Basic Information | |
---|---|
Family ID | F039112 |
Family Type | Metagenome |
Number of Sequences | 164 |
Average Sequence Length | 46 residues |
Representative Sequence | MTLSFSQDVYTEMVQVQQAQIQALQNKVQELQARIEVLEQQSILFI |
Number of Associated Samples | 107 |
Number of Associated Scaffolds | 164 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.61 % |
% of genes near scaffold ends (potentially truncated) | 33.54 % |
% of genes from short scaffolds (< 2000 bps) | 73.17 % |
Associated GOLD sequencing projects | 98 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (70.122 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (20.732 % of family members) |
Environment Ontology (ENVO) | Unclassified (59.756 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (59.756 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 59.46% β-sheet: 0.00% Coil/Unstructured: 40.54% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 164 Family Scaffolds |
---|---|---|
PF03796 | DnaB_C | 6.10 |
PF11753 | DUF3310 | 4.27 |
PF08291 | Peptidase_M15_3 | 3.66 |
PF12684 | DUF3799 | 3.05 |
PF04466 | Terminase_3 | 2.44 |
PF01844 | HNH | 1.83 |
PF14550 | Peptidase_S78_2 | 1.22 |
PF08299 | Bac_DnaA_C | 1.22 |
PF09568 | RE_MjaI | 1.22 |
PF04860 | Phage_portal | 0.61 |
PF02195 | ParBc | 0.61 |
PF13578 | Methyltransf_24 | 0.61 |
COG ID | Name | Functional Category | % Frequency in 164 Family Scaffolds |
---|---|---|---|
COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 6.10 |
COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 6.10 |
COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 2.44 |
COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 1.22 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 70.12 % |
All Organisms | root | All Organisms | 29.88 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2022920000|QLn_FQAYR3Y02S8YFH | Not Available | 523 | Open in IMG/M |
3300000756|JGI12421J11937_10001810 | Not Available | 8648 | Open in IMG/M |
3300000756|JGI12421J11937_10004226 | Not Available | 5730 | Open in IMG/M |
3300000756|JGI12421J11937_10163293 | Not Available | 541 | Open in IMG/M |
3300002384|B570J29636_1001992 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1543 | Open in IMG/M |
3300002408|B570J29032_109141658 | Not Available | 609 | Open in IMG/M |
3300002408|B570J29032_109218169 | Not Available | 640 | Open in IMG/M |
3300002408|B570J29032_109688759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1060 | Open in IMG/M |
3300003277|JGI25908J49247_10014992 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2369 | Open in IMG/M |
3300003394|JGI25907J50239_1009479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 2299 | Open in IMG/M |
3300003394|JGI25907J50239_1054983 | Not Available | 804 | Open in IMG/M |
3300003394|JGI25907J50239_1060151 | Not Available | 762 | Open in IMG/M |
3300004481|Ga0069718_10070053 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1544 | Open in IMG/M |
3300004481|Ga0069718_10079360 | Not Available | 818 | Open in IMG/M |
3300005580|Ga0049083_10045763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1550 | Open in IMG/M |
3300005581|Ga0049081_10000507 | Not Available | 14939 | Open in IMG/M |
3300005581|Ga0049081_10041016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1757 | Open in IMG/M |
3300005581|Ga0049081_10208331 | Not Available | 699 | Open in IMG/M |
3300005662|Ga0078894_10122696 | Not Available | 2314 | Open in IMG/M |
3300005662|Ga0078894_11359084 | Not Available | 595 | Open in IMG/M |
3300005805|Ga0079957_1066987 | All Organisms → Viruses → Predicted Viral | 2096 | Open in IMG/M |
3300006637|Ga0075461_10027826 | All Organisms → Viruses → Predicted Viral | 1864 | Open in IMG/M |
3300006639|Ga0079301_1103883 | Not Available | 869 | Open in IMG/M |
3300006802|Ga0070749_10032661 | All Organisms → Viruses → Predicted Viral | 3236 | Open in IMG/M |
3300006802|Ga0070749_10085886 | All Organisms → Viruses → Predicted Viral | 1874 | Open in IMG/M |
3300006802|Ga0070749_10447081 | Not Available | 709 | Open in IMG/M |
3300006863|Ga0075459_1026098 | Not Available | 977 | Open in IMG/M |
3300007162|Ga0079300_10041995 | Not Available | 1497 | Open in IMG/M |
3300007363|Ga0075458_10062391 | Not Available | 1168 | Open in IMG/M |
3300007540|Ga0099847_1000236 | Not Available | 18615 | Open in IMG/M |
