 | Soil | MKKVLCALVATLVAVSVAGCVGIGKGKGKAPPIVTKG* |
| Ga0097621_1022448671 | 3300006237 | Miscanthus Rhizosphere | EAVMKKVLIALVASLVAISVSGCAGYGFGKGKAPPPRVVTKG* |
| Ga0074051_105267901 | 3300006572 | Soil | LLIALVATLVAVSVSACAGIGKGKGKAPPPIITKG* |
| Ga0066653_101226282 | 3300006791 | Soil | MKKLLFALVATVVAVSVAGCAGMGKGKAPPVVTKG* |
| Ga0066660_113276861 | 3300006800 | Soil | MKKLLIALVATLVAVSVSGCVGIGKGKGKAPPIVTKG* |
| Ga0075433_117026262 | 3300006852 | Populus Rhizosphere | VLIALVATLVAVSVAGCAGIGKGKGKAPPPIVTKG* |
| Ga0075434_1005796573 | 3300006871 | Populus Rhizosphere | RGTPMKKVLTALVATLVAVSVAGCAGIGKGKGKAPPPIVTKG* |
| Ga0073928_1000030796 | 3300006893 | Iron-Sulfur Acid Spring | MKKLVIALIATLVAVSVSGCVGVGKGKAPPVVTKG* |
| Ga0099793_104408352 | 3300007258 | Vadose Zone Soil | MKKIFVALVATIVAVGMVGCVGVGKGKAPPIVTKG* |
| Ga0099829_108308411 | 3300009038 | Vadose Zone Soil | MKKLLIALVATLVAVSVSGCVGVGKGKGKAPPIVTKG* |
| Ga0099829_111986181 | 3300009038 | Vadose Zone Soil | MKKLLVALVATLVAVSVAGCVGIGKGKGKAPPPIVTKG* |
| Ga0099829_115881602 | 3300009038 | Vadose Zone Soil | IFVALVATLVAVSMAGCVGVGKGKGKAPPPIVTKG* |
| Ga0099830_105415042 | 3300009088 | Vadose Zone Soil | MKKVLIALVATVVAVGMAGCVGVGKGKAPPIVTKG* |
| Ga0099830_105852532 | 3300009088 | Vadose Zone Soil | MKKLLVALVATLVAVSVAGCVGVGKGKGKAPPPIVTKG* |
| Ga0099830_118652131 | 3300009088 | Vadose Zone Soil | KKVLIALVATLVAVSVSGCVGIGKGKGKAPPIVTKG* |
| Ga0099828_104305431 | 3300009089 | Vadose Zone Soil | MKKLFVALVATLVAVSVAGCAGIGKGKGKAPPPIVTKG* |
| Ga0099828_109304142 | 3300009089 | Vadose Zone Soil | MKKVLIALVATLVAVSVSGCVGIGKGKGKAPPIVTKG* |
| Ga0105245_131535892 | 3300009098 | Miscanthus Rhizosphere | MKKVLTALVATLVAVSVAGCAGIGKGKGKAPPPIVTKG* |
| Ga0075418_115775772 | 3300009100 | Populus Rhizosphere | MKKVLTVLVATLVAASVAGCAGIGKGKGKAPPPIVTKG* |
| Ga0105249_129793891 | 3300009553 | Switchgrass Rhizosphere | MKKVLFALVATLVAVSVSGCAGLGKGKGKAPPPPPIVRKG* |
| Ga0126374_111805162 | 3300009792 | Tropical Forest Soil | MKKVLFALVATLVAVSVAGCVGIGKGKGKAPPPIVTKG* |
| Ga0126382_105654421 | 3300010047 | Tropical Forest Soil | MKKVLIALVATLVAVSVAGCVGIGKGKGKAPPPIVTKG* |
| Ga0126320_13824521 | 3300010146 | Soil | YQHRGYPMKKVLIALVATLVAVSVSGCVGVGKGKAPPVVTKG* |
| Ga0126319_16176072 | 3300010147 | Soil | KKILVALVATLVAVSVAGCAGIGKGKGKAPPPIVTKG* |
| Ga0074046_104338701 | 3300010339 | Bog Forest Soil | MKKVLFALIATLVAVSVSGCVGIGKGKAPPVVTKG* |