3300007974|Ga0105747_1167847 | Not Available | 714 | Open in IMG/M |
3300008107|Ga0114340_1194033 | Not Available | 691 | Open in IMG/M |
3300008108|Ga0114341_10000927 | Not Available | 31959 | Open in IMG/M |
3300008259|Ga0114841_1000300 | Not Available | 30002 | Open in IMG/M |
3300008259|Ga0114841_1005232 | Not Available | 7694 | Open in IMG/M |
3300008259|Ga0114841_1019135 | Not Available | 5997 | Open in IMG/M |
3300008259|Ga0114841_1034800 | Not Available | 2556 | Open in IMG/M |
3300008259|Ga0114841_1230892 | Not Available | 629 | Open in IMG/M |
3300008262|Ga0114337_1161705 | Not Available | 957 | Open in IMG/M |
3300008266|Ga0114363_1085603 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1164 | Open in IMG/M |
3300008266|Ga0114363_1205548 | Not Available | 600 | Open in IMG/M |
3300008267|Ga0114364_1063053 | Not Available | 1277 | Open in IMG/M |
3300008267|Ga0114364_1159242 | Not Available | 608 | Open in IMG/M |
3300008448|Ga0114876_1174758 | Not Available | 755 | Open in IMG/M |
3300008450|Ga0114880_1003630 | Not Available | 8436 | Open in IMG/M |
3300008450|Ga0114880_1066445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1476 | Open in IMG/M |
3300008450|Ga0114880_1137030 | Not Available | 899 | Open in IMG/M |
3300008450|Ga0114880_1239896 | Not Available | 574 | Open in IMG/M |
3300009081|Ga0105098_10176483 | Not Available | 974 | Open in IMG/M |
3300009081|Ga0105098_10465465 | Not Available | 638 | Open in IMG/M |
3300009082|Ga0105099_10442330 | Not Available | 781 | Open in IMG/M |
3300009085|Ga0105103_10652525 | Not Available | 602 | Open in IMG/M |
3300010354|Ga0129333_10139451 | All Organisms → Viruses → Predicted Viral | 2228 | Open in IMG/M |
3300010354|Ga0129333_10348372 | Not Available | 1318 | Open in IMG/M |
3300010354|Ga0129333_10850812 | Not Available | 775 | Open in IMG/M |
3300010354|Ga0129333_11222100 | Not Available | 623 | Open in IMG/M |
3300011984|Ga0119931_1014151 | Not Available | 889 | Open in IMG/M |
3300013004|Ga0164293_10010916 | Not Available | 7612 | Open in IMG/M |
3300013004|Ga0164293_10193537 | All Organisms → Viruses → Predicted Viral | 1475 | Open in IMG/M |
3300013004|Ga0164293_10201957 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1435 | Open in IMG/M |
3300013004|Ga0164293_10674961 | Not Available | 664 | Open in IMG/M |
3300013004|Ga0164293_11010016 | Not Available | 519 | Open in IMG/M |
3300013005|Ga0164292_10125649 | Not Available | 1903 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10168714 | All Organisms → Viruses → Predicted Viral | 1419 | Open in IMG/M |
(restricted) 3300013127|Ga0172365_10090381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1962 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10287358 | Not Available | 1066 | Open in IMG/M |
3300013372|Ga0177922_10494591 | Not Available | 753 | Open in IMG/M |
3300013372|Ga0177922_10526972 | Not Available | 714 | Open in IMG/M |
3300015050|Ga0181338_1005055 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2233 | Open in IMG/M |
3300017700|Ga0181339_1015193 | Not Available | 881 | Open in IMG/M |
3300017701|Ga0181364_1049227 | Not Available | 662 | Open in IMG/M |
3300017722|Ga0181347_1115545 | Not Available | 754 | Open in IMG/M |
3300017722|Ga0181347_1151626 | Not Available | 632 | Open in IMG/M |
3300017722|Ga0181347_1194862 | Not Available | 535 | Open in IMG/M |
3300017723|Ga0181362_1058314 | Not Available | 795 | Open in IMG/M |
3300017736|Ga0181365_1081044 | Not Available | 795 | Open in IMG/M |
3300017747|Ga0181352_1011856 | All Organisms → Viruses → Predicted Viral | 2809 | Open in IMG/M |
3300017754|Ga0181344_1109856 | Not Available | 798 | Open in IMG/M |
3300017754|Ga0181344_1185563 | Not Available | 586 | Open in IMG/M |
3300017761|Ga0181356_1160940 | Not Available | 689 | Open in IMG/M |
3300017761|Ga0181356_1182417 | Not Available | 632 | Open in IMG/M |
3300017766|Ga0181343_1160614 | Not Available | 624 | Open in IMG/M |
3300017778|Ga0181349_1086330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1189 | Open in IMG/M |
3300017778|Ga0181349_1114463 | Not Available | 998 | Open in IMG/M |
3300017778|Ga0181349_1150565 | Not Available | 836 | Open in IMG/M |
3300017785|Ga0181355_1130231 | Not Available | 1025 | Open in IMG/M |