| Ga0074046_106873361 | 3300010339 | Bog Forest Soil | APMKKIFVALVATVVAVGMAGCVGVGKGKAPPVVTKG* |
| Ga0126370_109493111 | 3300010358 | Tropical Forest Soil | KVLFALVATLVAVSVSGCVGIGKGKAPPPIVTKG* |
| Ga0126379_122254972 | 3300010366 | Tropical Forest Soil | MKKIMVAVVATLVAISVSACVGPYGIGKGKGKAPPPVVT |
| Ga0134122_123399051 | 3300010400 | Terrestrial Soil | MKKVLFALVATLVAVSVSGCAGLGKGKGKAPPPPPIVRK |
| Ga0124844_12148602 | 3300010868 | Tropical Forest Soil | LIALVATLVAVSVSACVGIGKGKGKAPPPIVTKG* |
| Ga0124844_12374692 | 3300010868 | Tropical Forest Soil | VLIALVATLVAVSVSACVGIGKGKGKAPPPIVTKG* |
| Ga0137391_113013042 | 3300011270 | Vadose Zone Soil | PMKKLLVALVATLVAVSVAGCVGIGKGKGKAPPPIVTKG* |
| Ga0137389_107973341 | 3300012096 | Vadose Zone Soil | MKKIFVALVATVVAVGMVGCVGVGKGKAPPIVTKG* |
| Ga0137388_107758072 | 3300012189 | Vadose Zone Soil | MKKIFVALVATLVAVSMAGCVGVGKGKGKAPPPIVTKG* |
| Ga0137388_110079102 | 3300012189 | Vadose Zone Soil | MKKIFVALVATIVAVGMAGCVGVGKGKAPPVVTKG* |
| Ga0137363_113521851 | 3300012202 | Vadose Zone Soil | MKKVLVALVATLVAVSVSGCVGVGKGKAPPVVTKG* |
| Ga0150985_1034464732 | 3300012212 | Avena Fatua Rhizosphere | MNKIFVALVATVVAIGMSGCVGVGKGKAPPPIVTKG* |
| Ga0150985_1061792781 | 3300012212 | Avena Fatua Rhizosphere | KKVLTVLVATLVAVSVAGCVGIGKGKGKAPPPVVTKG* |
| Ga0150985_1065233211 | 3300012212 | Avena Fatua Rhizosphere | LTVLVATLVAVSVAGCVGIGKGKGKAPPPIVTKG* |
| Ga0150985_1084965041 | 3300012212 | Avena Fatua Rhizosphere | MKKVLIAFVATLVAVSVAGCAGLGKGRGKAPAPVVTKG* |
| Ga0150985_1118156921 | 3300012212 | Avena Fatua Rhizosphere | GQQHRGFQMKKLLFALVATLVAVSVAGCAGMGKGKAPPVVTKG* |
| Ga0150985_1137779324 | 3300012212 | Avena Fatua Rhizosphere | KKVLTVLVATLVAVSVAGCVGIGKGKGKGKGKAPPPIVTKG* |
| Ga0137390_102190861 | 3300012363 | Vadose Zone Soil | MKKVLVALVATLVAVSVSGCVGIGKGKGKAPPIVTKG* |
| Ga0150984_1120113132 | 3300012469 | Avena Fatua Rhizosphere | KVLVALVATLVAVSVSGCVGIGKGKGKAPPPVVTKG* |
| Ga0150984_1122970722 | 3300012469 | Avena Fatua Rhizosphere | MKKVLIAFVATLVAVSVAGCAGLGKGKGKAPAPVVTKG* |
| Ga0150984_1124523681 | 3300012469 | Avena Fatua Rhizosphere | MKKVLCALVATLVAVTVAGCVGVGKGKGKAPPIVTKG* |
| Ga0150984_1160801493 | 3300012469 | Avena Fatua Rhizosphere | MKKVLTVLVATLVAVSVAGCVGIGKGKGKGKAPPPIVTKG* |
| Ga0157302_102159381 | 3300012915 | Soil | MKKVLIAFVATLVAVSVAGCAGIGKGKGKALPPVVTKG* |
| Ga0126369_128855691 | 3300012971 | Tropical Forest Soil | MKKVLFALVATIVAVSVSGCVGIGKGKAPPVVTKG* |