3300019784|Ga0181359_1166838 | Not Available | 740 | Open in IMG/M |
3300020048|Ga0207193_1003607 | Not Available | 25832 | Open in IMG/M |
3300020048|Ga0207193_1159940 | All Organisms → Viruses → Predicted Viral | 1868 | Open in IMG/M |
3300020183|Ga0194115_10078850 | Not Available | 1918 | Open in IMG/M |
3300020183|Ga0194115_10080993 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1882 | Open in IMG/M |
3300020183|Ga0194115_10291684 | Not Available | 749 | Open in IMG/M |
3300020183|Ga0194115_10302947 | Not Available | 728 | Open in IMG/M |
3300020204|Ga0194116_10505057 | Not Available | 567 | Open in IMG/M |
3300020205|Ga0211731_11513575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 999 | Open in IMG/M |
3300020503|Ga0208363_1008821 | Not Available | 1400 | Open in IMG/M |
3300020505|Ga0208088_1002505 | All Organisms → cellular organisms → Bacteria | 2921 | Open in IMG/M |
3300020515|Ga0208234_1024539 | Not Available | 694 | Open in IMG/M |
3300020525|Ga0207938_1025599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium | 950 | Open in IMG/M |
3300020539|Ga0207941_1019655 | Not Available | 1007 | Open in IMG/M |
3300020549|Ga0207942_1013426 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1074 | Open in IMG/M |
3300020569|Ga0208229_1048966 | Not Available | 609 | Open in IMG/M |
3300021961|Ga0222714_10169545 | All Organisms → Viruses → Predicted Viral | 1289 | Open in IMG/M |
3300021961|Ga0222714_10325034 | Not Available | 835 | Open in IMG/M |
3300021961|Ga0222714_10381832 | Not Available | 749 | Open in IMG/M |
3300021962|Ga0222713_10255361 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1140 | Open in IMG/M |
3300021962|Ga0222713_10480179 | Not Available | 747 | Open in IMG/M |
3300021963|Ga0222712_10007925 | Not Available | 10153 | Open in IMG/M |
3300021963|Ga0222712_10049091 | All Organisms → Viruses → Predicted Viral | 3167 | Open in IMG/M |
3300021963|Ga0222712_10141738 | All Organisms → Viruses → Predicted Viral | 1632 | Open in IMG/M |
3300022169|Ga0196903_1014375 | Not Available | 970 | Open in IMG/M |
3300022179|Ga0181353_1123144 | Not Available | 618 | Open in IMG/M |
3300022190|Ga0181354_1153060 | Not Available | 720 | Open in IMG/M |
3300022407|Ga0181351_1006864 | All Organisms → Viruses → Predicted Viral | 4448 | Open in IMG/M |
3300022407|Ga0181351_1187668 | Not Available | 704 | Open in IMG/M |
3300025635|Ga0208147_1041734 | All Organisms → Viruses → Predicted Viral | 1188 | Open in IMG/M |
3300025889|Ga0208644_1008825 | Not Available | 7067 | Open in IMG/M |
3300027499|Ga0208788_1034706 | All Organisms → Viruses → Predicted Viral | 1453 | Open in IMG/M |
3300027563|Ga0209552_1003602 | All Organisms → Viruses → Predicted Viral | 4990 | Open in IMG/M |
3300027659|Ga0208975_1000235 | Not Available | 29818 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1087707 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1554 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1161574 | Not Available | 950 | Open in IMG/M |
3300027732|Ga0209442_1143746 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 924 | Open in IMG/M |
3300027743|Ga0209593_10127755 | Not Available | 923 | Open in IMG/M |
3300027785|Ga0209246_10148822 | Not Available | 920 | Open in IMG/M |
3300027785|Ga0209246_10271715 | Not Available | 654 | Open in IMG/M |
3300027792|Ga0209287_10339763 | Not Available | 577 | Open in IMG/M |
3300027797|Ga0209107_10000725 | Not Available | 18972 | Open in IMG/M |
3300027797|Ga0209107_10003091 | Not Available | 9220 | Open in IMG/M |
3300027808|Ga0209354_10398817 | Not Available | 535 | Open in IMG/M |
(restricted) 3300027970|Ga0247837_1335104 | Not Available | 555 | Open in IMG/M |
3300027972|Ga0209079_10036516 | All Organisms → Viruses → Predicted Viral | 1649 | Open in IMG/M |
(restricted) 3300028569|Ga0247843_1040678 | Not Available | 2825 | Open in IMG/M |
(restricted) 3300028569|Ga0247843_1246998 | Not Available | 646 | Open in IMG/M |
(restricted) 3300028581|Ga0247840_10073971 | All Organisms → Viruses → Predicted Viral | 2418 | Open in IMG/M |
(restricted) 3300029286|Ga0247841_10433739 | Not Available | 856 | Open in IMG/M |
3300031539|Ga0307380_10019218 | Not Available | 8233 | Open in IMG/M |
3300031539|Ga0307380_10970843 | Not Available | 681 | Open in IMG/M |
3300031758|Ga0315907_10385848 | Not Available | 1132 | Open in IMG/M |
3300031772|Ga0315288_10902055 | Not Available | 801 | Open in IMG/M |
3300031857|Ga0315909_10001646 | Not Available | 30028 | Open in IMG/M |
3300031857|Ga0315909_10034402 | All Organisms → Viruses → Predicted Viral | 4867 | Open in IMG/M |
3300031857|Ga0315909_10056463 | Not Available | 3595 | Open in IMG/M |
3300031999|Ga0315274_11708275 | Not Available | 584 | Open in IMG/M |
3300032093|Ga0315902_10342825 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1386 | Open in IMG/M |
3300033993|Ga0334994_0003436 | Not Available | 11354 | Open in IMG/M |
3300033994|Ga0334996_0503952 | Not Available | 541 | Open in IMG/M |
3300033996|Ga0334979_0027007 | Not Available | 3841 | Open in IMG/M |
3300034012|Ga0334986_0179991 | All Organisms → Viruses → Predicted Viral | 1197 | Open in IMG/M |
3300034050|Ga0335023_0268376 | Not Available | 934 | Open in IMG/M |
3300034050|Ga0335023_0443605 | Not Available | 679 | Open in IMG/M |
3300034061|Ga0334987_0343885 | Not Available | 968 | Open in IMG/M |
3300034062|Ga0334995_0001216 | Not Available | 27723 | Open in IMG/M |
3300034062|Ga0334995_0720648 | Not Available | 558 | Open in IMG/M |
3300034072|Ga0310127_001268 | Not Available | 29277 | Open in IMG/M |
3300034073|Ga0310130_0001996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10096 | Open in IMG/M |
3300034073|Ga0310130_0008385 | All Organisms → Viruses → Predicted Viral | 3765 | Open in IMG/M |
3300034073|Ga0310130_0021595 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2049 | Open in IMG/M |
3300034092|Ga0335010_0307097 | Not Available | 907 | Open in IMG/M |
3300034106|Ga0335036_0387101 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 903 | Open in IMG/M |
3300034109|Ga0335051_0196212 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1011 | Open in IMG/M |
3300034116|Ga0335068_0050077 | All Organisms → Viruses → Predicted Viral | 2451 | Open in IMG/M |
3300034121|Ga0335058_0077684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1936 | Open in IMG/M |
3300034166|Ga0335016_0003152 | Not Available | 15180 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 20.73% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 18.29% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.32% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.10% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.10% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.27% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.27% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.88% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.05% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 3.05% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.05% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.44% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.44% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 2.44% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.83% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.83% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.83% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.22% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.22% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.22% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.61% |
Drinking Water Treatment Plant | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant | 0.61% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.61% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.61% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2022920000 | Saline water microbial communities from Qinghai Lake, Tibetan Plateau - High mountain lake (unassembled) | Environmental | Open in IMG/M |
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300002384 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300011984 | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020503 | Freshwater microbial communities from Lake Mendota, WI - 03MAY2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020505 | Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020515 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020525 | Freshwater microbial communities from Lake Mendota, WI - 05MAR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020539 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020569 | Freshwater microbial communities from Lake Mendota, WI - 22AUG2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