| Ga0173483_110003593 | 3300015077 | Soil | SKEAVMKKVLIALVATLVAVSVSGCAGYGFGKGKAPPPRVVTKG* |
| Ga0132258_102983462 | 3300015371 | Arabidopsis Rhizosphere | MKKLLIALVATLVAVSVSGCVGIGKGKAPPVVTKG* |
| Ga0132258_115304881 | 3300015371 | Arabidopsis Rhizosphere | PMKKVLIALVATLVAVSVSGCVGVGKGKAPPVVTKA* |
| Ga0132257_1000316962 | 3300015373 | Arabidopsis Rhizosphere | MKKVVVAAVTVITLVSLAGCAGIGKGKGKAPPPIPVITKG* |
| Ga0132257_1013334172 | 3300015373 | Arabidopsis Rhizosphere | MKKLVIALVATLVAVSVSGCVGIGKGKAPPIVTKG* |
| Ga0132255_1021372991 | 3300015374 | Arabidopsis Rhizosphere | LIALVATLVAVSVAGWAGIGKGKGKAPPPIVTKG* |
| Ga0132255_1033699811 | 3300015374 | Arabidopsis Rhizosphere | IRGSKEAVMKKVLIALVATLVAVSVSGCAGYGFGKGKAPPPRVVTKG* |
| Ga0132255_1049081161 | 3300015374 | Arabidopsis Rhizosphere | KSASIRGSKEAVMKKVLIALVATLVAVSVSGCAGLGKGKAPPPRVVTKG* |
| Ga0182035_104789181 | 3300016341 | Soil | MKKVFVVLVATVVAVGMAGCVGIGKGKAPPVVTKG |
| Ga0182035_115100462 | 3300016341 | Soil | MKKLVVALLATLVAVSVAGCAGIGKGKARPAVLTKG |
| Ga0182035_121382201 | 3300016341 | Soil | MKKLLIALVATLVAVSVSGCVGIGKGKAPPVVTKG |
| Ga0182037_102632352 | 3300016404 | Soil | GTPMKKVLVALVATLVAVSVAGCVGIGKCKGPPPVVTKG |
| Ga0182039_101767141 | 3300016422 | Soil | MKKIFVALVATMVAVGMAGCVGVGKGKAPPVVTKG |
| Ga0182039_108193471 | 3300016422 | Soil | MKKVIFALIATIVAVSVAGCAGMGKGKAPPVVTKG |
| Ga0182038_103106683 | 3300016445 | Soil | PMKKVLFAVLATLVAVSVSGCVGVGKGKAPPVVTKG |
| Ga0187766_111083352 | 3300018058 | Tropical Peatland | MKKLLFALVATLVAVSVSGCVGVGKGKAPPPPVVTK |
| Ga0187766_112758761 | 3300018058 | Tropical Peatland | MKKIFVALVATVVAVGMVGCVGVGKGKAPPVVTKG |
| Ga0187766_114379522 | 3300018058 | Tropical Peatland | MKKVLFALVATLVAVSVSGCVGVGKGKAPPVVTKG |
| Ga0184624_104417401 | 3300018073 | Groundwater Sediment | MKKVLFALVATLVAVSVSGCVGVGKGKAPPIVTKG |
| Ga0066667_115484781 | 3300018433 | Grasslands Soil | MKKLLFALVATVVAVSVAGCAGMGKGKAPPVVTKG |
| Ga0066662_119275081 | 3300018468 | Grasslands Soil | MKKLLVAMVATLVAVSVAGCVGIGKGKGKAPPPIVTKG |
| Ga0066662_121017851 | 3300018468 | Grasslands Soil | MKKIFVALVATIVAVGMAGCVGVGKGKAPPVVTKG |
| Ga0066669_115765142 | 3300018482 | Grasslands Soil | MKKVLIALVATLVAVSVSGCVGVGKGKAPPVVTKG |
| Ga0173482_102733712 | 3300019361 | Soil | MKKVLIALVATLVAVSVSGCAGYGFGKGKAPPPRVVTKG |
| Ga0210406_109188462 | 3300021168 | Soil | MKKLLFALIATIVAVSVSGCAGMGKGKAPPVVTKG |
| Ga0126371_134099342 | 3300021560 | Tropical Forest Soil | MKKLLIALVATLVAVSVSGCVGVGKGKAPPVVTKG |
| Ga0212123_100069088 | 3300022557 | Iron-Sulfur Acid Spring | MKKLVIALIATLVAVSVSGCVGVGKGKAPPVVTKG |
| Ga0137417_13580424 | 3300024330 | Vadose Zone Soil | MKKILVALVATLVAVSVAGCAGIGKARAKAPPPIVTKG |
| Ga0209171_1000309011 | 3300025320 | Iron-Sulfur Acid Spring | MKKLLFALVATLVAVSVSGCVGVGKGKAPPVVTKG |
| Ga0207692_110829901 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VLVALVATLVAVSVSGCVGIGKGKGKAPPPVVTKG |
| Ga0207700_117930892 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKVLTALVATLVAVSVAGCAGIGKGKGKAPPPIVTKG |
| Ga0207690_115167461 | 3300025932 | Corn Rhizosphere | MNKLLIALVATLVAVSVSGCAGVGKGKAPPPVAAPIVTKG |
| Ga0207651_106999642 | 3300025960 | Switchgrass Rhizosphere | MKKALFALVATLVAVSVSGCAGIGKGKGKAPPPIVTKG |
| Ga0207677_106241201 | 3300026023 | Miscanthus Rhizosphere | SPLIREAVMKKVLIALVASLVAISVSGCAGYGFGKGKAPPPRVVTKG |
| Ga0209027_11542851 | 3300026300 | Grasslands Soil | MKKVLIALVATLVAVSVSGCVGIGKGKGKAPPIVTKG |
| Ga0208997_10162382 | 3300027181 | Forest Soil | LLVALVATLVAVSVAGCAGIGKGKGKAPPPIVTKG |
| Ga0209419_11299221 | 3300027537 | Forest Soil | MKKLLIALVATLVAVSVSGCVGVGKGKCKAPPIVTKG |
| Ga0209625_11150942 | 3300027635 | Forest Soil | MKKILIALVATLVAVSVSACVGIGKGKGKAPPDVLP |
| Ga0209656_103770271 | 3300027812 | Bog Forest Soil | MKKVLFALIATLVAVSVSGCVGIGKGKAPPVVTKG |
| Ga0209040_100890922 | 3300027824 | Bog Forest Soil | MKKILFALIATVVAVSVSGCVGVGKGKAPPIVTKG |
| Ga0209701_105339342 | 3300027862 | Vadose Zone Soil | MKKIFVALVATIVAVGMVGCVGVGKGKAPPIVTKG |
| Ga0209701_105442372 | 3300027862 | Vadose Zone Soil | AEGIPMKKLLIALVATLVAVSVSGCVGIGKGKGKAPPIVTKG |
| Ga0209283_107789731 | 3300027875 | Vadose Zone Soil | MKKVLVALVATLVAVSVSGCVGIGKGKGKAPPIVTKG |
| Ga0307302_100985243 | 3300028814 | Soil | KILVALVATLVAVSVAGCAGIGKGKGKAPPPIVTKG |
| Ga0318516_100431592 | 3300031543 | Soil | MKKVFVALVATVVAVGMAGCVGIGKGKAPPVVTKG |
| Ga0318534_103612392 | 3300031544 | Soil | MKKVLFAVIATLVAVSVSGCVGVGKGKAPPVVTKG |
| Ga0318560_100207093 | 3300031682 | Soil | MKKLLFALVATVVAVSVSGCVGVGKGKAPPVVTKG |
| Ga0306918_100262743 | 3300031744 | Soil | MKKVLFALVATIVAVSVSGCVGIGKGKAPPVVTKG |
| Ga0306918_105400941 | 3300031744 | Soil | MKKLVCALLATVLAFSVAGCAGVGKGKAPPVVTKG |
| Ga0306918_109368931 | 3300031744 | Soil | GIPMKKLLFALVATLVAVSVSGCVGIGKGKAPPVVTKG |