QL_na_12117900 | 2022920000 | Saline Water | MTLSFSQDVYTEMVSVQQAQIQALQNKIQELQARIENLGAAINFII |
JGI12421J11937_1000181017 | 3300000756 | Freshwater And Sediment | MTLSFSSDVYTEMVQVQQAQIQALQNKVAELQARIEVLEQQSILFI* |
JGI12421J11937_100042267 | 3300000756 | Freshwater And Sediment | MTLSFSSDVYTEMVQVQQAQIQALQNKIQELEARIDVLEQQSILFI* |
JGI12421J11937_101632932 | 3300000756 | Freshwater And Sediment | MTLSFSQDVYTEMVQVQQAQIQALQNKIQELEARIEVLKQQSILFI* |
B570J29636_10019924 | 3300002384 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKIQELEARIEVLEQQSILFI* |
B570J29032_1091416583 | 3300002408 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKIQELEARI |
B570J29032_1092181691 | 3300002408 | Freshwater | MTLSFSADVYTEMVQVQQAQIQALQNKIQELEARIEVLEQQSILFI* |
B570J29032_1096887591 | 3300002408 | Freshwater | VMTLSFSSDVYTEMVQVQQAQIQALQNKVAELQAHIEVLQQQSILFI* |
JGI25908J49247_100149925 | 3300003277 | Freshwater Lake | MTLSFSQDVYTEMVQVQQAQIQALQNKIQELEARIEVLEQQSILFI* |
JGI25907J50239_10094794 | 3300003394 | Freshwater Lake | MTLSFSQDVYTEMVQVQQAQIQALQNKIQELEARIEVXXQQSILFI* |
JGI25907J50239_10549831 | 3300003394 | Freshwater Lake | MTLSFSQDVYTEMVQVQQAQIQALQNKIQELQARIEILEQQ |
JGI25907J50239_10601512 | 3300003394 | Freshwater Lake | MTLSFSQDVYTEMVQVQQAQIQALQNKIQELQARIDVLEQQSILFI* |
Ga0069718_100700534 | 3300004481 | Sediment | MTLSLSQEVYSQTIVAQQASIQALQNKVQELQARIEVLEQQAILFI* |
Ga0069718_100793601 | 3300004481 | Sediment | MTLSLSQEVYTQSMQAQQAQIQALQNKVEELKARIEVLEQQSHLFI* |
Ga0049083_100457631 | 3300005580 | Freshwater Lentic | MTLSFSQDVYTEMVQVQQAQIQALQNKIQELEARIEVLQQQSILFI* |
Ga0049081_1000050719 | 3300005581 | Freshwater Lentic | MTLSFSSDVYTEMVQVQQAQIQALQNKVAELQARIDVLEQQSILFI* |
Ga0049081_100410163 | 3300005581 | Freshwater Lentic | MTLSFSSDVYTEMVQVQQAQIQALQNKIQELEARIEILEQQSILFI* |
Ga0049081_102083312 | 3300005581 | Freshwater Lentic | MTLSFSSDVYTEMVQVQQAQIQALQNKVAELQARIEILEQQSILFI* |
Ga0078894_101226963 | 3300005662 | Freshwater Lake | MTLSLSQDTYSQTIVAQQAQIKALQDKVQELNARIEVLEQQAVLFI* |
Ga0078894_113590842 | 3300005662 | Freshwater Lake | LIIFVESNSNTNQMTLSLSQEVYSQTIVAQQASIQALQNKVQELQARIEVLEQQAILFI* |
Ga0079957_10669873 | 3300005805 | Lake | MTLSFSSDVYTEMVQVQQAQIQALQNKVQELEARIEVLEQQSILFI* |
Ga0075461_100278263 | 3300006637 | Aqueous | MTLNLSQDTYTQAVMAQQAQIQALQSKVQELEAKIQVLEQQSILFI* |
Ga0079301_11038832 | 3300006639 | Deep Subsurface | MTLSLSQDTYSQTIIAQQAQIKALQDKVQELSARIEVLEQQAVLFI* |
Ga0070749_100326613 | 3300006802 | Aqueous | MTLSLSQETYTQALQVQQAHIQALQNKVQELEAKIQVLEQQSHLFI* |
Ga0070749_100858865 | 3300006802 | Aqueous | MTLSLSQETYTQALQVQQAQIKALQEKVTELQAKVEVLEQQSHLFI* |
Ga0070749_104470812 | 3300006802 | Aqueous | MTLSLSQETYTQALQVQQAQIKALQEKVLELQAKVEVLEQQAILFI* |
Ga0075459_10260984 | 3300006863 | Aqueous | MTLSLSQEVYSQTIMAQQASIQALQNKVQELQARIEVLEQQAILFI* |
Ga0079300_100419953 | 3300007162 | Deep Subsurface | MTLSLSQDTYSQTIIAQQAQIKALQDKVQELSARIEVLEQQAILFI* |
Ga0075458_100623912 | 3300007363 | Aqueous | MTLSLSQETYTQALQVQQAQIKALQEKVTELQAKVEVLEQQAILFI* |
Ga0099847_100023622 | 3300007540 | Aqueous | MTLSLSQDTYSQTIIAQQAQIKALQDKVQELSARIEVLEQQSILFI* |
Ga0105747_11678471 | 3300007974 | Estuary Water | MTLSFSQDVYTEMVQVQQAQIQALQNKIQELQARIDILEQQSI |
Ga0114340_11940332 | 3300008107 | Freshwater, Plankton | MTLSFSSDVYTEMVQVQQAQIQALQNKIQELEARIEVLQQQSILFI* |
Ga0114341_1000092740 | 3300008108 | Freshwater, Plankton | LHICHVKQKPIIMTLSLSQDTYSQTIVAQQAQIKALQDKVQELNARIEVLEQQAVLFI* |
Ga0114841_100030033 | 3300008259 | Freshwater, Plankton | MTLSFSADVYTEMVQVQQAQIQALQNKVAELQARIEVLEQQAILFI* |
Ga0114841_10052321 | 3300008259 | Freshwater, Plankton | NQSVMTLSFSSDVYTEMVQVQQAQIQALQNKVAELQARIEVLEQQSILFI* |
Ga0114841_10191351 | 3300008259 | Freshwater, Plankton | PKLIIFVVSNLKTNQMTLSLSQETYTQALQVQQAQIKALQEKVLELQAKVEVLEQQAILFI* |
Ga0114841_10348001 | 3300008259 | Freshwater, Plankton | MTLSFSSDVYTEMVQVQQAQIQALQNKVAELQARIDVMEQQSILFI* |
Ga0114841_12308921 | 3300008259 | Freshwater, Plankton | FSSDVYTEMVQVQQAQIQALQNKVAELQARIEILEQQSILFI* |
Ga0114337_11617053 | 3300008262 | Freshwater, Plankton | VSNLKTNQMTLSLSQETYAQALQVQQAQIKALQEKVLELQAKVEVLEQQAILFI* |
Ga0114363_10856033 | 3300008266 | Freshwater, Plankton | VSNLKTNQMTLSLSQETYTQALQVQQAQIKALQEKVLELQAKVEVLEQQAILFI* |
Ga0114363_12055482 | 3300008266 | Freshwater, Plankton | VSNLKTNQMTLSLSQETYTQALQVQQAQIKALQEKVTELQAKVEVLEQQAILFI* |
Ga0114364_10630532 | 3300008267 | Freshwater, Plankton | MTLSFSSDVYTEMVQVQQAQIQALQNKVAELEARIEILEQQSILFI* |
Ga0114364_11592423 | 3300008267 | Freshwater, Plankton | MTLSLSQEVYSQTIVAQQASIQALQNKVQELQARI |
Ga0114876_11747581 | 3300008448 | Freshwater Lake | MTLSFSSDVYTEMVQVQQAQIQALQNKVAELQARIETLEQQSILFI* |
Ga0114880_100363017 | 3300008450 | Freshwater Lake | MMTLSLSQETYTQAMQVMQAQIKALQEKNLELQAKIEVLEQQSQLFI* |
Ga0114880_10664451 | 3300008450 | Freshwater Lake | RISCIFAKNLNQSVMTLSFSSDVYTEMVQVQQAQIQALQNKIQELEARIEVLQQQSILFI |
Ga0114880_11370303 | 3300008450 | Freshwater Lake | MTLSLSQETYTQALQVQQAQIKALQEKVLELQAKVEVLEQQAIL |
Ga0114880_12398962 | 3300008450 | Freshwater Lake | MTLSFSSDVYTEMVQVQQAQIQALQNKVAELQARIEVLEQQAILFI* |
Ga0105098_101764832 | 3300009081 | Freshwater Sediment | MTLSLSQETYTQALQVQQAHIQALQNRVQELEAKIQVLEQQSLLFI* |
Ga0105098_104654651 | 3300009081 | Freshwater Sediment | MTLSLSQEVYSQTIMAQQASIQALQNKVQELQARIEVLEQQAVLFI* |
Ga0105099_104423303 | 3300009082 | Freshwater Sediment | MTLSLSQDTYSQTIIAQQAQIKALQDKVQELSARIEVLEQ |
Ga0105103_106525252 | 3300009085 | Freshwater Sediment | MTFSLSQETYTQTVVAQQAQIQALQSKIDELQARIEVLEQQAILFI* |
Ga0129333_101394516 | 3300010354 | Freshwater To Marine Saline Gradient | MTLSLSQETYTQALQVQQSQIQALQSKIQELQARIEVLETQ |
Ga0129333_103483723 | 3300010354 | Freshwater To Marine Saline Gradient | MTLSFSQDTYTQALQVQQAQIQALQSKIQELQARIEVLETQAILFI* |
Ga0129333_108508123 | 3300010354 | Freshwater To Marine Saline Gradient | LFICGVKLKTNQMTLSLSQETYTQALQVQQSQIQALQSKIQELQARIEVLETQ |
Ga0129333_112221001 | 3300010354 | Freshwater To Marine Saline Gradient | MTLSLSQETYTQALQVQQSQIQALQSKIQELQARIEVLETQAILFI* |
Ga0119931_10141512 | 3300011984 | Drinking Water Treatment Plant | MTLSLSQDVYTQAMQAQQAQIQALQNKVDELKARIEVLEQQAILFI* |
Ga0164293_1001091614 | 3300013004 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKVAELQAHIEVLQQQSILFI* |
Ga0164293_101935372 | 3300013004 | Freshwater | MTLSLSQEVYTQSMQAQQAQIQALQNKVEELKARIEVLEQQAILFI* |
Ga0164293_102019572 | 3300013004 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKIQELQARIEVLEQQSILFI* |
Ga0164293_106749611 | 3300013004 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKIQELQARIDVLEQQSILFI* |
Ga0164293_110100162 | 3300013004 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKVQELEARIEVLQQQSILFI* |
Ga0164292_101256494 | 3300013005 | Freshwater | SDVYTEMVQVQQAQIQALQNKVQELEARIEVLQQQSILFI* |
(restricted) Ga0172367_101687144 | 3300013126 | Freshwater | MTLSLSQEVYTQAMQAQQAQIQALQSKVEELKARIEVLEQQSHLFI* |
(restricted) Ga0172365_100903812 | 3300013127 | Sediment | MTLSLSQDVYTQAIQAQQAQIQALQSKIHELQARIEVMEQQSHLFI* |
(restricted) Ga0172373_102873582 | 3300013131 | Freshwater | MTLSLSQDVYTQAMQAQQAQIQALQSKIHELQARIEVMEQQSHLFI* |
Ga0177922_104945913 | 3300013372 | Freshwater | VYTEMVQVQQAQIQALQNKIQELEARIEVLQQQSILFI* |
Ga0177922_105269723 | 3300013372 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKVQELEARIEVLEQ |
Ga0181338_10050552 | 3300015050 | Freshwater Lake | MTLSFSQDVYTEMVEVQQAQIQALQNKIQELEARIEVLEQQSILFI* |
Ga0181339_10151931 | 3300017700 | Freshwater Lake | MTLSFSSDVYTEMVQVQQAQIQALQNKIQELQARIDILEQQSILFI |
Ga0181364_10492271 | 3300017701 | Freshwater Lake | MTLSFSQDVYTEMVQVQQAQIQALQNKIQELQARIDV |
Ga0181347_11155452 | 3300017722 | Freshwater Lake | MTLSFSQDVYTEMMQVQQAQIQALQNKIQELEARIEILEQQSILFI |
Ga0181347_11516261 | 3300017722 | Freshwater Lake | FSQDVYTEMVQVQQAQIQALQNKIQELQARIEILEQQSILFI |
Ga0181347_11948622 | 3300017722 | Freshwater Lake | MTLSFSQDVYTEMVQVQQAQIQALQNKIQELEARIDVLQQQSILFI |
Ga0181362_10583141 | 3300017723 | Freshwater Lake | MTLSFSQDVYTEMVQVQQAQIQALQNKIQELEARIEI |
Ga0181365_10810442 | 3300017736 | Freshwater Lake | MTLSLSQDVYTEMVQVQQAQIQALQNKIQELEARIEILEQQSILFI |
Ga0181352_10118566 | 3300017747 | Freshwater Lake | LLKLKPITMTLSLSQETYTQALQVQQAQIKALQEKVTELQAKVEVLEQQAILFI |
Ga0181344_11098563 | 3300017754 | Freshwater Lake | MTLSLSQEVYSQTIVAQQASIQALQNKVQELQARIEVL |
Ga0181344_11855632 | 3300017754 | Freshwater Lake | MTLNFSQDTYTQALQVQQAQIKALQEKIYELQAKVEVLEQQNQLFI |
Ga0181356_11609402 | 3300017761 | Freshwater Lake | MTLSFSSHVYTEMLKVQQAQIQALQNKIQELEARIEILEQQSILFI |
Ga0181356_11824172 | 3300017761 | Freshwater Lake | YTEMVQVQQAQIQALQNKIQELEARIEILEQQSILFI |