| Ga0306918_112514031 | 3300031744 | Soil | MKKIFVALVATIVAIGMAGCVGVGKGKAPPVVTKG |
| Ga0318509_108198752 | 3300031768 | Soil | MKKLLFALVATLVAVSVSGCVGIGKGKAPPVVTKGLG |
| Ga0318547_102363992 | 3300031781 | Soil | MKKLLFALVATLVAVSVSGCVGVGKGKAPPIVTKG |
| Ga0318548_100168892 | 3300031793 | Soil | MKKVLFALVATLVAVSVSGCVGVGNGKAPPVVTKG |
| Ga0318497_100518503 | 3300031805 | Soil | IPMKKLLFALVATLVAVSVSGCVGVGKGKAPPVVTKG |
| Ga0318568_102368752 | 3300031819 | Soil | PMKKVLFALVATLVAVSVSGCVGVGKGKAPPVVTKG |
| Ga0318567_103852901 | 3300031821 | Soil | MLLFDSRQVTEGVTMKKLVCALLATVLAFSVAGCAGVGKGKAPPVVTKG |
| Ga0310917_100873235 | 3300031833 | Soil | MKKVLFALVATLVAVSVSGCVGIGKGKAPPAVVTKG |
| Ga0306919_102530232 | 3300031879 | Soil | MKKIFVALVATLVAVGMVGCVGVGKGKAPPVVTKG |
| Ga0306919_102659451 | 3300031879 | Soil | MKKLVVALLATLVAVSVAGCAGIGKGKARPAVVTKG |
| Ga0306919_103717302 | 3300031879 | Soil | MKKVLIALIATLVAVSVSGCVGVGKGKAPPVVTKG |
| Ga0306919_109978372 | 3300031879 | Soil | MKKLLFALVATLVAVSVSGCVGIGKGKAPPVVTKG |
| Ga0306925_105347652 | 3300031890 | Soil | MKKVLIALVATLVAASVSGCVGYGLGKGKAPPPVVTKG |
| Ga0318536_100123681 | 3300031893 | Soil | EGIPMKKVLFAVIATLVAVSVSGCVGVGKGKAPPVVTKG |
| Ga0306923_101453344 | 3300031910 | Soil | MKKILFALVATLVAVSVSGCVGVGKGKAPPIVTKG |
| Ga0306921_123226592 | 3300031912 | Soil | MKRVLIALVATLVAASVSGCVGYGLGKGKAPPPVVTKG |
| Ga0310912_110336692 | 3300031941 | Soil | MKKVLIALIATLVAVSVSGCVGVGTGKAPPVVTKG |
| Ga0310913_106277711 | 3300031945 | Soil | GYPMKKVLFALVATIVAVSVSGCVGIGKGKAPPVVTKG |
| Ga0310910_112691501 | 3300031946 | Soil | RGYPMKKVLIALIATLVAVSVSGCVGVGKGKAPPVVTKG |
| Ga0306922_117059122 | 3300032001 | Soil | RQVTEGVTMKKLVCALLATVLAFSVAGCAGVGKGKAPPVVTKG |
| Ga0318506_102796242 | 3300032052 | Soil | AEGIPMKKVLFAVIATLVAVSVSGCVGVGKGKAPPVVTKG |
| Ga0318575_106291251 | 3300032055 | Soil | PMKKIFVALVATLVAVGMVGCVGVGKGKAPPVVTKG |
| Ga0318505_104091431 | 3300032060 | Soil | CSMKRVLIALVATLVAASVSGCVGYGLGKGKAPPPVVTKG |
| Ga0318514_106199062 | 3300032066 | Soil | HRGYPMKKVLIALIATLVAVSVSGCVGVGKGKAPPVVTKG |
| Ga0318525_103059802 | 3300032089 | Soil | RGYPMKKVLFALVATLVAVSVSGCVGVGKGKAPPVVTKG |
| Ga0306920_1019992401 | 3300032261 | Soil | PMKKVLIALIATLVAVSVSGCVGVGKGKAPPVVTKG |
| Ga0318519_110172491 | 3300033290 | Soil | KERGIPMKKVLFALVATLVAVSVSGCVGIGKGKAPPPIVRKG |
| Ga0318519_110741492 | 3300033290 | Soil | MKKVLVVLVATLVAVSVSGCAGIGKGKGKAPPAIVTKG |
| ⦗Top⦘ |