Ga0181343_11606141 | 3300017766 | Freshwater Lake | TNQMTLSLSQEVYSQTIVAQQASIQALQNKVQELQARIEVLEQQAILFI |
Ga0181349_10863301 | 3300017778 | Freshwater Lake | EMVQVQQAQIQALQNKIQELEARIEVLEQQSILFI |
Ga0181349_11144634 | 3300017778 | Freshwater Lake | MTLSFSQDVYTEMVEVQQAQIQALQNKIQELEARIEILEQQSILFI |
Ga0181349_11505654 | 3300017778 | Freshwater Lake | MTLSFSSDVYTEMVQVQQAQIQALQNKIQELEARIEVLE |
Ga0181355_11302312 | 3300017785 | Freshwater Lake | MTLSLSQEVYSQTIVAQQASIQALKNKVQELQARIEVLEQQSHLFI |
Ga0181359_11668382 | 3300019784 | Freshwater Lake | MTLSFSQDVYTEMVQVQQAQIQALQNKIQELEARIEVLEQQSILFI |
Ga0207193_100360735 | 3300020048 | Freshwater Lake Sediment | MTLSFSSDVYTEMVQVQQAQIQALQNKVQELEARIDVLEQQSILFI |
Ga0207193_11599403 | 3300020048 | Freshwater Lake Sediment | MKLSFSQETYTQALQVQIAQIQALQCKVAELEAKLEVAEQANQIYI |
Ga0194115_100788504 | 3300020183 | Freshwater Lake | IFFYFCSVKLKPIIMTLSLSQDVYTQAIQAQQAQIQALQSKINELQARIEVMEQQYHLFI |
Ga0194115_100809935 | 3300020183 | Freshwater Lake | MTLSLSQDVYSQTIQAQLAQIQALQSKVDELQARIEVLEQQSHLFI |
Ga0194115_102916843 | 3300020183 | Freshwater Lake | MTLSLSQDVYTQAIQAQQAQIQALQSKINELQARIEVM |
Ga0194115_103029471 | 3300020183 | Freshwater Lake | QEVYTQAMQAQQAQIQALQSKVDELKARIEVLEQQSHLFI |
Ga0194116_105050571 | 3300020204 | Freshwater Lake | KTNQMTLSLSQEVYTQAMQAQQAQIQALQSKVDELKARIEVLEQQSHLFI |
Ga0211731_115135753 | 3300020205 | Freshwater | FSSDVYTEMVQVQQAQIQALQNKVAELQARIEILEQQSILFI |
Ga0208363_10088212 | 3300020503 | Freshwater | MTLSFSQDVYTEMVQVQQAQIQALQNKIQELEARIEVLQQQSILFI |
Ga0208088_10025053 | 3300020505 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKVQELEARIEVLEQQSILFI |
Ga0208234_10245392 | 3300020515 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKIQELEARIEVLQQQSILFI |
Ga0207938_10255993 | 3300020525 | Freshwater | YTEMVQVQQAQIQALQNKVQELEARIEVLQQQSILFI |
Ga0207941_10196553 | 3300020539 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNRIQELQARIDVLEQQSILFI |
Ga0207942_10134261 | 3300020549 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKIQELEARIEV |
Ga0208229_10489662 | 3300020569 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKVAELQAHIEVLQQQSILFI |
Ga0222714_101695453 | 3300021961 | Estuarine Water | SQDTYSQTIIAQQAQIKALQDKVQELSARIEILEQQSLLFI |
Ga0222714_103250341 | 3300021961 | Estuarine Water | LEFFFIFVVSNLKPITMTLSLSQEVYTQAMQAQQAQIQALQSKVDELKARIEVLEQQSHLFI |
Ga0222714_103818322 | 3300021961 | Estuarine Water | LYLLKQKPITMTLSLSQETYTQALQVQQAQIKALQEKVTELQAKVEVLEQQSHLFI |
Ga0222713_102553611 | 3300021962 | Estuarine Water | MTLSLSQEVYTQAMQAQQAQIQALQNKVEELKARIEVLEQQSHLFI |
Ga0222713_104801792 | 3300021962 | Estuarine Water | IFVVSNLKPITMTLSLSQEVYTQAMQAQQAQIQALQSKVDELKARIEVLEQQSHLFI |
Ga0222712_1000792523 | 3300021963 | Estuarine Water | MTLSLSQEVYTQAMQAQQAQIQALQSKVDELKARIEVLEQQSHLFI |
Ga0222712_100490918 | 3300021963 | Estuarine Water | SLSQDTYSQTIVAQQAQIKALQDKVQELNARIEVLEQQAVLFI |
Ga0222712_101417384 | 3300021963 | Estuarine Water | MTLSLSQEVYTQAMQAQQAQIQALQNKVDELKARIEVLEQQAILFI |
Ga0196903_10143753 | 3300022169 | Aqueous | MTLSLSQDTYSQTIIAQQAQIKALQDKVQELSARIEVLEQQSILFI |
Ga0181353_11231441 | 3300022179 | Freshwater Lake | PKLIIFVVSNLKTNQMTLSLSQETYTQALQVQQAQIKALQEKVTELQAKVEVLEQQAILF |
Ga0181354_11530602 | 3300022190 | Freshwater Lake | MTLSFSQDVYTEMVEVQQAQIQALQNKIQELEARIEVLEQQSILFI |
Ga0181351_10068643 | 3300022407 | Freshwater Lake | MTLSLSQEVYSQTIMAQQASIQALQNKVQELQARIEVLEQQAILFI |
Ga0181351_11876681 | 3300022407 | Freshwater Lake | MTLSLSQETYTQAVVAQQAQIQALQSKIQELQARIEVLEQQAIL |
Ga0208147_10417343 | 3300025635 | Aqueous | MTLSLSQETYTQALQVQQAQIKALQEKVTELQAKVEVLEQQAILFI |
Ga0208644_10088258 | 3300025889 | Aqueous | MTLSLSQETYTQALQVQQAHIQALQNKVQELEAKIQVLEQQSHLFI |
Ga0208788_10347061 | 3300027499 | Deep Subsurface | YICSVKLKPIIMTLSLSQDTYSQTIIAQQAQIKALQDKVQELSARIEVLEQQAVLFI |
Ga0209552_100360210 | 3300027563 | Freshwater Lake | MTLSFSQDVYTEMVQVQQAQIQALQNKIQELQARIDVLEQQSILFI |
Ga0208975_10002359 | 3300027659 | Freshwater Lentic | MTLSFSSDVYTEMVQVQQAQIQALQNKVAELQARIDVLEQQSILFI |
(restricted) Ga0247836_10877072 | 3300027728 | Freshwater | MTLSFSSGVYTEMVEVQQAQIQALQNKVAELQAHIEVLQQQSILFI |
(restricted) Ga0247836_11615742 | 3300027728 | Freshwater | MTLSFSSDVYTEMVEVQQAQIQALQNKVAELQARIEILEQQSILFI |
Ga0209442_11437461 | 3300027732 | Freshwater Lake | MTLSFSQDVYTEMVQVQQAQIQALQNKIQELEARIEV |
Ga0209593_101277553 | 3300027743 | Freshwater Sediment | RTFGKSIIYLHICPVKLKPIIMTLSLSQDTYSQTIIAQQAQIKALQDKVQELSARIEVLEQQAVLFI |
Ga0209246_101488223 | 3300027785 | Freshwater Lake | HMTLSFSQDVYTEMVEVQQAQIQALQNKIQELEARIEVLEQQSILFI |
Ga0209246_102717152 | 3300027785 | Freshwater Lake | MTLSFSQDVYTEMVQVQQAQIQALQNKIQELQARIEILEQQSILFI |
Ga0209287_103397631 | 3300027792 | Freshwater Sediment | PVKLKPIIMTLSLSQDTYSQTIIAQQAQIKALQDKVQELSARIEVLEQQAVLFI |
Ga0209107_1000072512 | 3300027797 | Freshwater And Sediment | MTLSFSSDVYTEMVQVQQAQIQALQNKIQELEARIDVLEQQSILFI |
Ga0209107_100030919 | 3300027797 | Freshwater And Sediment | MTLSFSSDVYTEMVQVQQAQIQALQNKVAELQARIEVLEQQSILFI |
Ga0209354_103988172 | 3300027808 | Freshwater Lake | MTLSFSQDVYTEMVQVQQAQIQALQNKIQELQARIEILEQQSI |
(restricted) Ga0247837_13351042 | 3300027970 | Freshwater | MTLSFSSGVYTEMVEVQQAQIQALQNKVAELQAHIEVLQQQSIL |
Ga0209079_100365163 | 3300027972 | Freshwater Sediment | KLKPIIMTLSLSQDTYSQTIIAQQAQIKALQDKVQELSARIEVLEQQAVLFI |
(restricted) Ga0247843_10406786 | 3300028569 | Freshwater | MTLSFSSGVYTEMVEVQQAQIQALQNKVAELQARIEILEQQSILFI |
(restricted) Ga0247843_12469981 | 3300028569 | Freshwater | SVMTLSFSSGVYTEMVEVQQAQIQALQNKVAELQAHIEVLQQQSILFI |
(restricted) Ga0247840_100739715 | 3300028581 | Freshwater | MTLSFSSDVYTEMVEVQQAQIQALQNKVAELEARIEILEQQSILFI |
(restricted) Ga0247841_104337391 | 3300029286 | Freshwater | MTLSFSSDVYTEMVEVQQAQIQALQNKIQELEARIEI |
Ga0307380_1001921812 | 3300031539 | Soil | MTLSFSQDVYTEMVQVQQAQIQALQNKIAELQARIDVMEQQSILFI |
Ga0307380_109708432 | 3300031539 | Soil | MTLSFSSDVYTEMVQVQQAQIQALQNKVAELQAHIDVMEQQSVQLI |
Ga0315907_103858484 | 3300031758 | Freshwater | VSNLKTNQMTLSLSQETYTQALQVQQAQIKALQEKVTELQAKVEVLEQQAILFI |
Ga0315288_109020553 | 3300031772 | Sediment | MTLSFSQDVYTEMVQVQQAQIQALQNKVQELQARIEVLEQQSILFI |
Ga0315909_1000164617 | 3300031857 | Freshwater | MTLSFSADVYTEMVQVQQAQIQALQNKVAELQARIEVLEQQAILFI |
Ga0315909_100344023 | 3300031857 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKVAELQARIDVMEQQSILFI |
Ga0315909_100564635 | 3300031857 | Freshwater | MTLSLSQEVYSQTIMAQQAQIKALQDKVQELNARIEVLEQQAVLFI |
Ga0315274_117082752 | 3300031999 | Sediment | MTLSFSQDVYTEMVEVQQAQIQALQNKIQELQARIDVMEQQSILFI |
Ga0315902_103428251 | 3300032093 | Freshwater | VSNLKTNQMTLSLSQETYTQALQVQQAQIKALQEKVLELQAKVEVLEQQAILFI |
Ga0334994_0003436_236_376 | 3300033993 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKVQELEARIEVLQQQSILFI |
Ga0334996_0503952_406_540 | 3300033994 | Freshwater | MTLSFSQDVYTEMVQVQQAQIQALQNKIQELEARIEVLQQQSILF |
Ga0334979_0027007_648_788 | 3300033996 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKIQELQARIEVLEQQSILFI |
Ga0334986_0179991_443_583 | 3300034012 | Freshwater | MTLSLSQETYTQALQVQQAHIQALQNRVQELEAKIQVLEQQSHLFI |
Ga0335023_0268376_570_710 | 3300034050 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKVSELEARIEVLEQQAILFI |
Ga0335023_0443605_2_127 | 3300034050 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKVQELEARIEVLEQQS |
Ga0334987_0343885_644_808 | 3300034061 | Freshwater | VSNLKTNQMTLSLSQETYTQALQVQQAQIKALQEKVIELQAKVEVLEQQAILFI |
Ga0334995_0001216_26314_26454 | 3300034062 | Freshwater | MTLSLSQETYTQALQVQQAQIKALQEKVLELQAKVEVLEQQSHLFI |
Ga0334995_0720648_2_124 | 3300034062 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKVQELEARIEVLEQQ |
Ga0310127_001268_3526_3666 | 3300034072 | Fracking Water | MTFSLSQETYTQTVVAQQAQIQALQSKIDELQARIEVLEQQAILFI |
Ga0310130_0001996_2654_2794 | 3300034073 | Fracking Water | MTLNLSQDTYSQALVAQQAQIQALQNKVQELEAKIQVLEQQSHLFI |
Ga0310130_0008385_972_1112 | 3300034073 | Fracking Water | MTLSLSQETYTQALQVQQAHIQALQNRVQELEAKIQVLEQQSVLFI |
Ga0310130_0021595_973_1113 | 3300034073 | Fracking Water | MTLSLSQETYTQTVIAQQAQIQALQSKIEELQARIEVLEQQSILFI |
Ga0335010_0307097_482_622 | 3300034092 | Freshwater | MTLSFSADVYTEMVQVQQAQIQALQNKIQELEARIEVLEQQSILFI |
Ga0335036_0387101_3_107 | 3300034106 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKIQELQARI |
Ga0335051_0196212_1_114 | 3300034109 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKVQELEARIEVL |
Ga0335068_0050077_2343_2450 | 3300034116 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKIQELQARID |
Ga0335058_0077684_736_876 | 3300034121 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKVAELQARIETLEQQSILFI |
Ga0335016_0003152_1658_1798 | 3300034166 | Freshwater | MTLSFSSDVYTEMVQVQQAQIQALQNKIQELETRIEVLQQQSILFI |
⦗Top⦘ |